2KHIA

Nmr structure of the domain 4 of the e. coli ribosomal protein s1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
WVAIAKRYPEGTKLTGRVTNLTDYGCFVEIEEGVEGLVHVSEMDWTNKNIHPSKVVNVGDVVEVMVLDIDEERRRISLGLKQCKANPWQQFAETH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 30S ribosomal protein S1
publication title Probing the relationship between Gram-negative and Gram-positive S1 proteins by sequence analysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosomal protein
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2khiA00
3EIVA 3CCVA 2K5VA 3GTQH 1A8VA 1YBYA 1FGUA 2JQOA 3GO5A 2KCTA 3EN2A 4LFAQ 3U4VA 2FXQA 3U4ZA 5IP7G 2CQOA 4X62Q 2UUBQ 4DR4Q 2D62A 2WB1E 1I94L 4JI7Q 3NBHB 3STBC 1L2FA 1HZCA 1L1OC 3CCJA 2ASBA 4BY7H 5LMUQ 1D8LA 3GD7A 3TREA 1SFOH 1KIXA 3W5OA 3K81C 4OO1G 1PH2A 2CCZA 4B3MQ 4TQUS 4UPAA 1XMQQ 1JT8A 4LWCA 3PO3G 2ZM6L 3GTLH 3S2HH 4IO9A 1VQGA 2D0OA 5GAHC 1VQLA 2VNUD 3NEMA 1VQHA 4L5QA 3CCQA 5IE8A 5JJKA 5FLMG 4A3EH 1KAWA 2MQHA 2DGYA 4YHHQ 3GTJH 1SROA 1DGSA 2N49A 1Q1BA 3H3VH 1KL9A 5FLMH 5IP9G 4DV3L 1JE5A 3J80i 4JI2Q 3J81i 2NVXH 2HQLA 4C3HH 4H02A 5IP9H 4IPGA 3I2ZA 2ID0A 4JI1L 4POFA 4C3IH 3RN5A 3PO2H 4A3DG 1HH2P 4A4IA 4X66Q 4DR1Q 4DV7Q 3HKSA 4IFDJ 4KHPL 3T1HL 1E7ZA 1HR0L 1D7QA 4QGUA 3CMEA 2HHHL 2I5HA 2MNAA 1V1QA 2IHEA 2VUMH 3UE1A 3VDYA 2R93H 4OONA 2UXCL 4LUVA 1PH9A 1GVPA 2NVQH 2A19A 2JA6G 2BA1A 2AHOB 4JOIC 1J5EQ 4GN3B 2UUCQ 1HNWQ 1L1OA 4DV1Q 4A3BH 1Y1VG 2I5LX 4YY3Q 1LTLA 5FJ8G 1X56A 1KRSA 5C44G 4LFCQ 3K7UC 4QY7A 1OXTA 4R1JA 1KRTA 2R7ZH 4DK3C 1Z47A 5FJ8H 4A3CG 4DV2Q 1FJGL 1VQCA 3U50C 2VS1A 4DAMA 5IY0A 1HZ9A 1X3FA 3RZDH 2RCNA 1EOVA 4A3CH 1I94Q 1VQ6A 2ES2A 4GOPC 3G6EA 1OXSC 3CCRA 1WJJA 1PHJA 4Y52H 1U5KA 4DV6L 1FL0A 3PUVA 1VQKA 3E9HA 3A5UA 1NMGA 4BBSG 1X6OA 2PI2A 4BY1H 1G291 4J15A 1IXRA 3IRBA 4TVAB 4JCVE 2ZM6Q 2E2JH 5HY6A 5HGQA 2OWOA 3D0FA 3GTOH 1BKBA 3S1RH 3M85A 2CWAA 4XTCS 3MXNB 2VW9A 3ULPA 1WCMG 1WI5A 3UDIA 1SE8A 2WAQE 2LXKA 3I4NG 3ULJA 3S1QH 4A3GH 2JA7G 5K36G 3B6YA 5DLQE 3CCLA 1M1KC 4HJ8A 1PVOA 4DV3Q 1YIJA 3I4NH 1AE3A 2N3SA 2AWOA 3JAMi 1X65A 4JC0A 2YTXA 4JI1Q 1NMFA 2PQAA 5C4JH 3HOUG 2UXBL 5J3BA 2GVAA 3AFQA 3PUYA 1WYDA 2KENA 3OTOL 5M3FH 4JOIA 3NENA 4ALPA 1GD7A 2K50A 4YWKA 1YI2A 4JI3Q 3T1HQ 1HR0Q 4HJ5A 1HNXL 1Z9FA 1EUJA 2QA4A 2HHHQ 3K0XA 1N9WA 4DUZL 2YTYA 3RLFA 4LUOA 4X64L 1BBUA 3J81j 1EIYB 2UXCQ 4WJ4A 1E24A 2RHQB 1NE3A 2IT1A 1P8LA 1NBWA 1PH1A 4GOPA 4GN5A 1AE2A 3ERSX 1QVFA 4L5RC 2E5LL 5JJIA 3U58A 2JA5G 2N78A 2I5MX 3KF6B 5E7NA 3FP9A 1KD1C 1S72A 4POGA 2R92H 2PI2E 1T9HA 3PF5A 3KFUA 1VQMA 2HIVA 1MJEA 2DUDA 2JA5H 5M5YH 3GTGH 4GKJL 1CSQA 2WFWA 4JI8L 2ALYB 1YJWA 3JAMc 3Q8DA 2NN6I 3HKZG 4R4TA 3PIOA 3G48A 4NXNL 3F2BA 4YCVA 1CKNB 2UU9L 2JA9A 2GVBA 4GLXA 4BA1I 4EQ5A 1XNQL 2IY5B 2A8VA 4DR5L 4C3JH 1MJCA 2VQFL 2MO0A 1XPOA 4BY7G 2JE6I 1PH8A 4APVA 1ASZA 4L5TA 5GAEC 1HJPA 3W1GA 1VQPA 1PH6A 4HIMA 4DKAC 3F2CA 4UY8C 2YTVA 3J7A5 1QUQB 3CCMA 2OQ0A 1A63A 5AJ3L 1Q46A 3CPWA 2VY3A 3HOXG 1Q7YC 2Y0SE 5ELNA 3CMAA 2VQEL 3PCOB 4A3KH 4JBJA 4A3EG 4JI4L 1HZBA 1H95A 1GM5A 4P73A 2QGQA 3HOXH 2UXBQ 4A3LH 3L7ZC 1N36L 1HR0W 4X6AH 1G6PA 1C0AA 3ULLA 4QIWE 3OTOQ 4L5SA 1GO3E 3F8TA 3AQQA 2LXJA 3BZCA 3HOZG 3S2DH 1VQNA 1CKOA 5M3MG 3PO2G 1B70B 1IYJB 2KCMA 3M7NA 3HOZH 4OWTB 1VQ9A 3CCSA 2VZAA 3UDXA 3KYHC 4DUZQ 2BH8A 5M3MH 1Q81C 1M90C 4X64Q 4AYBE 2UUAL 2ZJPA 1XPRA 2HT1A 1X55A 2VL6A 2ZJRA 4NB3A 4B3SL 1U0LA 2Z0SA 1K0RA 2VUMG 3HOWH 2R93G 3H15A 1K83H 2E5LQ 2WAQG 5GROA 1A0IA 3PSIA 4IFDG 4PZ7A 1I3QH 2R7DA 3RNUA 1I6HH 4IPHA 1B7YB 2K5HA 4A3BG 3LGJA 1S40A 3I55A 4GKJQ 4A93G 4DR2L 3CC2A 4JI8Q 3D31A 2R7ZG 2L15A 4O2DA 4NXML 4DR3Q 4A93H 3OW2A 1YNXA 1KC8C 2UU9Q 4LF5L 4NXNQ 2YYZA 1E3PA 1V43A 2RF4A 1N33L 5JJLA 4ME3A 2YV5A 1CSPA 3KLWA 4HIKA 2B29A 1HNXQ 4OO1I 5H1SE 1R9TH 1LYLA 1N8RC 4DAYB 1XNQQ 2AMCB 1SLJA 2H5XA 4DR5Q 1ASYA 2VQFQ 2F4VL 2EQSA 2IX1A 3PIPA 4HIOA 3M4OH 1RL2A 5ELOA 2JJQA 4BY1G 1PH4A 1HNZL 4LNQA 4B3TL 4WJ3M 1YJ9A 2JA8G 4OX9L 4LF7L 4MZ9A 4RMFA 3I7FA 4PZ6A 5AJ3Q 2K52A 3H0GH 3L0OA 1PA6A 4PG3A 1KQSA 1QZGA 2AKWB 1C7YA 5C0XJ 2JA8H 2VQEQ 4JV5L 3S16H 4K0KL 4P74A 2XGTA 4JI4Q 4JI0L 1UE1A 2OTJA 3UDFA 2CWPA 5IYBG 4A3GG 4LF6L 5C0XG 3E0EA 1N36Q 2CKZB 4JYAL 1LUZA 5IYBH 1N32L 3TS0A 4R4CA 2D0PA 5C3EH 4FDBA 1K73C 1JB7A 3GTPH 1VQBA 4GKKL 5LMNL 3CD6A 1UE7A 4R4QA 1YHQA 1VQEA 3RR5A 4B3RL 3BU2A 5M3FG 1C9OA 3JC66 2AWNA 4PMWA 1CKNA 2B3GA 1XTDA 2WB1G 2F3IA 3OYYA 1NTGA 4QQBX 4B3SQ 4KHPQ 4GLVB 2ZTCA 4OWXB 1TWGH 4LUZA 3I56A 4B3ML 1UE5A 4A76A 4X65L 5GADC 1XMQL 1KXLA 4DPGA 3CP0A 1AH9A 1UE6A 1JMCA 2Y0SG 1OXUA 3ICEA 2E2IH 5IYCH 4NXMQ 2R92G 3CW2C 1WFQA 1SR3A 3MEFA 4A3IG 1N33Q 2NVTH 1IZ6A 4YCWA 4C2MH 4YHHL 4GNXB 1EQQA 4JBMA 4A3JH 5GQOA 1FVIA 3PUXA 4O0AA 2YU9H 4A3IH 2F4VQ 4IJLA 2K4KA 1V9PA 4QJFA 3GTMH 4HJAA 4A3FG 5IWAL 1HNZQ 5EAYA 4B3TQ 1EQRA 4DV6Q 3G71A 1JJGA 3M4PA 4A3FH 2KBNA 1VQ4A 3TRZA 3I4MG 1S3OA 2PNHA 4LF7Q 4BA2I 4IPDA 3F1ZA 1TWCH 3STBD 5M5XH 1Y14B 2I0QA 4BXXG 3I4MH 3AYHB 4JV5Q 4DR7L 4K0KQ 1IBLL 3CCEA 4JI0Q 3KDFB 5GAGC 4BXXH 3PUWA 1YITA 4LF6Q 5JEAJ 3S17H 4JYAQ 3T1YL 3GTKH 4GS3A 1N32Q 1SN8A 2ZTDA 4XIGS 1VQDA 2MFIA 5M5WH 4A3KG 5JEAG 5IYDH 1E1OA 2PQAB 1PH7A 1Q12A 4DR3L 4IOCA 4GKKQ 3I4OA 3A5ZB 5LMNQ 4YWMA 4A3LG 4B3RQ 4DV2L 4P75A 1K3RA 1OXXK 3GDEA 4DNIA 3TEHB 1PH3A 2R7FA 4AH6A 1N34L 2E8GA 5IP7H 5BR8L 3UDGA 1VQ7A 1TWFH 2BA0A 4NPSA 4P72A 2PMZE 3E9IA 3PUZA 1PFSA 4OXPA 2ATWA 5C4XG 4X65Q 4GOPB 2Z6KC 3A0JA 3F2DA 2C35B 3SGIA 3CF5A 3HOWG 5C4XH 4JI5L 1YHBA 1GKHA 2IHFA 3CQZH 4DV5L 4LF9L 2N8NA 1O7IA 3CPFA 3KJOA 4DK6C 4GNXC 3PO3H 1VQ5A 1SMXA 1W2BA 4OWWB 2Q2IA 1PYBA 1MIUA 2EIFA 3AEVA 3J7ZC 1YJNA 2B63G 4A3MG 1XNRL 3S15H 2KHIA 4DR6L 2NZOA 1E22A 3WWVA 3S1MH 3DM3A 1TXYA 1CUKA 1X54A 1YVCA 1I5FA 1VCIA 4P71A 4DV0L 4A3MH 1X9NA 2B63H 1EIFA 2F52A 1E1TA 2XTIA 3UE0A 5IWAQ 4A75A 1FJGQ 1VQAA 1VQOA 1IBML 1MKHA 3HKZE 1QVGA 1I50H 2JK8A 2K14A 3TQYA 4PZ8A 1HZAA 4A3DH 4UP9A 3KOJA 3FHWA 1IBKL 4JI3L 2WP8J 4AQYL 3RLOA 3AFPA 4DR7Q 1NJIC 4YCUA 3M9BA 1IBLQ 4LF4L 1Q86C 3NELA 1PH5A 2OCEA 1TWHH 4BBRG 3H3VI 3ZJYC 1TWAH 4KLKA 3H0GG 3K8AA 3T1YQ 1A62A 4IPCA 4UP7A 1K9MC 2Q2UA 2UXDL 1B8AA 5LMNW 4BBRH 1YEZA 3CC7A 3ER0A 1UEBA 2JA6H 2NZHA 4DV4L 4LFBL 2LSSA 2ZTEA 1BVSA 4DUYL 1LM0A 1Y1VH 4R4IA 1Q8KA 2Z6KA 5C44H 5C3EG 1XJVA 2E2HH 1OTCA 3CAMA 1OXVA 1PV4A 4KI0A 1Q82C 4IJHA 1SRUA 2A1AA 1G51A 3KF6A 3J80c 3J81c 2KHJA 4GNXA 1XMOL 1N34Q 1JJ2A 5BR8Q 2R6GA 1KHIA 4KHZA 3KJPA 3RN2A 1X3EA 4LF8L 1QVCA 4Y7NH 1W3SA 1EFWA 4HIDA 2UUAQ 4IFDI 4EX5A 2CFMA 4LFAL 4JI6L 2UUBL 4DR4L 4X62L 1K8GA 4BBSH 4QL5A 4JI5Q 1L0WA 4GN4B 3PGZA 4DV5Q 3M4QA 2NVYH 2V1CC 4YWLA 1X3GA 4JI7L 4LF9Q 2NN6G 1YHAA 3RZOH 4MNOA 2BH2A 3S24A 3KF8B 5LMUL 4UP8A 1Q1EA 3W1BA 1P16A 3CCUA 3KDFA 4LW1A 2OTLA 1XNRQ 1L1OB 1WCMH 3A74A 5IYCG 4DR6Q 4DV0Q 2JA7H 3EBEA 4DR2Q 1QUQA 1XPUA 3S1NH 1EYGA 2RHSB 2K75A 4JI6Q 4A3JG 2EXDA 1IBMQ 1VQIA 4LF5Q 4R4OA 2HIXA 3K7AH 3HOUH 1BBWA 4AIMA 3TS2A 1YZ6A 4IOAA 2OQKA 1IBKQ 1CKMA 3PV0A 3FKIG 4MTNA 4HJ9A 4AQYQ 1Y1WG 4JI2L 1VQ8A 3HFZB 3RLNA 4LF4Q 3L2PA 3G4SA 3FKIH 2K5NA 4JG2A 4AYBG 1Y1WH 1RIPA 2ZJQA 3S14H 1VS0A 2IX0A 5C0XI 3HOYG 2Q2HA 2GN5A 4X66L 5IT9c 4DV7L 4DR1L 3CC4A 4OX9Q 2UXDQ 2MO1A 3HOYH 3BJUA 3BZKA 4GLAC 2Q2TA 1PYSB 5FLXc 1QZHA 3DLLA 3K80C 4RG1A 4DV4Q 4LFBQ 1IL2A 1NY4A 4DUYQ 3PF4A 1EWIA 1VQJA 2QEXA 1JJCB 5IYDG 1UWVA 3CXCA 1J6QA 1XMOQ 1J5EL 3HOVG 2UUCL 1WOCA 3M3YH 1HNWL 1VQFA 4DV1L 2JEAI 4YY3L 4JBKA 4LFCL 3HOVH 1K8AC 4LF8Q 2JEBI 4HJ7A 4JBWA
chains in the Genus database with same CATH superfamily
3EIVA 2EDGA 5CORA 4JI6Q 3U4ZA 4DR4Q 2FXQA 1PRTF 4X62Q 2CQOA 2EXZA 2K03A 1STGA 3HOUB 1D1IA 1X32A 1L2FA 3NBHB 3CCJA 2B2UC 3GD7A 1STHA 1SNPA 1PH2A 1Y1WB 2EZVA 4LWCA 3PO3G 2VNUD 1VQLA 4L5QA 1TWCB 2Z9HA 3P7JA 1AN8A 4A3EH 4RHSA 2RQXA 1KL9A 4JI2Q 2L5TA 4H02A 2JYOA 3KLSA 4OIJA 2RCFA 3G7LA 1W6JA 3HOVB 1TS4A 3EFXD 5CV5A 2EYLA 3HKSA 4CGYB 3T1HL 1HR0L 4Q5VA 1OO9B 2HCCA 3HZXA 2MNAA 1SE2A 2CW0C 2VUMH 2FMCA 1Y8OB 1SNMA 1PH9A 1SFOB 2A19A 2JA6G 2BA1A 3D4RA 1AW7A 5E4XA 4YY3Q 4QB4A 2K04A 1EY0A 4LFCQ 3S2HB 4R1JA 1JORA 2KVMA 2R7ZH 1KLUD 1VQCA 4GZYC 3NXWA 5IY0A 1X3FA 2RCNA 1Q3LA 4A3CH 2ES2A 2RDGA 4GOPC 1O78A 3CCRA 1PHJA 1WJJA 1U5KA 2KCNA 4BBSG 4J1MA 1HXYD 1WTRA 4J15A 1KDAA 4I7ZC 4JCVE 2CVRA 2PZUA 2E2JH 3C2PA 3D0FA 1ET6A 1BKBA 2PZWA 4HAEA 4XTCS 2WV6D 3MHBA 2XSCA 1LABA 2XRSD 4A3GH 4KHVA 2JA7G 2NBFA 3I4LA 1PVOA 1YIJA 3I4NH 2NVQB 5ELEA 3VR5A 1EWHA 2N3SA 1DOKA 4FP5D 4JC0A 2YTXA 2F0SA 1ILQA 2SOBA 4O42A 5M3FH 3VR2A 1Y1VB 2HCIA 1YI2A 4JI3Q 3DM1A 3MXUA 3T1HQ 1HR0Q 2F3VA 5C3XA 1N9WA 5CBAE 4DXGA 4C1NK 4DUZL 4X64L 4WJ4A 2RHQB 1JQYD 5IT9E 3CRKC 1TU2B 1P8LA 3GTOB 3HGBA 3D3RA 2N78A 1RHPA 2EE1A 1KD1C 1VF5C 4POGA 3PF5A 3SXHA 1NUCA 5LHY1 1ICFB 2K5DA 5M5YH 3RD4A 1CSQA 3S1QB 2Z1CA 3A56A 4JI8L 2K5QA 1DOMA 4KD3A 3Q8DA 3HKZG 4DR3L 1CHPD 3G48A 4NXNL 1EIGA 4FF4A 1F2LA 1HA6A 1XNQL 2A8VA 4BY7G 5IGGA 1XPOA 1MSGA 2F0JA 4G7ZC 3R2IA 1ASZA 4L5TA 4LAAA 1HJPA 3W1GA 4ABNA 2YTVA 5D3IB 1QUQB 5ELFA 3J7A5 1JC7A 2VY3A 3A7AB 2C9OA 3HOXG 2Y0SE 4RGMA 1H95A 3J80L 3GV3A 4JI4L 1HZBA 1GM5A 4XYOA 5C4HA 5KRUA 4K5WA 3L7ZC 1D6EC 4KY5A 2SDFA 1QILA 3AQQA 2LXJA 2EY1A 3O13A 1HUNA 3S2DH 4IALA 1YNND 4N9TA 3PO2G 1STYA 2KCMA 4DNRB 2PW5A 3UDXA 3KYHC 4DUZQ 2BH8A 5M3MH 1M90C 4X64Q 2ZJPA 2CHBD 5IODA 4H44C 5EGTA 1PXUA 5JVH3 3HOWH 2R93G 3H15A 4C3JB 5GROA 4N9PA 1PZID 1I3QH 4IPHA 3KF8A 2NTSA 3LGJA 1S40A 4DR2L 4JI8Q 2L15A 4NXML 1EFID 4DR3Q 4A93H 3OW2A 1YNXA 1WTPA 4NXNQ 5JJLA 1BCPC 5H1SE 1R9TH 1DYQA 3FPPA 1GUGA 1WTQA 1XNQQ 1CQVA 2F4VL 2IX1A 4E6IA 1STAA 5CV4A 1LT3D 2EOTA 1PTOH 1YJ9A 1G6ZA 4LF7L 3IFTA 5FO8B 2NUCA 2JA8H 1G8ZD 5CV9A 2AKWB 1IHZA 5J22A 4JV5L 4K0KL 4P74A 2XGTA 4JI4Q 2OTJA 1DM0B 4RA8A 4BS9A 3K5LA 3E0EA 4HTHA 4R4CA 2D0PA 1J9OA 1JB7A 2WAQB 5FKAC 1UE7A 1YHQA 1C9OA 2TSSA 2N88A 5LL6S 3JC66 4N8X1 1XTDA 4QQBX 2ZT9C 4N8FA 2L11A 1ONLA 2ZTCA 2CH4W 2E2DC 4LUZA 5CV7A 4CBVA 3M4OB 1XMQL 3CP0A 1AH9A 1OXUA 2CQAA 4ZQ3A 2IWHA 3OHXC 4NXMQ 1U4RA 1EY7A 1V8QA 2C5CA 4WFN3 3MEFA 1S5ED 1QOHA 3S9WA 5K5PA 2QW7A 4A3JH 1FVIA 4O0AA 1STNA 2F4VQ 4CDEC 5HURA 4RGTA 1GUOA 5C3EB 3OMGA 1DOLA 4A3FH 2A74C 2KBNA 1VQ4A 3I4MG 1S3OA 2PNHA 2QF7A 5EPJA 4IPDA 4LF7Q 4R8NA 2I0QA 4JV5Q 4K0KQ 5M3FB 4FYDA 2ZXOA 1RD9D 3PUWA 2DJFC 1KNEA 3GTKH 1GXDC 1SN8A 5M5WH 1PH7A 2PQAB 1Q12A 5EKKA 3I4OA 4Z9CB 4HMJA 2XWJB 3FEWX 4DV2L 5HGTA 3FRPB 1ML0D 1PH3A 5A35A 5FOBB 4DAVA 4RCOA 1SYBA 5BR8L 3UDGA 2BA0A 3K6OA 3K5NA 3WOEA 2PMZE 3PUZA 2HDLA 4OXPA 1UUPA 3TSSA 3F2DA 1CHQD 3K58A 5C4XH 3CQZH 2CW0D 3KJOA 3HG9A 2K7VA 1PYBA 2EIFA 2A69D 2R61A 2KHIA 3TDQA 1VMCA 2LFNA 2NZOA 3WWVA 4DR6L 2A73B 3DM3A 4A3MH 1EIFA 2HQEA 1E1TA 4M1UB 1FJGQ 5C3WA 1MKHA 1JWMD 1QVGA 4LMQD 2K14A 4PZ8A 3K59A 1LO5D 2H1EA 4KV6A 1BCPF 2K33A 3AFPA 3M9BA 1F2YA 1PLFA 1QWYA 3NQIA 1PH5A 2OCEA 4ID6A 4BBRG 1RKNA 4R9WA 3H3VI 1JWUD 3K8AA 1K9MC 3ITPA 5T1GA 5LMNW 1JOQA 4KJOA 3CC7A 1Q90A 4QUFA 2I07B 2Z4IA 4DV4L 1BVSA 3OMCA 4RAUC 4DUYL 4WJWA 1LM0A 3PO3B 5C44H 3NWSA 3HOWB 1GHKA 4XQNA 4KI0A 2B39A 2F4IA 3MA2B 1SRUA 1RTOA 2A1AA 3DHQA 3KF6A 3M4YA 1GJXA 1O7ZA 5BR8Q 1KHIA 1LTRD 1L0YB 3RN2A 2ZXPA 5EBDA 3I90A 4RFBA 1BBXC 1BF4A 4LFAL 1KTKA 1I50B 3M4QA 1R9TB 1YHAA 4MNOA 5LMUL 2NN6H 5BN3A 1TIID 2X6LA 5IYCG 4DR6Q 1EZ8A 1TWAB 4K5XA 2LKVA 1EY6A 3EBEA 4OELB 3N6RA 2HDMA 2K75A 4ODGA 2B2TA 4K2KA 1LTAD 4G57A 2JA6B 4R4OA 3HOUH 4AIMA 5CYUA 3R2TA 2MP1A 2E2HB 3DWPA 3FKIG 4FF1A 4HJ9A 3NQTA 2K5NA 4AYBG 1Y1WH 1RIPA 2ZXRA 3HOYG 1F2ZA 3J7AF 2Q2HA 3CC4A 4OX9Q 3U9SA 1VMPA 3BVMA 1TY0A 1H9RA 2EYMA 2Q2TA 1CI3M 1PYSB 2Q8RE 1QZHA 4RG1A 3T51B 4DV4Q 1GUTA 1ET9A 3KBXA 2NVYB 1EZ6A 4DUYQ 1F9RA 1KLGD 2QEXA 5JJZA 2JN4A 4P2CB 1J6QA 1I4XA 1HNWL 1VQFA 3HOVH 2M9VA 1UEAB 1Q81C 4PMCA 2K5VA 1BO0A 1A8VA 1GUSA 1FGUA 4LFAQ 3U4VA 2KCTA 1D5ZC 2V4DA 5IP7G 3HS0C 4PMBA 2QKIC 4ZKCB 2D62A 3STBC 4A3JB 1HZCA 5A2QE 1GHJA 3H94A 5LMUQ 5EKIA 3TREA 1SFOH 3W5OA 3K81C 2CCZA 4TQUS 3BS1A 5L37A 3DWAA 2IPKD 1TKWB 1SYDA 2X6GA 3S2HH 5GAHC 1VQHA 1ICWA 5IE8A 2DNCA 5JJKA 2F0EA 1KAWA 4YHHQ 3H3VH 1SROA 2N49A 1FNWA 2AQ1B 2F0KA 5FLMH 1JE5A 1NAPA 3J81i 4C3HH 3R8BA 2DY7A 5IP9H 1BCPD 1LLRD 3M3YB 3RN5A 4A3DG 5KYIA 1NR2A 4XQJA 2H4OA 1HQRD 3HKZB 4IFDJ 4KHPL 1HFNA 2B8FA 4QGUA 2I5HA 1ILPA 1EEFD 4F8MA 3UE1A 4K14A 3BYTB 4LUVA 4BY7B 2NVQH 3BVZA 1AFPA 1SJHD 2ICIA 4EVOA 1HNWQ 3MXPA 3I70A 4A3BH 3CKIB 4QY7A 1OXTA 1KRTA 3CQZB 5D14A 4DK3C 5FJ8H 4A3CG 5DM63 2EVBA 4DAMA 1HZ9A 3QB3A 1V1OA 1OXSC 4Y52H 5I6YA 2NVXB 1FL0A 2EJMA 4KKUA 5KEEA 3A5UA 5T1IA 2FFKB 5CR3A 3IRBA 3K57A 2OWOA 3GTOH 2A5HA 4MTKA 2CWAA 3MXNB 1WCMG 3OWEB 2WAQE 3I4NG 2QDLA 3S1QH 3CCLA 2XRQD 4K5VA 1AE3A 2BE5D 1AZQA 1D1KA 1T5EA 4DFAA 4HEDA 5J3BA 3AFQA 4CDCC 1L0XB 4FXGC 2KENA 1A2UA 1T5XD 4OHJA 3OTOL 3TN2A 4ALPA 2E76C 5ELBA 3RZDB 1EUJA 2QA4A 2KECA 1O7YA 1BBUA 2XNAC 3SK4A 3I72A 5ELCA 1Y8NB 5COYA 2IT1A 2LS01 2KHSA 3OIPA 4GN5A 1AE2A 1I6VC 1ZXTA 3ERSX 3PIP3 1EYAA 1ENFA 4M8AA 1PYWD 3QR8A 5JJIA 3S1RB 2FINB 2R92H 5E7NA 3FP9A 2PI2E 3KFUA 1VQMA 2HIVA 1W6KA 4C3IG 2F0FA 1PFMA 2ALYB 1YJWA 2RSOA 4R4TA 3PIOA 4YCVA 3ONAB 5IGFA 2F0DA 3NHHA 4IN3A 4GLXA 4EQ5A 2B2VA 2EY5A 1I4QA 2IY5B 1WD1A 4C3JH 2VQFL 2MO0A 1RCVD 4APVA 1PFNA 1K0SA 1FYCA 1SE4A 2OQ0A 1B9NA 2AQ3B 2PMZB 5ELNA 4U68A 4JK1C 1SYCA 2WACA 4P73A 2SEBD 3WOFA 5IOCA 1N36L 1HR0W 1C0AA 3OTOQ 1S5BD 1K3BC 1VQNA 5M3MG 1B70B 2JA5B 3GTGB 3CCSA 2Z4HA 2HT1A 5DAUA 1X55A 1NNXA 3OPOA 4IFDG 3FVQA 1B7YB 3MXNA 4R8IA 4JPBW 4X3UA 3I55A 4A93G 1XWEA 3TP6A 2L0CA 1KNAA 4O2DA 4LF5L 5JAVA 1JCKB 1V43A 1V1PA 1HNXQ 1CSPA 1A3TA 1LYLA 2FMMA 2NWGA 3LX0A 1ASYA 2VQFQ 3M4OH 3H6MA 2OF1A 5ELOA 3J81E 5FLXL 4BY1G 1PH4A 4C3HB 2JA8G 5EPKA 2G9HD 3HOZB 3X3MA 3IAYA 4RMFA 3I7FA 3H0GH 4PG3A 4G7OC 4L6TB 2K5WA 4JW0A 4LF6L 1N36Q 3NWTA 1KDCA 4QMGA 1TT2A 1VDZA 5C0XH 5C3EH 3TS0A 2BDNA 1CA5A 3VYSA 5E1FA 1VQBA 4NP5A 3BU2A 4ZYSA 4A3BB 2ICEC 4DNTB 4EQOA 4IUVA 2WB1G 2F3IA 3OYYA 4RH6A 4I7AA 3T16A 3HRZC 2PNRC 4HSVA 3A54A 4OWXB 3NBHA 4B3ML 2NB0A 5GADC 1KXLA 3K0YA 1UE6A 2Y0SG 2A6HC 4HCSA 1RTNA 3SVMA 5C5LA 4NW2A 1WFQA 4TRDA 1SR3A 3S16B 2NVTH 1IZ6A 2O2LD 3ERQA 1EQQA 3BZDB 4JBMA 1B2TA 4PNYA 1FNUA 1MI2A 1GUWA 3E6ZX 1V9PA 2WKCA 4V190 4A3FG 1UNSA 4WRDA 4FVMA 4IURA 3GTPB 1JJGA 4RCNA 1GOZA 1MHWC 3Q0AA 3TRZA 3SK6A 3STBD 4IZ8A 3P1HA 1Y14B 1EL0A 1S5FD 1H9JA 1HFGA 1SNCA 3AYHB 4KN7C 1IBLL 3CCEA 2F03A 4LF6Q 2KEEA 4GS3A 4XIGS 4EGVA 1VQDA 2MFIA 4A3KG 5D3DA 4V0BA 5IYDH 4KKTA 4J6HA 3VYUA 3A5ZB 5EJWA 4F87A 5JEAH 4A3LG 2E2IB 4ZK9B 4X3TA 2E75C 4P75A 1D2BA 1K3RA 3TEHB 2R92B 4AH6A 2E8GA 4QIWB 1TWFH 4A3IB 1HA5A 1BOSA 1WTVA 1HHVA 1PFSA 5C4XG 4GOPB 1U4PA 2C35B 2ENBA 2VB3X 3CF5A 1YHBA 1GKHA 4DV5L 1O7IA 3CPFA 3PO3H 3KK7A 5M5XB 1SMXA 2F0IA 1QB5D 4OWWB 1MIUA 4ZKBB 1YJNA 3D8GA 1F9QA 4A3MG 2B2YA 1E22A 1KDBA 1X9NA 1I5FA 1H9KA 2F52A 4EQPA 3UE0A 3D4WA 1VQOA 3HKZE 5M9OA 1I50H 2JK8A 3D6WA 4UP9A 1CM9A 4IUNA 2WP8J 4AQYL 3RLOA 1NJIC 1IBLQ 3NELA 2B2TC 1TWAH 2A6EC 1B8AA 1YEZA 3TP7A 5KNDA 2JA6H 2FJ2A 4LFBL 1AZPA 5BN5A 2ZTEA 3ZYYX 3JAML 2Z6KA 2E2HH 3CAMA 1OXVA 4K6LA 1XMOL 3J80c 3VYRA 3S1MB 5CGKA 2R6GA 4KHZA 2B63B 2KA7A 1B4OA 4B9XA 2CFMA 2F0GA 1IL8A 4BBSH 4IUUA 1LT6D 4DV5Q 1M4VA 2B8GA 2NVYH 4RWSC 1BDOA 2NN6G 2MHVA 4A3DB 3C3LA 1Q1EA 4K8IA 3CCUA 4HSPA 4LW1A 2A68C 1L1OB 1LTBD 1XX8A 3A74A 1MSHA 1HQMC 3E5SA 5ELDA 2JA7H 4DR2Q 1QUQA 4KTAA 3LNNA 1EYGA 3H0GB 1VQIA 3NBIA 1BUVT 1XYIA 3EA6A 3K7AH 1YZ6A 4FXDA 2OQKA 3PV0A 4NMZA 4AQYQ 1Y1WG 3NE5B 1BQQT 3MFYA 1VQ8A 3RLNA 4JG2A 2ZJQA 2IX0A 2F0MA 4X66L 4DR1L 3L9AX 4DV7L 4Y7NB 2XN9C 4GLAC 2DNEA 4LFBQ 3NTIA 1NCVA 1KAAA 1RF2D 3Q23A 3H09A 3RZOB 1S5DD 2CH4A 1EYDA 2I46A 1XMOQ 1J5EL 3HOVG 2UUCL 3M3YH 1WCMB 1H9SB 4DV1L 1QE6A 1ESRA 4JBKA 5I4DA 4DAPA 2F0TA 5E4WC 4ZCKA 2RKSA 2JEBI 3D4DA 3C1EA 4DA2A 4G7HC 3GTQH 1YBYA 3GO5A 2LMCB 4OEMB 5IGDA 2NVTB 3Q6SA 1BCPB 1JOKA 4IUQA 3OOCA 2ASBA 4BY7H 1PTOC 1KIXA 3MFGA 4C56C 4OO1G 3URYA 1G2TA 1MGSA 4UPAA 1XMQQ 1O80A 1VQGA 4I65A 1EQTA 1K8MA 3NEMA 3CCQA 3NTHA 5FLMG 3SK5A 4Q0FA 1U4MA 5KYLA 1Q1BA 3QOJA 5IP9G 4DU9A 2AUKA 2NVXH 3EVQA 1J8IA 4IPGA 1E2VA 4POFA 3PO2H 4X66Q 4DR1Q 2PPBC 4DV7Q 2J7ZA 4KY6A 2FHTA 1QNUA 1E7ZA 1D7QA 2F0NA 3CMEA 2MPMA 2RA4A 1ENCA 1V1QA 2IHEA 2R93H 3C1FA 1TWFB 1K28A 2AHOB 1J5EQ 2UUCQ 3OWFA 4OGQC 1L1OA 4DV1Q 1Y1VG 2I5LX 5FJ8G 4CKCA 3DEOA 1SJED 1EQVA 5CV8A 4DV2Q 2O5JC 1I4HA 3RZDH 1EOVA 2PO4A 4LK1C 4JVZA 4DV6L 1VQKA 4G4KA 1WTXA 2PI2A 3TP8A 4PQXA 2EYJA 5HY6A 5HGQA 3S1RH 3M85A 4K8JA 3MZ5A 3ULPA 2XVSA 3UDIA 2A6HD 2E74C 2LXKA 2L4NA 1IW7C 3B6YA 5DLQE 1M1KC 2B2VC 4HJ8A 4S3SA 5I9OA 5K36H 1R4PB 1B1ZA 1WTHA 2PQAA 3MWYW 1O7LA 4HCEA 4H0LC 2GVAA 3CU7A 2D2CC 3QOLA 1B3AA 3NSWA 4JOIA 2K50A 4YWKA 4HJ5A 1SMYC 1HNXL 1Z9FA 2PZTA 2JSOA 2YTYA 1PZKD 3J81j 4KY7A 1MD2D 1E24A 1NE3A 5FO9B 3MTSA 1NBWA 5FO7B 1PH1A 1QVFA 1R4QB 2E5LL 4BBSB 2G9DA 5NUCA 4KJNA 2M2LA 1S72A 3J7AV 1G91A 2DUDA 2JA5H 3GTGH 1B53A 1SNQA 5I9PA 4GKJL 4K6DA 2PYKA 2WFWA 1SEBD 2UU9L 3DXJC 1CKNB 2JA7B 1E0BA 4C3JG 5C4JB 1TQOA 4DR5L 3K7AB 4ZAIA 2PQEA 3T13A 3NTKA 1VF7A 2J0TD 3L3OC 5GAEC 1VQPA 1PH6A 4DKAC 3SE0A 5JOBA 3F2CA 4UY8C 3EQLC 3LWEA 1LTID 1PTOF 1A63A 5AJ3L 2WIIB 1CFMA 1A15A 1TS2A 2VQEL 3J81L 4JBJA 4A3EG 2BOSA 3DWQA 1A3VA 1PRTC 4HMIA 3QG1A 5DNFA 4X6AH 3ULLA 4QIWE 1GO3E 4QUCA 1CKOA 3KUPA 1IYJB 1SE3A 3M7NA 5TSSA 3HOZH 4OWTB 1VQ9A 4XDXA 2OT2A 2M00A 4ZRZA 4AYBE 2UUAL 2O4XA 1XPRA 4NB3A 4XT3B 2IX3A 4B3SL 1U0LA 3GTQB 1K0RA 1EY4A 2VUMG 1B50A 2E5LQ 2D5DA 2WAQG 1A0IA 2A6ED 1D5MC 2R7DA 4O1NA 2BCOA 2F0LA 4PV1C 2K5HA 3VR3A 5FK9C 4CJ2C 4GKJQ 4XT1B 3CC2A 3D31A 2R7ZG 2F3WA 3VYTA 3CHBD 1KC8C 2UU9Q 5F2DA 2YYZA 1E3PA 2RF4A 2EY6A 3FPUB 4A3KB 1N33L 2YV5A 3KLWA 4HIKA 3HOXB 4DAYB 2AMCB 5IT9L 2H5XA 4DR5Q 1B9MA 5I2YA 3E0JA 2EQSA 2OEOA 4HIOA 1RL2A 2JJQA 1CZWA 4B3TL 5E3FA 1AEXA 1MBYA 3PO2B 5AJ3Q 4PZ6A 1TS5A 2K52A 3NK9A 1PA6A 1KQSA 3VA5A 1QZGA 2VQEQ 3S16H 1TR5A 2A68D 2CWPA 4A3GG 2K1BA 5C0XG 1HCZA 1LTSD 5EPLA 2CKZB 4TKOB 1K83B 4U673 4H13C 5IYBH 3EROA 3ND8A 4OL7A 2R93B 2MGSA 1K73C 4OIKA 3GTPH 4GKKL 3WDNA 4R4QA 1VQEA 5M3FG 1Z7TA 2AWNA 4PMWA 1CKNA 4B3SQ 4KHPQ 4GLVB 1FGBD 3I73A 1TWGH 3I56A 2OXPA 2JXMB 1IKMA 1EY5A 4RHRA 4X65L 4MIUA 2E2IH 4L63B 5IYCH 5ISRA 3D6CA 3CW2C 1SNDA 1N33Q 3H3VC 4GNXB 1BNZA 3PUXA 2K05A 4A3IH 2K4KA 4QJFA 2GA4B 1Z6HA 4B3TQ 2WINB 1KABA 3G71A 5BN4A 4BA2I 3F1ZA 4DK0A 2B2YC 5M5XH 2IJ0A 1SAPA 1PTOD 5JVG3 2F0HA 5GAGC 4BXXH 1YITA 4HN7A 2ZTDA 5JEAG 1WVLA 4B08A 1U9RA 3A7LA 4IOCA 4GKKQ 3U9OA 4CKEA 5JPMC 4C2MB 3AU7A 2R7FA 4DAYA 5IP7H 2YU9B 4NPSA 4P72A 4YIJA 3E9IA 2ATWA 5IIFA 4X65Q 2Z6KC 1XTCD 3SDZA 4RKBA 3HOWG 1QCBD 2JP1A 5CC4A 2IHFA 1EY9A 5KGUA 1U4LA 3K5OA 1JB3A 3I4MB 1XNRL 3M7GA 1X3PA 3S1MH 1TXYA 1X54A 5IGEA 4DV0L 2B63H 1YNJC 4P71A 5I6WA 3BDLA 4C1NI 4A75A 1IBML 1WD0A 1SNOA 3TQYA 3AMUA 4A3DH 3KOJA 4JI3L 2Q8TA 1M8AA 4YCUA 4KN4C 4NKLA 3QJYA 4DK1A 2WKDA 1LTTD 3FDTA 4UP7A 2UXDL 2A69C 5KNCA 2F0PA 2F0OA 2KJXA 2NZHA 3DUZA 2LSSA 4FF2A 1ZEQX 1IW7D 4R4IA 3Q24A 1Q8KA 1RJTA 2KCCA 1IYUA 1GUNA 4IJHA 3TP5A 4GNXA 3S15B 3V05A 2IL8A 3KJPA 3S17B 1WTWA 4Y7NH 4RGNA 1W3SA 1EFWA 4HIDA 4DXFA 4IFDI 4EX5A 1SMYD 3SR1A 2UUBL 2AQ2B 3T4AC 1K8GA 2LY7A 4GN4B 3PGZA 4JI7L 2V1CC 4YWLA 1X3GA 5EKLA 1LV9A 4FF3A 3RZOH 2BH2A 3KF8B 2EJGC 1IKLA 4UP8A 3X3NA 1LT4D 3I8ZA 2OTLA 1XNRQ 1TWHB 1WCMH 1CA6A 2IW3A 2KUMA 4DV0Q 1XPUA 5G3LF 4BBRB 1BXTA 2RHSB 1FR3A 4A3JG 2EXDA 1IBMQ 4LF5Q 1I4GA 4WORA 2HIXA 3KBGA 3TS2A 5CV6A 2G5DA 3HFZB 4IUTA 4J8QA 3G4SA 3S14H 2B2WA 3P75A 1VS0A 4RGOS 2UXDQ 3DEPA 2MO1A 3BJUA 3SHLA 4X3SA 5FLXc 3DLLA 2EYFA 5J1ZA 2DN8A 1UWVA 1TWGB 2P5ZX 1WOCA 1IYVA 4FO2A 1PRTD 3RMHA 1K8AC 2K01A 4C3IH 3S1NB 4HJ7A 1WTOA 1CQFA 3CCVA 3GTMH 2JQOA 3EN2A 2UUBQ 2NTTA 3FMCA 4XQQA 2WB1E 1I94L 4JI7Q 1L1OC 3E3XA 1D8LA 5J39A 1A3UA 4B3MQ 3K5MA 3FKIB 1JT8A 1LT5D 2ZM6L 3GTLH 1CZGA 4IO9A 1JWSD 2D0OA 3IFDA 4AYBB 3MXGA 2L12A 3HOYB 5C5MA 2MQHA 4BWGB 1ZYRC 2DGYA 3GTJH 1DGSA 2QDBA 4DV3L 3J80i 2HQLA 2F0UA 5C4ZA 4JI1L 3I2ZA 2ID0A 1CK1A 4MHEA 2F1MA 1HH2P 4A4IA 4CKBA 1E2ZA 1II3A 3OW7A 3BG3A 2HHHL 2PW7A 3PIO3 3J7YW 3VDYA 4OONA 2UXCL 2EPBA 1B3QA 1GVPA 2L1BA 2QEJC 4IFDH 4JOIC 2RDHA 3GV6A 4GN3B 3DMUA 1LTLA 2B2UA 1X56A 1KRSA 3N52A 5C44G 3K7UC 3ND9A 4FNFA 2X69A 1Z47A 1HUMA 3U50C 2VS1A 4CJ0B 1C48A 3I91A 2TMPA 4A3EB 1I94Q 1VQ6A 4ILWA 1JOOA 3G6EA 3QO2A 3PUVA 2KEDA 3E9HA 1NMGA 3A55A 1X6OA 4BY1H 1G291 3IKJA 1IXRA 4TVAB 2ZM6Q 1QJOA 2AUJD 3BDOA 2KQ3A 4DGZA 2XIWA 2VW9A 5G3LD 1WI5A 3A8JE 1C4QA 1SE8A 1SYFA 3ULJA 1PMRA 5K36G 2L55A 2K28A 2VUMB 4ME5A 4DV3Q 5DEHA 5A2QL 2AWOA 3QWNA 3JAMi 1X65A 4JI1Q 1DD2A 5C4JH 1NMFA 3HOUG 2UXBL 2Q8IB 3PUYA 1WYDA 4L8JA 2RDFA 1HTPA 1QG7A 4K2LA 3NENA 2R7ZB 1GD7A 1TS3A 1A2TA 1A6XA 2J4XA 1LTGD 1H9MA 2HHHQ 3K0XA 3RLFA 3VR4A 4LUOA 5KIXA 1EIYB 2UXCQ 4CJ1B 3PQIA 4GOPA 3RUZA 4L5RC 5FLXE 2E2JB 2K32A 3U58A 4ZLTF 2JA5G 1STBA 2BE5C 2I5MX 3KF6B 1T9HA 2QCPX 1MJEA 1EYCA 4A3GB 3JAMc 2NN6I 1FNVA 3F2BA 1FJGL 3I4NB 2JA9A 2L9HA 2GVBA 4BA1I 1AP0A 4XXEA 2HUGA 1HRJA 1FD7D 1MJCA 3EJIA 2JE6I 1PH8A 1EIHA 2KOLA 1K8OA 4HIMA 4MN3A 3CCMA 3S14B 3CPWA 1Q46A 1Q7YC 3CMAA 4UDUC 3PCOB 4A3KH 4TSSA 3NUCA 2QGQA 3HOXH 2UXBQ 1DONA 1TY2A 3T56B 4A3LH 1DCZA 1G6PA 4L5SA 3NP8A 2SNSA 3F8TA 1YNJD 3R3OA 4C3HG 3BZCA 3HOZG 5KNBA 4FXKC 4DN4M 1EU3A 3GQBA 1ENAA 1JICA 5M5YB 2VZAA 3V2TA 3TZDA 1PDQA 1BR9A 4KMUC 2VL6A 2ZJRA 3W3AA 4C3IB 1F2MA 3G6JB 4QF4A 2F0WA 2Z0SA 2EYOA 3GTMB 3R93A 1E2WA 1K83H 1TVXA 3PSIA 3UI2A 4PZ7A 1I6HH 3RNUA 4B9WA 1F9SA 5AFWA 4A3BG 2QILA 1PFBA 1I4RA 3GTLB 3MEHA 3SEBA 4ME3A 2B29A 4OO1I 1N8RC 1SLJA 3TZUA 3GTJB 3PIPA 3BDCA 3J80E 3S2DB 1HNZL 4LNQA 4QCLA 2EJFC 4IQZA 1NR4A 4WJ3M 2RBMA 4OX9L 4MZ9A 5M3MB 5C6AA 3L0OA 5LL6X 1C7YA 5C0XJ 1SSOA 4JI0L 1UE1A 4LJZC 4UAIA 3UDFA 5IYBG 1DJRD 1EEID 4JYAL 1LUZA 1N32L 1I3QB 4FDBA 3H91A 1XXGA 5LMNL 3CD6A 4B3RL 3RR5A 3KLSX 1H9SA 4A93B 2MJ8A 1RDPD 2B3GA 3OSOA 1EWCA 1NTGA 3BVGA 3CRLC 2NZ1D 1D5XC 1UE5A 2RVLA 4A76A 4DPGA 1JMCA 1PTOB 1PZJD 3ICEA 4BY1B 5I2XA 2R92G 3W2DA 2O5IC 2JA8B 1DZ1A 4A3IG 4YCWA 5EBCA 4C2MH 4YHHL 1S4ZA 4RKLA 1NSNS 2EYHA 1I4PA 2SNMA 5GQOA 3VA7A 2YU9H 4IJLA 1ESFA 4HJAA 5IWAL 1HNZQ 5EAYA 3PMFA 1EQRA 3JAME 4DV6Q 1QNKA 3M4PA 3C46A 4F88A 1TWCH 4KD4A 4BXXG 3A8IE 3I4MH 4DR7L 4CHTB 4JI0Q 3KDFB 5EQ0A 1SYGA 5JEAJ 2WB1B 4JYAQ 3T1YL 1N32Q 1E1OA 3GP7A 2NYZD 1Q8IA 5IGCA 1ZYRD 5LMNQ 4YWMA 2PCFB 4B3RQ 1SDFA 3A8KE 2Y0SB 1OXXK 5IGBA 2VB2X 3GDEA 4DNIA 1STEA 1SYEA 1N34L 1VQ7A 2XWBB 4EQNA 3I3CA 3IL8A 3LWUA 3MAQA 2F0QA 3A0JA 3SGIA 4OO1H 3VR6A 4JI5L 4A3FB 1ZKOA 1F77A 2N8NA 1F9PA 3TBIB 4GNXC 4NDXA 4DK6C 4LF9L 1VQ5A 1W2BA 2Q2IA 3SK8A 3AEVA 3J7ZC 3MVVA 3OIQA 2B63G 3S15H 3P20A 3GTKB 5CBEE 1CUKA 3S17H 1EOTA 1YVCA 1VCIA 5D65A 5M5WB 5IWAQ 2XTIA 1YNNC 1C8CA 1VQAA 1Y69U 1HPCA 3AB9A 1HZAA 2Z6BA 3FHWA 1JR0D 1IBKL 4DR7Q 3QIAA 2DJGC 4LF4L 1Q86C 1TWHH 4CDFC 3KLRA 3ZJYC 4IUPA 4KLKA 3H0GG 3T1YQ 1UAPA 1A62A 4H7BA 4IPCA 2Q2UA 1EU4A 4BBRH 3BYYB 3ER0A 1UEBA 3HP3A 3F2UA 5C4XB 5DM73 4ZUIA 1Y8PB 5JPNC 1Y1VH 1XJVA 2B2WC 2Z8LA 5C3EG 3Q22A 1OTCA 1PV4A 1Q82C 1I6HB 1RODA 1G51A 3J81c 2KHJA 1JJ2A 1N34Q 1CT1D 4KKSA 4LF8L 1LACA 1X3EA 4A3MB 1QVCA 1DXMA 2UUAQ 4X3KA 4JI6L 4DR4L 1SXTA 4X62L 4QL5A 4JI5Q 1L0WA 1SBBB 4ZUJA 4DF7A 1JE4A 4LF9Q 2VXWA 3S24A 3V96A 4ULLA 2R3ZA 4UHVA 3W1BA 5CMDA 1P16A 3KDFA 2RSNA 1CTMA 3S1NH 1V1PB 3NPPA 2MUYA 2BDOA 4F7XA 3HEJA 1BBWA 1HTLD 4IOAA 5C44B 1IBKQ 1PRTB 1CKMA 2K6AA 4MTNA 4JI2L 2N55A 4LF4Q 3L2PA 4KK7A 3T53B 3FKIH 1B44D 5C0XI 2DY8A 2GN5A 5IT9c 4HR7B 2HD3A 3HOYH 3BZKA 1G2SA 3K80C 1IL2A 4XYQA 4CDDC 1NY4A 2EYPA 1X3QA 3PF4A 1EWIA 2F0VA 1VQJA 1JJCB 5IYDG 2D9UA 1EY8A 2EY2A 3CXCA 1S5CD 3TMEA 2JEAI 4YY3L 4LFCL 4LF8Q 3MC0B 4JBWA
chains in the Genus database with same CATH topology
3EIVA 3CCVA 2K5VA 3GTQH 1A8VA 1YBYA 1FGUA 2JQOA 3GO5A 2KCTA 3EN2A 4LFAQ 3U4VA 2FXQA 3U4ZA 5IP7G 2CQOA 4X62Q 2UUBQ 4DR4Q 2D62A 2WB1E 1I94L 4JI7Q 3NBHB 3STBC 1L2FA 1HZCA 1L1OC 3CCJA 2ASBA 4BY7H 5LMUQ 1D8LA 3GD7A 3TREA 1SFOH 1KIXA 3W5OA 3K81C 4OO1G 1PH2A 2CCZA 4B3MQ 4TQUS 4UPAA 1XMQQ 1JT8A 4LWCA 3PO3G 2ZM6L 3GTLH 3S2HH 4IO9A 1VQGA 2D0OA 5GAHC 1VQLA 2VNUD 3NEMA 1VQHA 4L5QA 3CCQA 5IE8A 5JJKA 5FLMG 4A3EH 1KAWA 2MQHA 2DGYA 4YHHQ 3GTJH 1SROA 1DGSA 2N49A 1Q1BA 3H3VH 1KL9A 5FLMH 5IP9G 4DV3L 1JE5A 3J80i 4JI2Q 3J81i 2NVXH 2HQLA 4C3HH 4H02A 5IP9H 4IPGA 3I2ZA 2ID0A 4JI1L 4POFA 4C3IH 3RN5A 3PO2H 4A3DG 1HH2P 4A4IA 4X66Q 4DR1Q 4DV7Q 3HKSA 4IFDJ 4KHPL 3T1HL 1E7ZA 1HR0L 1D7QA 4QGUA 3CMEA 2HHHL 2I5HA 2MNAA 1V1QA 2IHEA 2VUMH 3UE1A 3VDYA 2R93H 4OONA 2UXCL 4LUVA 1PH9A 1GVPA 2NVQH 2A19A 2JA6G 2BA1A 2AHOB 4JOIC 1J5EQ 4GN3B 2UUCQ 1HNWQ 1L1OA 4DV1Q 4A3BH 1Y1VG 2I5LX 4YY3Q 1LTLA 5FJ8G 1X56A 1KRSA 5C44G 4LFCQ 3K7UC 4QY7A 1OXTA 4R1JA 1KRTA 2R7ZH 4DK3C 1Z47A 5FJ8H 4A3CG 4DV2Q 1FJGL 1VQCA 3U50C 2VS1A 4DAMA 5IY0A 1HZ9A 1X3FA 3RZDH 2RCNA 1EOVA 4A3CH 1I94Q 1VQ6A 2ES2A 4GOPC 3G6EA 1OXSC 3CCRA 1WJJA 1PHJA 4Y52H 1U5KA 4DV6L 1FL0A 3PUVA 1VQKA 3E9HA 3A5UA 1NMGA 4BBSG 1X6OA 2PI2A 4BY1H 1G291 4J15A 1IXRA 3IRBA 4TVAB 4JCVE 2ZM6Q 2E2JH 5HY6A 5HGQA 2OWOA 3D0FA 3GTOH 1BKBA 3S1RH 3M85A 2CWAA 4XTCS 3MXNB 2VW9A 3ULPA 1WCMG 1WI5A 3UDIA 1SE8A 2WAQE 2LXKA 3I4NG 3ULJA 3S1QH 4A3GH 2JA7G 5K36G 3B6YA 5DLQE 3CCLA 1M1KC 4HJ8A 1PVOA 4DV3Q 1YIJA 3I4NH 1AE3A 2N3SA 2AWOA 3JAMi 1X65A 4JC0A 2YTXA 4JI1Q 1NMFA 2PQAA 5C4JH 3HOUG 2UXBL 5J3BA 2GVAA 3AFQA 3PUYA 1WYDA 2KENA 3OTOL 5M3FH 4JOIA 3NENA 4ALPA 1GD7A 2K50A 4YWKA 1YI2A 4JI3Q 3T1HQ 1HR0Q 4HJ5A 1HNXL 1Z9FA 1EUJA 2QA4A 2HHHQ 3K0XA 1N9WA 4DUZL 2YTYA 3RLFA 4LUOA 4X64L 1BBUA 3J81j 1EIYB 2UXCQ 4WJ4A 1E24A 2RHQB 1NE3A 2IT1A 1P8LA 1NBWA 1PH1A 4GOPA 4GN5A 1AE2A 3ERSX 1QVFA 4L5RC 2E5LL 5JJIA 3U58A 2JA5G 2N78A 2I5MX 3KF6B 5E7NA 3FP9A 1KD1C 1S72A 4POGA 2R92H 2PI2E 1T9HA 3PF5A 3KFUA 1VQMA 2HIVA 1MJEA 2DUDA 2JA5H 5M5YH 3GTGH 4GKJL 1CSQA 2WFWA 4JI8L 2ALYB 1YJWA 3JAMc 3Q8DA 2NN6I 3HKZG 4R4TA 3PIOA 3G48A 4NXNL 3F2BA 4YCVA 1CKNB 2UU9L 2JA9A 2GVBA 4GLXA 4BA1I 4EQ5A 1XNQL 2IY5B 2A8VA 4DR5L 4C3JH 1MJCA 2VQFL 2MO0A 1XPOA 4BY7G 2JE6I 1PH8A 4APVA 1ASZA 4L5TA 5GAEC 1HJPA 3W1GA 1VQPA 1PH6A 4HIMA 4DKAC 3F2CA 4UY8C 2YTVA 3J7A5 1QUQB 3CCMA 2OQ0A 1A63A 5AJ3L 1Q46A 3CPWA 2VY3A 3HOXG 1Q7YC 2Y0SE 5ELNA 3CMAA 2VQEL 3PCOB 4A3KH 4JBJA 4A3EG 4JI4L 1HZBA 1H95A 1GM5A 4P73A 2QGQA 3HOXH 2UXBQ 4A3LH 3L7ZC 1N36L 1HR0W 4X6AH 1G6PA 1C0AA 3ULLA 4QIWE 3OTOQ 4L5SA 1GO3E 3F8TA 3AQQA 2LXJA 3BZCA 3HOZG 3S2DH 1VQNA 1CKOA 5M3MG 3PO2G 1B70B 1IYJB 2KCMA 3M7NA 3HOZH 4OWTB 1VQ9A 3CCSA 2VZAA 3UDXA 3KYHC 4DUZQ 2BH8A 5M3MH 1Q81C 1M90C 4X64Q 4AYBE 2UUAL 2ZJPA 1XPRA 2HT1A 1X55A 2VL6A 2ZJRA 4NB3A 4B3SL 1U0LA 2Z0SA 1K0RA 2VUMG 3HOWH 2R93G 3H15A 1K83H 2E5LQ 2WAQG 5GROA 1A0IA 3PSIA 4IFDG 4PZ7A 1I3QH 2R7DA 3RNUA 1I6HH 4IPHA 1B7YB 2K5HA 4A3BG 3LGJA 1S40A 3I55A 4GKJQ 4A93G 4DR2L 3CC2A 4JI8Q 3D31A 2R7ZG 2L15A 4O2DA 4NXML 4DR3Q 4A93H 3OW2A 1YNXA 1KC8C 2UU9Q 4LF5L 4NXNQ 2YYZA 1E3PA 1V43A 2RF4A 1N33L 5JJLA 4ME3A 2YV5A 1CSPA 3KLWA 4HIKA 2B29A 1HNXQ 4OO1I 5H1SE 1R9TH 1LYLA 1N8RC 4DAYB 1XNQQ 2AMCB 1SLJA 2H5XA 4DR5Q 1ASYA 2VQFQ 2F4VL 2EQSA 2IX1A 3PIPA 4HIOA 3M4OH 1RL2A 5ELOA 2JJQA 4BY1G 1PH4A 1HNZL 4LNQA 4B3TL 4WJ3M 1YJ9A 2JA8G 4OX9L 4LF7L 4MZ9A 4RMFA 3I7FA 4PZ6A 5AJ3Q 2K52A 3H0GH 3L0OA 1PA6A 4PG3A 1KQSA 1QZGA 2AKWB 1C7YA 5C0XJ 2JA8H 2VQEQ 4JV5L 3S16H 4K0KL 4P74A 2XGTA 4JI4Q 4JI0L 1UE1A 2OTJA 3UDFA 2CWPA 5IYBG 4A3GG 4LF6L 5C0XG 3E0EA 1N36Q 2CKZB 4JYAL 1LUZA 5IYBH 1N32L 3TS0A 4R4CA 2D0PA 5C3EH 4FDBA 1K73C 1JB7A 3GTPH 1VQBA 4GKKL 5LMNL 3CD6A 1UE7A 4R4QA 1YHQA 1VQEA 3RR5A 4B3RL 3BU2A 5M3FG 1C9OA 3JC66 2AWNA 4PMWA 1CKNA 2B3GA 1XTDA 2WB1G 2F3IA 3OYYA 1NTGA 4QQBX 4B3SQ 4KHPQ 4GLVB 2ZTCA 4OWXB 1TWGH 4LUZA 3I56A 4B3ML 1UE5A 4A76A 4X65L 5GADC 1XMQL 1KXLA 4DPGA 3CP0A 1AH9A 1UE6A 1JMCA 2Y0SG 1OXUA 3ICEA 2E2IH 5IYCH 4NXMQ 2R92G 3CW2C 1WFQA 1SR3A 3MEFA 4A3IG 1N33Q 2NVTH 1IZ6A 4YCWA 4C2MH 4YHHL 4GNXB 1EQQA 4JBMA 4A3JH 5GQOA 1FVIA 3PUXA 4O0AA 2YU9H 4A3IH 2F4VQ 4IJLA 2K4KA 1V9PA 4QJFA 3GTMH 4HJAA 4A3FG 5IWAL 1HNZQ 5EAYA 4B3TQ 1EQRA 4DV6Q 3G71A 1JJGA 3M4PA 4A3FH 2KBNA 1VQ4A 3TRZA 3I4MG 1S3OA 2PNHA 4LF7Q 4BA2I 4IPDA 3F1ZA 1TWCH 3STBD 5M5XH 1Y14B 2I0QA 4BXXG 3I4MH 3AYHB 4JV5Q 4DR7L 4K0KQ 1IBLL 3CCEA 4JI0Q 3KDFB 5GAGC 4BXXH 3PUWA 1YITA 4LF6Q 5JEAJ 3S17H 4JYAQ 3T1YL 3GTKH 4GS3A 1N32Q 1SN8A 2ZTDA 4XIGS 1VQDA 2MFIA 5M5WH 4A3KG 5JEAG 5IYDH 1E1OA 2PQAB 1PH7A 1Q12A 4DR3L 4IOCA 4GKKQ 3I4OA 3A5ZB 5LMNQ 4YWMA 4A3LG 4B3RQ 4DV2L 4P75A 1K3RA 1OXXK 3GDEA 4DNIA 3TEHB 1PH3A 2R7FA 4AH6A 1N34L 2E8GA 5IP7H 5BR8L 3UDGA 1VQ7A 1TWFH 2BA0A 4NPSA 4P72A 2PMZE 3E9IA 3PUZA 1PFSA 4OXPA 2ATWA 5C4XG 4X65Q 4GOPB 2Z6KC 3A0JA 3F2DA 2C35B 3SGIA 3CF5A 3HOWG 5C4XH 4JI5L 1YHBA 1GKHA 2IHFA 3CQZH 4DV5L 4LF9L 2N8NA 1O7IA 3CPFA 3KJOA 4DK6C 4GNXC 3PO3H 1VQ5A 1SMXA 1W2BA 4OWWB 2Q2IA 1PYBA 1MIUA 2EIFA 3AEVA 3J7ZC 1YJNA 2B63G 4A3MG 1XNRL 3S15H 2KHIA 4DR6L 2NZOA 1E22A 3WWVA 3S1MH 3DM3A 1TXYA 1CUKA 1X54A 1YVCA 1I5FA 1VCIA 4P71A 4DV0L 4A3MH 1X9NA 2B63H 1EIFA 2F52A 1E1TA 2XTIA 3UE0A 5IWAQ 4A75A 1FJGQ 1VQAA 1VQOA 1IBML 1MKHA 3HKZE 1QVGA 1I50H 2JK8A 2K14A 3TQYA 4PZ8A 1HZAA 4A3DH 4UP9A 3KOJA 3FHWA 1IBKL 4JI3L 2WP8J 4AQYL 3RLOA 3AFPA 4DR7Q 1NJIC 4YCUA 3M9BA 1IBLQ 4LF4L 1Q86C 3NELA 1PH5A 2OCEA 1TWHH 4BBRG 3H3VI 3ZJYC 1TWAH 4KLKA 3H0GG 3K8AA 3T1YQ 1A62A 4IPCA 4UP7A 1K9MC 2Q2UA 2UXDL 1B8AA 5LMNW 4BBRH 1YEZA 3CC7A 3ER0A 1UEBA 2JA6H 2NZHA 4DV4L 4LFBL 2LSSA 2ZTEA 1BVSA 4DUYL 1LM0A 1Y1VH 4R4IA 1Q8KA 2Z6KA 5C44H 5C3EG 1XJVA 2E2HH 1OTCA 3CAMA 1OXVA 1PV4A 4KI0A 1Q82C 4IJHA 1SRUA 2A1AA 1G51A 3KF6A 3J80c 3J81c 2KHJA 4GNXA 1XMOL 1N34Q 1JJ2A 5BR8Q 2R6GA 1KHIA 4KHZA 3KJPA 3RN2A 1X3EA 4LF8L 1QVCA 4Y7NH 1W3SA 1EFWA 4HIDA 2UUAQ 4IFDI 4EX5A 2CFMA 4LFAL 4JI6L 2UUBL 4DR4L 4X62L 1K8GA 4BBSH 4QL5A 4JI5Q 1L0WA 4GN4B 3PGZA 4DV5Q 3M4QA 2NVYH 2V1CC 4YWLA 1X3GA 4JI7L 4LF9Q 2NN6G 1YHAA 3RZOH 4MNOA 2BH2A 3S24A 3KF8B 5LMUL 4UP8A 1Q1EA 3W1BA 1P16A 3CCUA 3KDFA 4LW1A 2OTLA 1XNRQ 1L1OB 1WCMH 3A74A 5IYCG 4DR6Q 4DV0Q 2JA7H 3EBEA 4DR2Q 1QUQA 1XPUA 3S1NH 1EYGA 2RHSB 2K75A 4JI6Q 4A3JG 2EXDA 1IBMQ 1VQIA 4LF5Q 4R4OA 2HIXA 3K7AH 3HOUH 1BBWA 4AIMA 3TS2A 1YZ6A 4IOAA 2OQKA 1IBKQ 1CKMA 3PV0A 3FKIG 4MTNA 4HJ9A 4AQYQ 1Y1WG 4JI2L 1VQ8A 3HFZB 3RLNA 4LF4Q 3L2PA 3G4SA 3FKIH 2K5NA 4JG2A 4AYBG 1Y1WH 1RIPA 2ZJQA 3S14H 1VS0A 2IX0A 5C0XI 3HOYG 2Q2HA 2GN5A 4X66L 5IT9c 4DV7L 4DR1L 3CC4A 4OX9Q 2UXDQ 2MO1A 3HOYH 3BJUA 3BZKA 4GLAC 2Q2TA 1PYSB 5FLXc 1QZHA 3DLLA 3K80C 4RG1A 4DV4Q 4LFBQ 1IL2A 1NY4A 4DUYQ 3PF4A 1EWIA 1VQJA 2QEXA 1JJCB 5IYDG 1UWVA 3CXCA 1J6QA 1XMOQ 1J5EL 3HOVG 2UUCL 1WOCA 3M3YH 1HNWL 1VQFA 4DV1L 2JEAI 4YY3L 4JBKA 4LFCL 3HOVH 1K8AC 4LF8Q 2JEBI 4HJ7A 4JBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIV A;  3CCV A;  2K5V A;  3GTQ H;  1A8V A;  1YBY A;  1FGU A;  2JQO A;  3GO5 A;  2KCT A;  3EN2 A;  4LFA Q;  3U4V A;  2FXQ A;  3U4Z A;  5IP7 G;  2CQO A;  4X62 Q;  2UUB Q;  4DR4 Q;  2D62 A;  2WB1 E;  1I94 L;  4JI7 Q;  3NBH B;  3STB C;  1L2F A;  1HZC A;  1L1O C;  3CCJ A;  2ASB A;  4BY7 H;  5LMU Q;  1D8L A;  3GD7 A;  3TRE A;  1SFO H;  1KIX A;  3W5O A;  3K81 C;  4OO1 G;  1PH2 A;  2CCZ A;  4B3M Q;  4TQU S;  4UPA A;  1XMQ Q;  1JT8 A;  4LWC A;  3PO3 G;  2ZM6 L;  3GTL H;  3S2H H;  4IO9 A;  1VQG A;  2D0O A;  5GAH C;  1VQL A;  2VNU D;  3NEM A;  1VQH A;  4L5Q A;  3CCQ A;  5IE8 A;  5JJK A;  5FLM G;  4A3E H;  1KAW A;  2MQH A;  2DGY A;  4YHH Q;  3GTJ H;  1SRO A;  1DGS A;  2N49 A;  1Q1B A;  3H3V H;  1KL9 A;  5FLM H;  5IP9 G;  4DV3 L;  1JE5 A;  3J80 i;  4JI2 Q;  3J81 i;  2NVX H;  2HQL A;  4C3H H;  4H02 A;  5IP9 H;  4IPG A;  3I2Z A;  2ID0 A;  4JI1 L;  4POF A;  4C3I H;  3RN5 A;  3PO2 H;  4A3D G;  1HH2 P;  4A4I A;  4X66 Q;  4DR1 Q;  4DV7 Q;  3HKS A;  4IFD J;  4KHP L;  3T1H L;  1E7Z A;  1HR0 L;  1D7Q A;  4QGU A;  3CME A;  2HHH L;  2I5H A;  2MNA A;  1V1Q A;  2IHE A;  2VUM H;  3UE1 A;  3VDY A;  2R93 H;  4OON A;  2UXC L;  4LUV A;  1PH9 A;  1GVP A;  2NVQ H;  2A19 A;  2JA6 G;  2BA1 A;  2AHO B;  4JOI C;  1J5E Q;  4GN3 B;  2UUC Q;  1HNW Q;  1L1O A;  4DV1 Q;  4A3B H;  1Y1V G;  2I5L X;  4YY3 Q;  1LTL A;  5FJ8 G;  1X56 A;  1KRS A;  5C44 G;  4LFC Q;  3K7U C;  4QY7 A;  1OXT A;  4R1J A;  1KRT A;  2R7Z H;  4DK3 C;  1Z47 A;  5FJ8 H;  4A3C G;  4DV2 Q;  1FJG L;  1VQC A;  3U50 C;  2VS1 A;  4DAM A;  5IY0 A;  1HZ9 A;  1X3F A;  3RZD H;  2RCN A;  1EOV A;  4A3C H;  1I94 Q;  1VQ6 A;  2ES2 A;  4GOP C;  3G6E A;  1OXS C;  3CCR A;  1WJJ A;  1PHJ A;  4Y52 H;  1U5K A;  4DV6 L;  1FL0 A;  3PUV A;  1VQK A;  3E9H A;  3A5U A;  1NMG A;  4BBS G;  1X6O A;  2PI2 A;  4BY1 H;  1G29 1;  4J15 A;  1IXR A;  3IRB A;  4TVA B;  4JCV E;  2ZM6 Q;  2E2J H;  5HY6 A;  5HGQ A;  2OWO A;  3D0F A;  3GTO H;  1BKB A;  3S1R H;  3M85 A;  2CWA A;  4XTC S;  3MXN B;  2VW9 A;  3ULP A;  1WCM G;  1WI5 A;  3UDI A;  1SE8 A;  2WAQ E;  2LXK A;  3I4N G;  3ULJ A;  3S1Q H;  4A3G H;  2JA7 G;  5K36 G;  3B6Y A;  5DLQ E;  3CCL A;  1M1K C;  4HJ8 A;  1PVO A;  4DV3 Q;  1YIJ A;  3I4N H;  1AE3 A;  2N3S A;  2AWO A;  3JAM i;  1X65 A;  4JC0 A;  2YTX A;  4JI1 Q;  1NMF A;  2PQA A;  5C4J H;  3HOU G;  2UXB L;  5J3B A;  2GVA A;  3AFQ A;  3PUY A;  1WYD A;  2KEN A;  3OTO L;  5M3F H;  4JOI A;  3NEN A;  4ALP A;  1GD7 A;  2K50 A;  4YWK A;  1YI2 A;  4JI3 Q;  3T1H Q;  1HR0 Q;  4HJ5 A;  1HNX L;  1Z9F A;  1EUJ A;  2QA4 A;  2HHH Q;  3K0X A;  1N9W A;  4DUZ L;  2YTY A;  3RLF A;  4LUO A;  4X64 L;  1BBU A;  3J81 j;  1EIY B;  2UXC Q;  4WJ4 A;  1E24 A;  2RHQ B;  1NE3 A;  2IT1 A;  1P8L A;  1NBW A;  1PH1 A;  4GOP A;  4GN5 A;  1AE2 A;  3ERS X;  1QVF A;  4L5R C;  2E5L L;  5JJI A;  3U58 A;  2JA5 G;  2N78 A;  2I5M X;  3KF6 B;  5E7N A;  3FP9 A;  1KD1 C;  1S72 A;  4POG A;  2R92 H;  2PI2 E;  1T9H A;  3PF5 A;  3KFU A;  1VQM A;  2HIV A;  1MJE A;  2DUD A;  2JA5 H;  5M5Y H;  3GTG H;  4GKJ L;  1CSQ A;  2WFW A;  4JI8 L;  2ALY B;  1YJW A;  3JAM c;  3Q8D A;  2NN6 I;  3HKZ G;  4R4T A;  3PIO A;  3G48 A;  4NXN L;  3F2B A;  4YCV A;  1CKN B;  2UU9 L;  2JA9 A;  2GVB A;  4GLX A;  4BA1 I;  4EQ5 A;  1XNQ L;  2IY5 B;  2A8V A;  4DR5 L;  4C3J H;  1MJC A;  2VQF L;  2MO0 A;  1XPO A;  4BY7 G;  2JE6 I;  1PH8 A;  4APV A;  1ASZ A;  4L5T A;  5GAE C;  1HJP A;  3W1G A;  1VQP A;  1PH6 A;  4HIM A;  4DKA C;  3F2C A;  4UY8 C;  2YTV A;  3J7A 5;  1QUQ B;  3CCM A;  2OQ0 A;  1A63 A;  5AJ3 L;  1Q46 A;  3CPW A;  2VY3 A;  3HOX G;  1Q7Y C;  2Y0S E;  5ELN A;  3CMA A;  2VQE L;  3PCO B;  4A3K H;  4JBJ A;  4A3E G;  4JI4 L;  1HZB A;  1H95 A;  1GM5 A;  4P73 A;  2QGQ A;  3HOX H;  2UXB Q;  4A3L H;  3L7Z C;  1N36 L;  1HR0 W;  4X6A H;  1G6P A;  1C0A A;  3ULL A;  4QIW E;  3OTO Q;  4L5S A;  1GO3 E;  3F8T A;  3AQQ A;  2LXJ A;  3BZC A;  3HOZ G;  3S2D H;  1VQN A;  1CKO A;  5M3M G;  3PO2 G;  1B70 B;  1IYJ B;  2KCM A;  3M7N A;  3HOZ H;  4OWT B;  1VQ9 A;  3CCS A;  2VZA A;  3UDX A;  3KYH C;  4DUZ Q;  2BH8 A;  5M3M H;  1Q81 C;  1M90 C;  4X64 Q;  4AYB E;  2UUA L;  2ZJP A;  1XPR A;  2HT1 A;  1X55 A;  2VL6 A;  2ZJR A;  4NB3 A;  4B3S L;  1U0L A;  2Z0S A;  1K0R A;  2VUM G;  3HOW H;  2R93 G;  3H15 A;  1K83 H;  2E5L Q;  2WAQ G;  5GRO A;  1A0I A;  3PSI A;  4IFD G;  4PZ7 A;  1I3Q H;  2R7D A;  3RNU A;  1I6H H;  4IPH A;  1B7Y B;  2K5H A;  4A3B G;  3LGJ A;  1S40 A;  3I55 A;  4GKJ Q;  4A93 G;  4DR2 L;  3CC2 A;  4JI8 Q;  3D31 A;  2R7Z G;  2L15 A;  4O2D A;  4NXM L;  4DR3 Q;  4A93 H;  3OW2 A;  1YNX A;  1KC8 C;  2UU9 Q;  4LF5 L;  4NXN Q;  2YYZ A;  1E3P A;  1V43 A;  2RF4 A;  1N33 L;  5JJL A;  4ME3 A;  2YV5 A;  1CSP A;  3KLW A;  4HIK A;  2B29 A;  1HNX Q;  4OO1 I;  5H1S E;  1R9T H;  1LYL A;  1N8R C;  4DAY B;  1XNQ Q;  2AMC B;  1SLJ A;  2H5X A;  4DR5 Q;  1ASY A;  2VQF Q;  2F4V L;  2EQS A;  2IX1 A;  3PIP A;  4HIO A;  3M4O H;  1RL2 A;  5ELO A;  2JJQ A;  4BY1 G;  1PH4 A;  1HNZ L;  4LNQ A;  4B3T L;  4WJ3 M;  1YJ9 A;  2JA8 G;  4OX9 L;  4LF7 L;  4MZ9 A;  4RMF A;  3I7F A;  4PZ6 A;  5AJ3 Q;  2K52 A;  3H0G H;  3L0O A;  1PA6 A;  4PG3 A;  1KQS A;  1QZG A;  2AKW B;  1C7Y A;  5C0X J;  2JA8 H;  2VQE Q;  4JV5 L;  3S16 H;  4K0K L;  4P74 A;  2XGT A;  4JI4 Q;  4JI0 L;  1UE1 A;  2OTJ A;  3UDF A;  2CWP A;  5IYB G;  4A3G G;  4LF6 L;  5C0X G;  3E0E A;  1N36 Q;  2CKZ B;  4JYA L;  1LUZ A;  5IYB H;  1N32 L;  3TS0 A;  4R4C A;  2D0P A;  5C3E H;  4FDB A;  1K73 C;  1JB7 A;  3GTP H;  1VQB A;  4GKK L;  5LMN L;  3CD6 A;  1UE7 A;  4R4Q A;  1YHQ A;  1VQE A;  3RR5 A;  4B3R L;  3BU2 A;  5M3F G;  1C9O A;  3JC6 6;  2AWN A;  4PMW A;  1CKN A;  2B3G A;  1XTD A;  2WB1 G;  2F3I A;  3OYY A;  1NTG A;  4QQB X;  4B3S Q;  4KHP Q;  4GLV B;  2ZTC A;  4OWX B;  1TWG H;  4LUZ A;  3I56 A;  4B3M L;  1UE5 A;  4A76 A;  4X65 L;  5GAD C;  1XMQ L;  1KXL A;  4DPG A;  3CP0 A;  1AH9 A;  1UE6 A;  1JMC A;  2Y0S G;  1OXU A;  3ICE A;  2E2I H;  5IYC H;  4NXM Q;  2R92 G;  3CW2 C;  1WFQ A;  1SR3 A;  3MEF A;  4A3I G;  1N33 Q;  2NVT H;  1IZ6 A;  4YCW A;  4C2M H;  4YHH L;  4GNX B;  1EQQ A;  4JBM A;  4A3J H;  5GQO A;  1FVI A;  3PUX A;  4O0A A;  2YU9 H;  4A3I H;  2F4V Q;  4IJL A;  2K4K A;  1V9P A;  4QJF A;  3GTM H;  4HJA A;  4A3F G;  5IWA L;  1HNZ Q;  5EAY A;  4B3T Q;  1EQR A;  4DV6 Q;  3G71 A;  1JJG A;  3M4P A;  4A3F H;  2KBN A;  1VQ4 A;  3TRZ A;  3I4M G;  1S3O A;  2PNH A;  4LF7 Q;  4BA2 I;  4IPD A;  3F1Z A;  1TWC H;  3STB D;  5M5X H;  1Y14 B;  2I0Q A;  4BXX G;  3I4M H;  3AYH B;  4JV5 Q;  4DR7 L;  4K0K Q;  1IBL L;  3CCE A;  4JI0 Q;  3KDF B;  5GAG C;  4BXX H;  3PUW A;  1YIT A;  4LF6 Q;  5JEA J;  3S17 H;  4JYA Q;  3T1Y L;  3GTK H;  4GS3 A;  1N32 Q;  1SN8 A;  2ZTD A;  4XIG S;  1VQD A;  2MFI A;  5M5W H;  4A3K G;  5JEA G;  5IYD H;  1E1O A;  2PQA B;  1PH7 A;  1Q12 A;  4DR3 L;  4IOC A;  4GKK Q;  3I4O A;  3A5Z B;  5LMN Q;  4YWM A;  4A3L G;  4B3R Q;  4DV2 L;  4P75 A;  1K3R A;  1OXX K;  3GDE A;  4DNI A;  3TEH B;  1PH3 A;  2R7F A;  4AH6 A;  1N34 L;  2E8G A;  5IP7 H;  5BR8 L;  3UDG A;  1VQ7 A;  1TWF H;  2BA0 A;  4NPS A;  4P72 A;  2PMZ E;  3E9I A;  3PUZ A;  1PFS A;  4OXP A;  2ATW A;  5C4X G;  4X65 Q;  4GOP B;  2Z6K C;  3A0J A;  3F2D A;  2C35 B;  3SGI A;  3CF5 A;  3HOW G;  5C4X H;  4JI5 L;  1YHB A;  1GKH A;  2IHF A;  3CQZ H;  4DV5 L;  4LF9 L;  2N8N A;  1O7I A;  3CPF A;  3KJO A;  4DK6 C;  4GNX C;  3PO3 H;  1VQ5 A;  1SMX A;  1W2B A;  4OWW B;  2Q2I A;  1PYB A;  1MIU A;  2EIF A;  3AEV A;  3J7Z C;  1YJN A;  2B63 G;  4A3M G;  1XNR L;  3S15 H;  2KHI A;  4DR6 L;  2NZO A;  1E22 A;  3WWV A;  3S1M H;  3DM3 A;  1TXY A;  1CUK A;  1X54 A;  1YVC A;  1I5F A;  1VCI A;  4P71 A;  4DV0 L;  4A3M H;  1X9N A;  2B63 H;  1EIF A;  2F52 A;  1E1T A;  2XTI A;  3UE0 A;  5IWA Q;  4A75 A;  1FJG Q;  1VQA A;  1VQO A;  1IBM L;  1MKH A;  3HKZ E;  1QVG A;  1I50 H;  2JK8 A;  2K14 A;  3TQY A;  4PZ8 A;  1HZA A;  4A3D H;  4UP9 A;  3KOJ A;  3FHW A;  1IBK L;  4JI3 L;  2WP8 J;  4AQY L;  3RLO A;  3AFP A;  4DR7 Q;  1NJI C;  4YCU A;  3M9B A;  1IBL Q;  4LF4 L;  1Q86 C;  3NEL A;  1PH5 A;  2OCE A;  1TWH H;  4BBR G;  3H3V I;  3ZJY C;  1TWA H;  4KLK A;  3H0G G;  3K8A A;  3T1Y Q;  1A62 A;  4IPC A;  4UP7 A;  1K9M C;  2Q2U A;  2UXD L;  1B8A A;  5LMN W;  4BBR H;  1YEZ A;  3CC7 A;  3ER0 A;  1UEB A;  2JA6 H;  2NZH A;  4DV4 L;  4LFB L;  2LSS A;  2ZTE A;  1BVS A;  4DUY L;  1LM0 A;  1Y1V H;  4R4I A;  1Q8K A;  2Z6K A;  5C44 H;  5C3E G;  1XJV A;  2E2H H;  1OTC A;  3CAM A;  1OXV A;  1PV4 A;  4KI0 A;  1Q82 C;  4IJH A;  1SRU A;  2A1A A;  1G51 A;  3KF6 A;  3J80 c;  3J81 c;  2KHJ A;  4GNX A;  1XMO L;  1N34 Q;  1JJ2 A;  5BR8 Q;  2R6G A;  1KHI A;  4KHZ A;  3KJP A;  3RN2 A;  1X3E A;  4LF8 L;  1QVC A;  4Y7N H;  1W3S A;  1EFW A;  4HID A;  2UUA Q;  4IFD I;  4EX5 A;  2CFM A;  4LFA L;  4JI6 L;  2UUB L;  4DR4 L;  4X62 L;  1K8G A;  4BBS H;  4QL5 A;  4JI5 Q;  1L0W A;  4GN4 B;  3PGZ A;  4DV5 Q;  3M4Q A;  2NVY H;  2V1C C;  4YWL A;  1X3G A;  4JI7 L;  4LF9 Q;  2NN6 G;  1YHA A;  3RZO H;  4MNO A;  2BH2 A;  3S24 A;  3KF8 B;  5LMU L;  4UP8 A;  1Q1E A;  3W1B A;  1P16 A;  3CCU A;  3KDF A;  4LW1 A;  2OTL A;  1XNR Q;  1L1O B;  1WCM H;  3A74 A;  5IYC G;  4DR6 Q;  4DV0 Q;  2JA7 H;  3EBE A;  4DR2 Q;  1QUQ A;  1XPU A;  3S1N H;  1EYG A;  2RHS B;  2K75 A;  4JI6 Q;  4A3J G;  2EXD A;  1IBM Q;  1VQI A;  4LF5 Q;  4R4O A;  2HIX A;  3K7A H;  3HOU H;  1BBW A;  4AIM A;  3TS2 A;  1YZ6 A;  4IOA A;  2OQK A;  1IBK Q;  1CKM A;  3PV0 A;  3FKI G;  4MTN A;  4HJ9 A;  4AQY Q;  1Y1W G;  4JI2 L;  1VQ8 A;  3HFZ B;  3RLN A;  4LF4 Q;  3L2P A;  3G4S A;  3FKI H;  2K5N A;  4JG2 A;  4AYB G;  1Y1W H;  1RIP A;  2ZJQ A;  3S14 H;  1VS0 A;  2IX0 A;  5C0X I;  3HOY G;  2Q2H A;  2GN5 A;  4X66 L;  5IT9 c;  4DV7 L;  4DR1 L;  3CC4 A;  4OX9 Q;  2UXD Q;  2MO1 A;  3HOY H;  3BJU A;  3BZK A;  4GLA C;  2Q2T A;  1PYS B;  5FLX c;  1QZH A;  3DLL A;  3K80 C;  4RG1 A;  4DV4 Q;  4LFB Q;  1IL2 A;  1NY4 A;  4DUY Q;  3PF4 A;  1EWI A;  1VQJ A;  2QEX A;  1JJC B;  5IYD G;  1UWV A;  3CXC A;  1J6Q A;  1XMO Q;  1J5E L;  3HOV G;  2UUC L;  1WOC A;  3M3Y H;  1HNW L;  1VQF A;  4DV1 L;  2JEA I;  4YY3 L;  4JBK A;  4LFC L;  3HOV H;  1K8A C;  4LF8 Q;  2JEB I;  4HJ7 A;  4JBW A; 
#chains in the Genus database with same CATH topology
 3EIV A;  2EDG A;  5COR A;  4JI6 Q;  3U4Z A;  4DR4 Q;  2FXQ A;  1PRT F;  4X62 Q;  2CQO A;  2EXZ A;  2K03 A;  1STG A;  3HOU B;  1D1I A;  1X32 A;  1L2F A;  3NBH B;  3CCJ A;  2B2U C;  3GD7 A;  1STH A;  1SNP A;  1PH2 A;  1Y1W B;  2EZV A;  4LWC A;  3PO3 G;  2VNU D;  1VQL A;  4L5Q A;  1TWC B;  2Z9H A;  3P7J A;  1AN8 A;  4A3E H;  4RHS A;  2RQX A;  1KL9 A;  4JI2 Q;  2L5T A;  4H02 A;  2JYO A;  3KLS A;  4OIJ A;  2RCF A;  3G7L A;  1W6J A;  3HOV B;  1TS4 A;  3EFX D;  5CV5 A;  2EYL A;  3HKS A;  4CGY B;  3T1H L;  1HR0 L;  4Q5V A;  1OO9 B;  2HCC A;  3HZX A;  2MNA A;  1SE2 A;  2CW0 C;  2VUM H;  2FMC A;  1Y8O B;  1SNM A;  1PH9 A;  1SFO B;  2A19 A;  2JA6 G;  2BA1 A;  3D4R A;  1AW7 A;  5E4X A;  4YY3 Q;  4QB4 A;  2K04 A;  1EY0 A;  4LFC Q;  3S2H B;  4R1J A;  1JOR A;  2KVM A;  2R7Z H;  1KLU D;  1VQC A;  4GZY C;  3NXW A;  5IY0 A;  1X3F A;  2RCN A;  1Q3L A;  4A3C H;  2ES2 A;  2RDG A;  4GOP C;  1O78 A;  3CCR A;  1PHJ A;  1WJJ A;  1U5K A;  2KCN A;  4BBS G;  4J1M A;  1HXY D;  1WTR A;  4J15 A;  1KDA A;  4I7Z C;  4JCV E;  2CVR A;  2PZU A;  2E2J H;  3C2P A;  3D0F A;  1ET6 A;  1BKB A;  2PZW A;  4HAE A;  4XTC S;  2WV6 D;  3MHB A;  2XSC A;  1LAB A;  2XRS D;  4A3G H;  4KHV A;  2JA7 G;  2NBF A;  3I4L A;  1PVO A;  1YIJ A;  3I4N H;  2NVQ B;  5ELE A;  3VR5 A;  1EWH A;  2N3S A;  1DOK A;  4FP5 D;  4JC0 A;  2YTX A;  2F0S A;  1ILQ A;  2SOB A;  4O42 A;  5M3F H;  3VR2 A;  1Y1V B;  2HCI A;  1YI2 A;  4JI3 Q;  3DM1 A;  3MXU A;  3T1H Q;  1HR0 Q;  2F3V A;  5C3X A;  1N9W A;  5CBA E;  4DXG A;  4C1N K;  4DUZ L;  4X64 L;  4WJ4 A;  2RHQ B;  1JQY D;  5IT9 E;  3CRK C;  1TU2 B;  1P8L A;  3GTO B;  3HGB A;  3D3R A;  2N78 A;  1RHP A;  2EE1 A;  1KD1 C;  1VF5 C;  4POG A;  3PF5 A;  3SXH A;  1NUC A;  5LHY 1;  1ICF B;  2K5D A;  5M5Y H;  3RD4 A;  1CSQ A;  3S1Q B;  2Z1C A;  3A56 A;  4JI8 L;  2K5Q A;  1DOM A;  4KD3 A;  3Q8D A;  3HKZ G;  4DR3 L;  1CHP D;  3G48 A;  4NXN L;  1EIG A;  4FF4 A;  1F2L A;  1HA6 A;  1XNQ L;  2A8V A;  4BY7 G;  5IGG A;  1XPO A;  1MSG A;  2F0J A;  4G7Z C;  3R2I A;  1ASZ A;  4L5T A;  4LAA A;  1HJP A;  3W1G A;  4ABN A;  2YTV A;  5D3I B;  1QUQ B;  5ELF A;  3J7A 5;  1JC7 A;  2VY3 A;  3A7A B;  2C9O A;  3HOX G;  2Y0S E;  4RGM A;  1H95 A;  3J80 L;  3GV3 A;  4JI4 L;  1HZB A;  1GM5 A;  4XYO A;  5C4H A;  5KRU A;  4K5W A;  3L7Z C;  1D6E C;  4KY5 A;  2SDF A;  1QIL A;  3AQQ A;  2LXJ A;  2EY1 A;  3O13 A;  1HUN A;  3S2D H;  4IAL A;  1YNN D;  4N9T A;  3PO2 G;  1STY A;  2KCM A;  4DNR B;  2PW5 A;  3UDX A;  3KYH C;  4DUZ Q;  2BH8 A;  5M3M H;  1M90 C;  4X64 Q;  2ZJP A;  2CHB D;  5IOD A;  4H44 C;  5EGT A;  1PXU A;  5JVH 3;  3HOW H;  2R93 G;  3H15 A;  4C3J B;  5GRO A;  4N9P A;  1PZI D;  1I3Q H;  4IPH A;  3KF8 A;  2NTS A;  3LGJ A;  1S40 A;  4DR2 L;  4JI8 Q;  2L15 A;  4NXM L;  1EFI D;  4DR3 Q;  4A93 H;  3OW2 A;  1YNX A;  1WTP A;  4NXN Q;  5JJL A;  1BCP C;  5H1S E;  1R9T H;  1DYQ A;  3FPP A;  1GUG A;  1WTQ A;  1XNQ Q;  1CQV A;  2F4V L;  2IX1 A;  4E6I A;  1STA A;  5CV4 A;  1LT3 D;  2EOT A;  1PTO H;  1YJ9 A;  1G6Z A;  4LF7 L;  3IFT A;  5FO8 B;  2NUC A;  2JA8 H;  1G8Z D;  5CV9 A;  2AKW B;  1IHZ A;  5J22 A;  4JV5 L;  4K0K L;  4P74 A;  2XGT A;  4JI4 Q;  2OTJ A;  1DM0 B;  4RA8 A;  4BS9 A;  3K5L A;  3E0E A;  4HTH A;  4R4C A;  2D0P A;  1J9O A;  1JB7 A;  2WAQ B;  5FKA C;  1UE7 A;  1YHQ A;  1C9O A;  2TSS A;  2N88 A;  5LL6 S;  3JC6 6;  4N8X 1;  1XTD A;  4QQB X;  2ZT9 C;  4N8F A;  2L11 A;  1ONL A;  2ZTC A;  2CH4 W;  2E2D C;  4LUZ A;  5CV7 A;  4CBV A;  3M4O B;  1XMQ L;  3CP0 A;  1AH9 A;  1OXU A;  2CQA A;  4ZQ3 A;  2IWH A;  3OHX C;  4NXM Q;  1U4R A;  1EY7 A;  1V8Q A;  2C5C A;  4WFN 3;  3MEF A;  1S5E D;  1QOH A;  3S9W A;  5K5P A;  2QW7 A;  4A3J H;  1FVI A;  4O0A A;  1STN A;  2F4V Q;  4CDE C;  5HUR A;  4RGT A;  1GUO A;  5C3E B;  3OMG A;  1DOL A;  4A3F H;  2A74 C;  2KBN A;  1VQ4 A;  3I4M G;  1S3O A;  2PNH A;  2QF7 A;  5EPJ A;  4IPD A;  4LF7 Q;  4R8N A;  2I0Q A;  4JV5 Q;  4K0K Q;  5M3F B;  4FYD A;  2ZXO A;  1RD9 D;  3PUW A;  2DJF C;  1KNE A;  3GTK H;  1GXD C;  1SN8 A;  5M5W H;  1PH7 A;  2PQA B;  1Q12 A;  5EKK A;  3I4O A;  4Z9C B;  4HMJ A;  2XWJ B;  3FEW X;  4DV2 L;  5HGT A;  3FRP B;  1ML0 D;  1PH3 A;  5A35 A;  5FOB B;  4DAV A;  4RCO A;  1SYB A;  5BR8 L;  3UDG A;  2BA0 A;  3K6O A;  3K5N A;  3WOE A;  2PMZ E;  3PUZ A;  2HDL A;  4OXP A;  1UUP A;  3TSS A;  3F2D A;  1CHQ D;  3K58 A;  5C4X H;  3CQZ H;  2CW0 D;  3KJO A;  3HG9 A;  2K7V A;  1PYB A;  2EIF A;  2A69 D;  2R61 A;  2KHI A;  3TDQ A;  1VMC A;  2LFN A;  2NZO A;  3WWV A;  4DR6 L;  2A73 B;  3DM3 A;  4A3M H;  1EIF A;  2HQE A;  1E1T A;  4M1U B;  1FJG Q;  5C3W A;  1MKH A;  1JWM D;  1QVG A;  4LMQ D;  2K14 A;  4PZ8 A;  3K59 A;  1LO5 D;  2H1E A;  4KV6 A;  1BCP F;  2K33 A;  3AFP A;  3M9B A;  1F2Y A;  1PLF A;  1QWY A;  3NQI A;  1PH5 A;  2OCE A;  4ID6 A;  4BBR G;  1RKN A;  4R9W A;  3H3V I;  1JWU D;  3K8A A;  1K9M C;  3ITP A;  5T1G A;  5LMN W;  1JOQ A;  4KJO A;  3CC7 A;  1Q90 A;  4QUF A;  2I07 B;  2Z4I A;  4DV4 L;  1BVS A;  3OMC A;  4RAU C;  4DUY L;  4WJW A;  1LM0 A;  3PO3 B;  5C44 H;  3NWS A;  3HOW B;  1GHK A;  4XQN A;  4KI0 A;  2B39 A;  2F4I A;  3MA2 B;  1SRU A;  1RTO A;  2A1A A;  3DHQ A;  3KF6 A;  3M4Y A;  1GJX A;  1O7Z A;  5BR8 Q;  1KHI A;  1LTR D;  1L0Y B;  3RN2 A;  2ZXP A;  5EBD A;  3I90 A;  4RFB A;  1BBX C;  1BF4 A;  4LFA L;  1KTK A;  1I50 B;  3M4Q A;  1R9T B;  1YHA A;  4MNO A;  5LMU L;  2NN6 H;  5BN3 A;  1TII D;  2X6L A;  5IYC G;  4DR6 Q;  1EZ8 A;  1TWA B;  4K5X A;  2LKV A;  1EY6 A;  3EBE A;  4OEL B;  3N6R A;  2HDM A;  2K75 A;  4ODG A;  2B2T A;  4K2K A;  1LTA D;  4G57 A;  2JA6 B;  4R4O A;  3HOU H;  4AIM A;  5CYU A;  3R2T A;  2MP1 A;  2E2H B;  3DWP A;  3FKI G;  4FF1 A;  4HJ9 A;  3NQT A;  2K5N A;  4AYB G;  1Y1W H;  1RIP A;  2ZXR A;  3HOY G;  1F2Z A;  3J7A F;  2Q2H A;  3CC4 A;  4OX9 Q;  3U9S A;  1VMP A;  3BVM A;  1TY0 A;  1H9R A;  2EYM A;  2Q2T A;  1CI3 M;  1PYS B;  2Q8R E;  1QZH A;  4RG1 A;  3T51 B;  4DV4 Q;  1GUT A;  1ET9 A;  3KBX A;  2NVY B;  1EZ6 A;  4DUY Q;  1F9R A;  1KLG D;  2QEX A;  5JJZ A;  2JN4 A;  4P2C B;  1J6Q A;  1I4X A;  1HNW L;  1VQF A;  3HOV H;  2M9V A;  1UEA B;  1Q81 C;  4PMC A;  2K5V A;  1BO0 A;  1A8V A;  1GUS A;  1FGU A;  4LFA Q;  3U4V A;  2KCT A;  1D5Z C;  2V4D A;  5IP7 G;  3HS0 C;  4PMB A;  2QKI C;  4ZKC B;  2D62 A;  3STB C;  4A3J B;  1HZC A;  5A2Q E;  1GHJ A;  3H94 A;  5LMU Q;  5EKI A;  3TRE A;  1SFO H;  3W5O A;  3K81 C;  2CCZ A;  4TQU S;  3BS1 A;  5L37 A;  3DWA A;  2IPK D;  1TKW B;  1SYD A;  2X6G A;  3S2H H;  5GAH C;  1VQH A;  1ICW A;  5IE8 A;  2DNC A;  5JJK A;  2F0E A;  1KAW A;  4YHH Q;  3H3V H;  1SRO A;  2N49 A;  1FNW A;  2AQ1 B;  2F0K A;  5FLM H;  1JE5 A;  1NAP A;  3J81 i;  4C3H H;  3R8B A;  2DY7 A;  5IP9 H;  1BCP D;  1LLR D;  3M3Y B;  3RN5 A;  4A3D G;  5KYI A;  1NR2 A;  4XQJ A;  2H4O A;  1HQR D;  3HKZ B;  4IFD J;  4KHP L;  1HFN A;  2B8F A;  4QGU A;  2I5H A;  1ILP A;  1EEF D;  4F8M A;  3UE1 A;  4K14 A;  3BYT B;  4LUV A;  4BY7 B;  2NVQ H;  3BVZ A;  1AFP A;  1SJH D;  2ICI A;  4EVO A;  1HNW Q;  3MXP A;  3I70 A;  4A3B H;  3CKI B;  4QY7 A;  1OXT A;  1KRT A;  3CQZ B;  5D14 A;  4DK3 C;  5FJ8 H;  4A3C G;  5DM6 3;  2EVB A;  4DAM A;  1HZ9 A;  3QB3 A;  1V1O A;  1OXS C;  4Y52 H;  5I6Y A;  2NVX B;  1FL0 A;  2EJM A;  4KKU A;  5KEE A;  3A5U A;  5T1I A;  2FFK B;  5CR3 A;  3IRB A;  3K57 A;  2OWO A;  3GTO H;  2A5H A;  4MTK A;  2CWA A;  3MXN B;  1WCM G;  3OWE B;  2WAQ E;  3I4N G;  2QDL A;  3S1Q H;  3CCL A;  2XRQ D;  4K5V A;  1AE3 A;  2BE5 D;  1AZQ A;  1D1K A;  1T5E A;  4DFA A;  4HED A;  5J3B A;  3AFQ A;  4CDC C;  1L0X B;  4FXG C;  2KEN A;  1A2U A;  1T5X D;  4OHJ A;  3OTO L;  3TN2 A;  4ALP A;  2E76 C;  5ELB A;  3RZD B;  1EUJ A;  2QA4 A;  2KEC A;  1O7Y A;  1BBU A;  2XNA C;  3SK4 A;  3I72 A;  5ELC A;  1Y8N B;  5COY A;  2IT1 A;  2LS0 1;  2KHS A;  3OIP A;  4GN5 A;  1AE2 A;  1I6V C;  1ZXT A;  3ERS X;  3PIP 3;  1EYA A;  1ENF A;  4M8A A;  1PYW D;  3QR8 A;  5JJI A;  3S1R B;  2FIN B;  2R92 H;  5E7N A;  3FP9 A;  2PI2 E;  3KFU A;  1VQM A;  2HIV A;  1W6K A;  4C3I G;  2F0F A;  1PFM A;  2ALY B;  1YJW A;  2RSO A;  4R4T A;  3PIO A;  4YCV A;  3ONA B;  5IGF A;  2F0D A;  3NHH A;  4IN3 A;  4GLX A;  4EQ5 A;  2B2V A;  2EY5 A;  1I4Q A;  2IY5 B;  1WD1 A;  4C3J H;  2VQF L;  2MO0 A;  1RCV D;  4APV A;  1PFN A;  1K0S A;  1FYC A;  1SE4 A;  2OQ0 A;  1B9N A;  2AQ3 B;  2PMZ B;  5ELN A;  4U68 A;  4JK1 C;  1SYC A;  2WAC A;  4P73 A;  2SEB D;  3WOF A;  5IOC A;  1N36 L;  1HR0 W;  1C0A A;  3OTO Q;  1S5B D;  1K3B C;  1VQN A;  5M3M G;  1B70 B;  2JA5 B;  3GTG B;  3CCS A;  2Z4H A;  2HT1 A;  5DAU A;  1X55 A;  1NNX A;  3OPO A;  4IFD G;  3FVQ A;  1B7Y B;  3MXN A;  4R8I A;  4JPB W;  4X3U A;  3I55 A;  4A93 G;  1XWE A;  3TP6 A;  2L0C A;  1KNA A;  4O2D A;  4LF5 L;  5JAV A;  1JCK B;  1V43 A;  1V1P A;  1HNX Q;  1CSP A;  1A3T A;  1LYL A;  2FMM A;  2NWG A;  3LX0 A;  1ASY A;  2VQF Q;  3M4O H;  3H6M A;  2OF1 A;  5ELO A;  3J81 E;  5FLX L;  4BY1 G;  1PH4 A;  4C3H B;  2JA8 G;  5EPK A;  2G9H D;  3HOZ B;  3X3M A;  3IAY A;  4RMF A;  3I7F A;  3H0G H;  4PG3 A;  4G7O C;  4L6T B;  2K5W A;  4JW0 A;  4LF6 L;  1N36 Q;  3NWT A;  1KDC A;  4QMG A;  1TT2 A;  1VDZ A;  5C0X H;  5C3E H;  3TS0 A;  2BDN A;  1CA5 A;  3VYS A;  5E1F A;  1VQB A;  4NP5 A;  3BU2 A;  4ZYS A;  4A3B B;  2ICE C;  4DNT B;  4EQO A;  4IUV A;  2WB1 G;  2F3I A;  3OYY A;  4RH6 A;  4I7A A;  3T16 A;  3HRZ C;  2PNR C;  4HSV A;  3A54 A;  4OWX B;  3NBH A;  4B3M L;  2NB0 A;  5GAD C;  1KXL A;  3K0Y A;  1UE6 A;  2Y0S G;  2A6H C;  4HCS A;  1RTN A;  3SVM A;  5C5L A;  4NW2 A;  1WFQ A;  4TRD A;  1SR3 A;  3S16 B;  2NVT H;  1IZ6 A;  2O2L D;  3ERQ A;  1EQQ A;  3BZD B;  4JBM A;  1B2T A;  4PNY A;  1FNU A;  1MI2 A;  1GUW A;  3E6Z X;  1V9P A;  2WKC A;  4V19 0;  4A3F G;  1UNS A;  4WRD A;  4FVM A;  4IUR A;  3GTP B;  1JJG A;  4RCN A;  1GOZ A;  1MHW C;  3Q0A A;  3TRZ A;  3SK6 A;  3STB D;  4IZ8 A;  3P1H A;  1Y14 B;  1EL0 A;  1S5F D;  1H9J A;  1HFG A;  1SNC A;  3AYH B;  4KN7 C;  1IBL L;  3CCE A;  2F03 A;  4LF6 Q;  2KEE A;  4GS3 A;  4XIG S;  4EGV A;  1VQD A;  2MFI A;  4A3K G;  5D3D A;  4V0B A;  5IYD H;  4KKT A;  4J6H A;  3VYU A;  3A5Z B;  5EJW A;  4F87 A;  5JEA H;  4A3L G;  2E2I B;  4ZK9 B;  4X3T A;  2E75 C;  4P75 A;  1D2B A;  1K3R A;  3TEH B;  2R92 B;  4AH6 A;  2E8G A;  4QIW B;  1TWF H;  4A3I B;  1HA5 A;  1BOS A;  1WTV A;  1HHV A;  1PFS A;  5C4X G;  4GOP B;  1U4P A;  2C35 B;  2ENB A;  2VB3 X;  3CF5 A;  1YHB A;  1GKH A;  4DV5 L;  1O7I A;  3CPF A;  3PO3 H;  3KK7 A;  5M5X B;  1SMX A;  2F0I A;  1QB5 D;  4OWW B;  1MIU A;  4ZKB B;  1YJN A;  3D8G A;  1F9Q A;  4A3M G;  2B2Y A;  1E22 A;  1KDB A;  1X9N A;  1I5F A;  1H9K A;  2F52 A;  4EQP A;  3UE0 A;  3D4W A;  1VQO A;  3HKZ E;  5M9O A;  1I50 H;  2JK8 A;  3D6W A;  4UP9 A;  1CM9 A;  4IUN A;  2WP8 J;  4AQY L;  3RLO A;  1NJI C;  1IBL Q;  3NEL A;  2B2T C;  1TWA H;  2A6E C;  1B8A A;  1YEZ A;  3TP7 A;  5KND A;  2JA6 H;  2FJ2 A;  4LFB L;  1AZP A;  5BN5 A;  2ZTE A;  3ZYY X;  3JAM L;  2Z6K A;  2E2H H;  3CAM A;  1OXV A;  4K6L A;  1XMO L;  3J80 c;  3VYR A;  3S1M B;  5CGK A;  2R6G A;  4KHZ A;  2B63 B;  2KA7 A;  1B4O A;  4B9X A;  2CFM A;  2F0G A;  1IL8 A;  4BBS H;  4IUU A;  1LT6 D;  4DV5 Q;  1M4V A;  2B8G A;  2NVY H;  4RWS C;  1BDO A;  2NN6 G;  2MHV A;  4A3D B;  3C3L A;  1Q1E A;  4K8I A;  3CCU A;  4HSP A;  4LW1 A;  2A68 C;  1L1O B;  1LTB D;  1XX8 A;  3A74 A;  1MSH A;  1HQM C;  3E5S A;  5ELD A;  2JA7 H;  4DR2 Q;  1QUQ A;  4KTA A;  3LNN A;  1EYG A;  3H0G B;  1VQI A;  3NBI A;  1BUV T;  1XYI A;  3EA6 A;  3K7A H;  1YZ6 A;  4FXD A;  2OQK A;  3PV0 A;  4NMZ A;  4AQY Q;  1Y1W G;  3NE5 B;  1BQQ T;  3MFY A;  1VQ8 A;  3RLN A;  4JG2 A;  2ZJQ A;  2IX0 A;  2F0M A;  4X66 L;  4DR1 L;  3L9A X;  4DV7 L;  4Y7N B;  2XN9 C;  4GLA C;  2DNE A;  4LFB Q;  3NTI A;  1NCV A;  1KAA A;  1RF2 D;  3Q23 A;  3H09 A;  3RZO B;  1S5D D;  2CH4 A;  1EYD A;  2I46 A;  1XMO Q;  1J5E L;  3HOV G;  2UUC L;  3M3Y H;  1WCM B;  1H9S B;  4DV1 L;  1QE6 A;  1ESR A;  4JBK A;  5I4D A;  4DAP A;  2F0T A;  5E4W C;  4ZCK A;  2RKS A;  2JEB I;  3D4D A;  3C1E A;  4DA2 A;  4G7H C;  3GTQ H;  1YBY A;  3GO5 A;  2LMC B;  4OEM B;  5IGD A;  2NVT B;  3Q6S A;  1BCP B;  1JOK A;  4IUQ A;  3OOC A;  2ASB A;  4BY7 H;  1PTO C;  1KIX A;  3MFG A;  4C56 C;  4OO1 G;  3URY A;  1G2T A;  1MGS A;  4UPA A;  1XMQ Q;  1O80 A;  1VQG A;  4I65 A;  1EQT A;  1K8M A;  3NEM A;  3CCQ A;  3NTH A;  5FLM G;  3SK5 A;  4Q0F A;  1U4M A;  5KYL A;  1Q1B A;  3QOJ A;  5IP9 G;  4DU9 A;  2AUK A;  2NVX H;  3EVQ A;  1J8I A;  4IPG A;  1E2V A;  4POF A;  3PO2 H;  4X66 Q;  4DR1 Q;  2PPB C;  4DV7 Q;  2J7Z A;  4KY6 A;  2FHT A;  1QNU A;  1E7Z A;  1D7Q A;  2F0N A;  3CME A;  2MPM A;  2RA4 A;  1ENC A;  1V1Q A;  2IHE A;  2R93 H;  3C1F A;  1TWF B;  1K28 A;  2AHO B;  1J5E Q;  2UUC Q;  3OWF A;  4OGQ C;  1L1O A;  4DV1 Q;  1Y1V G;  2I5L X;  5FJ8 G;  4CKC A;  3DEO A;  1SJE D;  1EQV A;  5CV8 A;  4DV2 Q;  2O5J C;  1I4H A;  3RZD H;  1EOV A;  2PO4 A;  4LK1 C;  4JVZ A;  4DV6 L;  1VQK A;  4G4K A;  1WTX A;  2PI2 A;  3TP8 A;  4PQX A;  2EYJ A;  5HY6 A;  5HGQ A;  3S1R H;  3M85 A;  4K8J A;  3MZ5 A;  3ULP A;  2XVS A;  3UDI A;  2A6H D;  2E74 C;  2LXK A;  2L4N A;  1IW7 C;  3B6Y A;  5DLQ E;  1M1K C;  2B2V C;  4HJ8 A;  4S3S A;  5I9O A;  5K36 H;  1R4P B;  1B1Z A;  1WTH A;  2PQA A;  3MWY W;  1O7L A;  4HCE A;  4H0L C;  2GVA A;  3CU7 A;  2D2C C;  3QOL A;  1B3A A;  3NSW A;  4JOI A;  2K50 A;  4YWK A;  4HJ5 A;  1SMY C;  1HNX L;  1Z9F A;  2PZT A;  2JSO A;  2YTY A;  1PZK D;  3J81 j;  4KY7 A;  1MD2 D;  1E24 A;  1NE3 A;  5FO9 B;  3MTS A;  1NBW A;  5FO7 B;  1PH1 A;  1QVF A;  1R4Q B;  2E5L L;  4BBS B;  2G9D A;  5NUC A;  4KJN A;  2M2L A;  1S72 A;  3J7A V;  1G91 A;  2DUD A;  2JA5 H;  3GTG H;  1B53 A;  1SNQ A;  5I9P A;  4GKJ L;  4K6D A;  2PYK A;  2WFW A;  1SEB D;  2UU9 L;  3DXJ C;  1CKN B;  2JA7 B;  1E0B A;  4C3J G;  5C4J B;  1TQO A;  4DR5 L;  3K7A B;  4ZAI A;  2PQE A;  3T13 A;  3NTK A;  1VF7 A;  2J0T D;  3L3O C;  5GAE C;  1VQP A;  1PH6 A;  4DKA C;  3SE0 A;  5JOB A;  3F2C A;  4UY8 C;  3EQL C;  3LWE A;  1LTI D;  1PTO F;  1A63 A;  5AJ3 L;  2WII B;  1CFM A;  1A15 A;  1TS2 A;  2VQE L;  3J81 L;  4JBJ A;  4A3E G;  2BOS A;  3DWQ A;  1A3V A;  1PRT C;  4HMI A;  3QG1 A;  5DNF A;  4X6A H;  3ULL A;  4QIW E;  1GO3 E;  4QUC A;  1CKO A;  3KUP A;  1IYJ B;  1SE3 A;  3M7N A;  5TSS A;  3HOZ H;  4OWT B;  1VQ9 A;  4XDX A;  2OT2 A;  2M00 A;  4ZRZ A;  4AYB E;  2UUA L;  2O4X A;  1XPR A;  4NB3 A;  4XT3 B;  2IX3 A;  4B3S L;  1U0L A;  3GTQ B;  1K0R A;  1EY4 A;  2VUM G;  1B50 A;  2E5L Q;  2D5D A;  2WAQ G;  1A0I A;  2A6E D;  1D5M C;  2R7D A;  4O1N A;  2BCO A;  2F0L A;  4PV1 C;  2K5H A;  3VR3 A;  5FK9 C;  4CJ2 C;  4GKJ Q;  4XT1 B;  3CC2 A;  3D31 A;  2R7Z G;  2F3W A;  3VYT A;  3CHB D;  1KC8 C;  2UU9 Q;  5F2D A;  2YYZ A;  1E3P A;  2RF4 A;  2EY6 A;  3FPU B;  4A3K B;  1N33 L;  2YV5 A;  3KLW A;  4HIK A;  3HOX B;  4DAY B;  2AMC B;  5IT9 L;  2H5X A;  4DR5 Q;  1B9M A;  5I2Y A;  3E0J A;  2EQS A;  2OEO A;  4HIO A;  1RL2 A;  2JJQ A;  1CZW A;  4B3T L;  5E3F A;  1AEX A;  1MBY A;  3PO2 B;  5AJ3 Q;  4PZ6 A;  1TS5 A;  2K52 A;  3NK9 A;  1PA6 A;  1KQS A;  3VA5 A;  1QZG A;  2VQE Q;  3S16 H;  1TR5 A;  2A68 D;  2CWP A;  4A3G G;  2K1B A;  5C0X G;  1HCZ A;  1LTS D;  5EPL A;  2CKZ B;  4TKO B;  1K83 B;  4U67 3;  4H13 C;  5IYB H;  3ERO A;  3ND8 A;  4OL7 A;  2R93 B;  2MGS A;  1K73 C;  4OIK A;  3GTP H;  4GKK L;  3WDN A;  4R4Q A;  1VQE A;  5M3F G;  1Z7T A;  2AWN A;  4PMW A;  1CKN A;  4B3S Q;  4KHP Q;  4GLV B;  1FGB D;  3I73 A;  1TWG H;  3I56 A;  2OXP A;  2JXM B;  1IKM A;  1EY5 A;  4RHR A;  4X65 L;  4MIU A;  2E2I H;  4L63 B;  5IYC H;  5ISR A;  3D6C A;  3CW2 C;  1SND A;  1N33 Q;  3H3V C;  4GNX B;  1BNZ A;  3PUX A;  2K05 A;  4A3I H;  2K4K A;  4QJF A;  2GA4 B;  1Z6H A;  4B3T Q;  2WIN B;  1KAB A;  3G71 A;  5BN4 A;  4BA2 I;  3F1Z A;  4DK0 A;  2B2Y C;  5M5X H;  2IJ0 A;  1SAP A;  1PTO D;  5JVG 3;  2F0H A;  5GAG C;  4BXX H;  1YIT A;  4HN7 A;  2ZTD A;  5JEA G;  1WVL A;  4B08 A;  1U9R A;  3A7L A;  4IOC A;  4GKK Q;  3U9O A;  4CKE A;  5JPM C;  4C2M B;  3AU7 A;  2R7F A;  4DAY A;  5IP7 H;  2YU9 B;  4NPS A;  4P72 A;  4YIJ A;  3E9I A;  2ATW A;  5IIF A;  4X65 Q;  2Z6K C;  1XTC D;  3SDZ A;  4RKB A;  3HOW G;  1QCB D;  2JP1 A;  5CC4 A;  2IHF A;  1EY9 A;  5KGU A;  1U4L A;  3K5O A;  1JB3 A;  3I4M B;  1XNR L;  3M7G A;  1X3P A;  3S1M H;  1TXY A;  1X54 A;  5IGE A;  4DV0 L;  2B63 H;  1YNJ C;  4P71 A;  5I6W A;  3BDL A;  4C1N I;  4A75 A;  1IBM L;  1WD0 A;  1SNO A;  3TQY A;  3AMU A;  4A3D H;  3KOJ A;  4JI3 L;  2Q8T A;  1M8A A;  4YCU A;  4KN4 C;  4NKL A;  3QJY A;  4DK1 A;  2WKD A;  1LTT D;  3FDT A;  4UP7 A;  2UXD L;  2A69 C;  5KNC A;  2F0P A;  2F0O A;  2KJX A;  2NZH A;  3DUZ A;  2LSS A;  4FF2 A;  1ZEQ X;  1IW7 D;  4R4I A;  3Q24 A;  1Q8K A;  1RJT A;  2KCC A;  1IYU A;  1GUN A;  4IJH A;  3TP5 A;  4GNX A;  3S15 B;  3V05 A;  2IL8 A;  3KJP A;  3S17 B;  1WTW A;  4Y7N H;  4RGN A;  1W3S A;  1EFW A;  4HID A;  4DXF A;  4IFD I;  4EX5 A;  1SMY D;  3SR1 A;  2UUB L;  2AQ2 B;  3T4A C;  1K8G A;  2LY7 A;  4GN4 B;  3PGZ A;  4JI7 L;  2V1C C;  4YWL A;  1X3G A;  5EKL A;  1LV9 A;  4FF3 A;  3RZO H;  2BH2 A;  3KF8 B;  2EJG C;  1IKL A;  4UP8 A;  3X3N A;  1LT4 D;  3I8Z A;  2OTL A;  1XNR Q;  1TWH B;  1WCM H;  1CA6 A;  2IW3 A;  2KUM A;  4DV0 Q;  1XPU A;  5G3L F;  4BBR B;  1BXT A;  2RHS B;  1FR3 A;  4A3J G;  2EXD A;  1IBM Q;  4LF5 Q;  1I4G A;  4WOR A;  2HIX A;  3KBG A;  3TS2 A;  5CV6 A;  2G5D A;  3HFZ B;  4IUT A;  4J8Q A;  3G4S A;  3S14 H;  2B2W A;  3P75 A;  1VS0 A;  4RGO S;  2UXD Q;  3DEP A;  2MO1 A;  3BJU A;  3SHL A;  4X3S A;  5FLX c;  3DLL A;  2EYF A;  5J1Z A;  2DN8 A;  1UWV A;  1TWG B;  2P5Z X;  1WOC A;  1IYV A;  4FO2 A;  1PRT D;  3RMH A;  1K8A C;  2K01 A;  4C3I H;  3S1N B;  4HJ7 A;  1WTO A;  1CQF A;  3CCV A;  3GTM H;  2JQO A;  3EN2 A;  2UUB Q;  2NTT A;  3FMC A;  4XQQ A;  2WB1 E;  1I94 L;  4JI7 Q;  1L1O C;  3E3X A;  1D8L A;  5J39 A;  1A3U A;  4B3M Q;  3K5M A;  3FKI B;  1JT8 A;  1LT5 D;  2ZM6 L;  3GTL H;  1CZG A;  4IO9 A;  1JWS D;  2D0O A;  3IFD A;  4AYB B;  3MXG A;  2L12 A;  3HOY B;  5C5M A;  2MQH A;  4BWG B;  1ZYR C;  2DGY A;  3GTJ H;  1DGS A;  2QDB A;  4DV3 L;  3J80 i;  2HQL A;  2F0U A;  5C4Z A;  4JI1 L;  3I2Z A;  2ID0 A;  1CK1 A;  4MHE A;  2F1M A;  1HH2 P;  4A4I A;  4CKB A;  1E2Z A;  1II3 A;  3OW7 A;  3BG3 A;  2HHH L;  2PW7 A;  3PIO 3;  3J7Y W;  3VDY A;  4OON A;  2UXC L;  2EPB A;  1B3Q A;  1GVP A;  2L1B A;  2QEJ C;  4IFD H;  4JOI C;  2RDH A;  3GV6 A;  4GN3 B;  3DMU A;  1LTL A;  2B2U A;  1X56 A;  1KRS A;  3N52 A;  5C44 G;  3K7U C;  3ND9 A;  4FNF A;  2X69 A;  1Z47 A;  1HUM A;  3U50 C;  2VS1 A;  4CJ0 B;  1C48 A;  3I91 A;  2TMP A;  4A3E B;  1I94 Q;  1VQ6 A;  4ILW A;  1JOO A;  3G6E A;  3QO2 A;  3PUV A;  2KED A;  3E9H A;  1NMG A;  3A55 A;  1X6O A;  4BY1 H;  1G29 1;  3IKJ A;  1IXR A;  4TVA B;  2ZM6 Q;  1QJO A;  2AUJ D;  3BDO A;  2KQ3 A;  4DGZ A;  2XIW A;  2VW9 A;  5G3L D;  1WI5 A;  3A8J E;  1C4Q A;  1SE8 A;  1SYF A;  3ULJ A;  1PMR A;  5K36 G;  2L55 A;  2K28 A;  2VUM B;  4ME5 A;  4DV3 Q;  5DEH A;  5A2Q L;  2AWO A;  3QWN A;  3JAM i;  1X65 A;  4JI1 Q;  1DD2 A;  5C4J H;  1NMF A;  3HOU G;  2UXB L;  2Q8I B;  3PUY A;  1WYD A;  4L8J A;  2RDF A;  1HTP A;  1QG7 A;  4K2L A;  3NEN A;  2R7Z B;  1GD7 A;  1TS3 A;  1A2T A;  1A6X A;  2J4X A;  1LTG D;  1H9M A;  2HHH Q;  3K0X A;  3RLF A;  3VR4 A;  4LUO A;  5KIX A;  1EIY B;  2UXC Q;  4CJ1 B;  3PQI A;  4GOP A;  3RUZ A;  4L5R C;  5FLX E;  2E2J B;  2K32 A;  3U58 A;  4ZLT F;  2JA5 G;  1STB A;  2BE5 C;  2I5M X;  3KF6 B;  1T9H A;  2QCP X;  1MJE A;  1EYC A;  4A3G B;  3JAM c;  2NN6 I;  1FNV A;  3F2B A;  1FJG L;  3I4N B;  2JA9 A;  2L9H A;  2GVB A;  4BA1 I;  1AP0 A;  4XXE A;  2HUG A;  1HRJ A;  1FD7 D;  1MJC A;  3EJI A;  2JE6 I;  1PH8 A;  1EIH A;  2KOL A;  1K8O A;  4HIM A;  4MN3 A;  3CCM A;  3S14 B;  3CPW A;  1Q46 A;  1Q7Y C;  3CMA A;  4UDU C;  3PCO B;  4A3K H;  4TSS A;  3NUC A;  2QGQ A;  3HOX H;  2UXB Q;  1DON A;  1TY2 A;  3T56 B;  4A3L H;  1DCZ A;  1G6P A;  4L5S A;  3NP8 A;  2SNS A;  3F8T A;  1YNJ D;  3R3O A;  4C3H G;  3BZC A;  3HOZ G;  5KNB A;  4FXK C;  4DN4 M;  1EU3 A;  3GQB A;  1ENA A;  1JIC A;  5M5Y B;  2VZA A;  3V2T A;  3TZD A;  1PDQ A;  1BR9 A;  4KMU C;  2VL6 A;  2ZJR A;  3W3A A;  4C3I B;  1F2M A;  3G6J B;  4QF4 A;  2F0W A;  2Z0S A;  2EYO A;  3GTM B;  3R93 A;  1E2W A;  1K83 H;  1TVX A;  3PSI A;  3UI2 A;  4PZ7 A;  1I6H H;  3RNU A;  4B9W A;  1F9S A;  5AFW A;  4A3B G;  2QIL A;  1PFB A;  1I4R A;  3GTL B;  3MEH A;  3SEB A;  4ME3 A;  2B29 A;  4OO1 I;  1N8R C;  1SLJ A;  3TZU A;  3GTJ B;  3PIP A;  3BDC A;  3J80 E;  3S2D B;  1HNZ L;  4LNQ A;  4QCL A;  2EJF C;  4IQZ A;  1NR4 A;  4WJ3 M;  2RBM A;  4OX9 L;  4MZ9 A;  5M3M B;  5C6A A;  3L0O A;  5LL6 X;  1C7Y A;  5C0X J;  1SSO A;  4JI0 L;  1UE1 A;  4LJZ C;  4UAI A;  3UDF A;  5IYB G;  1DJR D;  1EEI D;  4JYA L;  1LUZ A;  1N32 L;  1I3Q B;  4FDB A;  3H91 A;  1XXG A;  5LMN L;  3CD6 A;  4B3R L;  3RR5 A;  3KLS X;  1H9S A;  4A93 B;  2MJ8 A;  1RDP D;  2B3G A;  3OSO A;  1EWC A;  1NTG A;  3BVG A;  3CRL C;  2NZ1 D;  1D5X C;  1UE5 A;  2RVL A;  4A76 A;  4DPG A;  1JMC A;  1PTO B;  1PZJ D;  3ICE A;  4BY1 B;  5I2X A;  2R92 G;  3W2D A;  2O5I C;  2JA8 B;  1DZ1 A;  4A3I G;  4YCW A;  5EBC A;  4C2M H;  4YHH L;  1S4Z A;  4RKL A;  1NSN S;  2EYH A;  1I4P A;  2SNM A;  5GQO A;  3VA7 A;  2YU9 H;  4IJL A;  1ESF A;  4HJA A;  5IWA L;  1HNZ Q;  5EAY A;  3PMF A;  1EQR A;  3JAM E;  4DV6 Q;  1QNK A;  3M4P A;  3C46 A;  4F88 A;  1TWC H;  4KD4 A;  4BXX G;  3A8I E;  3I4M H;  4DR7 L;  4CHT B;  4JI0 Q;  3KDF B;  5EQ0 A;  1SYG A;  5JEA J;  2WB1 B;  4JYA Q;  3T1Y L;  1N32 Q;  1E1O A;  3GP7 A;  2NYZ D;  1Q8I A;  5IGC A;  1ZYR D;  5LMN Q;  4YWM A;  2PCF B;  4B3R Q;  1SDF A;  3A8K E;  2Y0S B;  1OXX K;  5IGB A;  2VB2 X;  3GDE A;  4DNI A;  1STE A;  1SYE A;  1N34 L;  1VQ7 A;  2XWB B;  4EQN A;  3I3C A;  3IL8 A;  3LWU A;  3MAQ A;  2F0Q A;  3A0J A;  3SGI A;  4OO1 H;  3VR6 A;  4JI5 L;  4A3F B;  1ZKO A;  1F77 A;  2N8N A;  1F9P A;  3TBI B;  4GNX C;  4NDX A;  4DK6 C;  4LF9 L;  1VQ5 A;  1W2B A;  2Q2I A;  3SK8 A;  3AEV A;  3J7Z C;  3MVV A;  3OIQ A;  2B63 G;  3S15 H;  3P20 A;  3GTK B;  5CBE E;  1CUK A;  3S17 H;  1EOT A;  1YVC A;  1VCI A;  5D65 A;  5M5W B;  5IWA Q;  2XTI A;  1YNN C;  1C8C A;  1VQA A;  1Y69 U;  1HPC A;  3AB9 A;  1HZA A;  2Z6B A;  3FHW A;  1JR0 D;  1IBK L;  4DR7 Q;  3QIA A;  2DJG C;  4LF4 L;  1Q86 C;  1TWH H;  4CDF C;  3KLR A;  3ZJY C;  4IUP A;  4KLK A;  3H0G G;  3T1Y Q;  1UAP A;  1A62 A;  4H7B A;  4IPC A;  2Q2U A;  1EU4 A;  4BBR H;  3BYY B;  3ER0 A;  1UEB A;  3HP3 A;  3F2U A;  5C4X B;  5DM7 3;  4ZUI A;  1Y8P B;  5JPN C;  1Y1V H;  1XJV A;  2B2W C;  2Z8L A;  5C3E G;  3Q22 A;  1OTC A;  1PV4 A;  1Q82 C;  1I6H B;  1ROD A;  1G51 A;  3J81 c;  2KHJ A;  1JJ2 A;  1N34 Q;  1CT1 D;  4KKS A;  4LF8 L;  1LAC A;  1X3E A;  4A3M B;  1QVC A;  1DXM A;  2UUA Q;  4X3K A;  4JI6 L;  4DR4 L;  1SXT A;  4X62 L;  4QL5 A;  4JI5 Q;  1L0W A;  1SBB B;  4ZUJ A;  4DF7 A;  1JE4 A;  4LF9 Q;  2VXW A;  3S24 A;  3V96 A;  4ULL A;  2R3Z A;  4UHV A;  3W1B A;  5CMD A;  1P16 A;  3KDF A;  2RSN A;  1CTM A;  3S1N H;  1V1P B;  3NPP A;  2MUY A;  2BDO A;  4F7X A;  3HEJ A;  1BBW A;  1HTL D;  4IOA A;  5C44 B;  1IBK Q;  1PRT B;  1CKM A;  2K6A A;  4MTN A;  4JI2 L;  2N55 A;  4LF4 Q;  3L2P A;  4KK7 A;  3T53 B;  3FKI H;  1B44 D;  5C0X I;  2DY8 A;  2GN5 A;  5IT9 c;  4HR7 B;  2HD3 A;  3HOY H;  3BZK A;  1G2S A;  3K80 C;  1IL2 A;  4XYQ A;  4CDD C;  1NY4 A;  2EYP A;  1X3Q A;  3PF4 A;  1EWI A;  2F0V A;  1VQJ A;  1JJC B;  5IYD G;  2D9U A;  1EY8 A;  2EY2 A;  3CXC A;  1S5C D;  3TME A;  2JEA I;  4YY3 L;  4LFC L;  4LF8 Q;  3MC0 B;  4JBW A; 
#chains in the Genus database with same CATH homology
 3EIV A;  3CCV A;  2K5V A;  3GTQ H;  1A8V A;  1YBY A;  1FGU A;  2JQO A;  3GO5 A;  2KCT A;  3EN2 A;  4LFA Q;  3U4V A;  2FXQ A;  3U4Z A;  5IP7 G;  2CQO A;  4X62 Q;  2UUB Q;  4DR4 Q;  2D62 A;  2WB1 E;  1I94 L;  4JI7 Q;  3NBH B;  3STB C;  1L2F A;  1HZC A;  1L1O C;  3CCJ A;  2ASB A;  4BY7 H;  5LMU Q;  1D8L A;  3GD7 A;  3TRE A;  1SFO H;  1KIX A;  3W5O A;  3K81 C;  4OO1 G;  1PH2 A;  2CCZ A;  4B3M Q;  4TQU S;  4UPA A;  1XMQ Q;  1JT8 A;  4LWC A;  3PO3 G;  2ZM6 L;  3GTL H;  3S2H H;  4IO9 A;  1VQG A;  2D0O A;  5GAH C;  1VQL A;  2VNU D;  3NEM A;  1VQH A;  4L5Q A;  3CCQ A;  5IE8 A;  5JJK A;  5FLM G;  4A3E H;  1KAW A;  2MQH A;  2DGY A;  4YHH Q;  3GTJ H;  1SRO A;  1DGS A;  2N49 A;  1Q1B A;  3H3V H;  1KL9 A;  5FLM H;  5IP9 G;  4DV3 L;  1JE5 A;  3J80 i;  4JI2 Q;  3J81 i;  2NVX H;  2HQL A;  4C3H H;  4H02 A;  5IP9 H;  4IPG A;  3I2Z A;  2ID0 A;  4JI1 L;  4POF A;  4C3I H;  3RN5 A;  3PO2 H;  4A3D G;  1HH2 P;  4A4I A;  4X66 Q;  4DR1 Q;  4DV7 Q;  3HKS A;  4IFD J;  4KHP L;  3T1H L;  1E7Z A;  1HR0 L;  1D7Q A;  4QGU A;  3CME A;  2HHH L;  2I5H A;  2MNA A;  1V1Q A;  2IHE A;  2VUM H;  3UE1 A;  3VDY A;  2R93 H;  4OON A;  2UXC L;  4LUV A;  1PH9 A;  1GVP A;  2NVQ H;  2A19 A;  2JA6 G;  2BA1 A;  2AHO B;  4JOI C;  1J5E Q;  4GN3 B;  2UUC Q;  1HNW Q;  1L1O A;  4DV1 Q;  4A3B H;  1Y1V G;  2I5L X;  4YY3 Q;  1LTL A;  5FJ8 G;  1X56 A;  1KRS A;  5C44 G;  4LFC Q;  3K7U C;  4QY7 A;  1OXT A;  4R1J A;  1KRT A;  2R7Z H;  4DK3 C;  1Z47 A;  5FJ8 H;  4A3C G;  4DV2 Q;  1FJG L;  1VQC A;  3U50 C;  2VS1 A;  4DAM A;  5IY0 A;  1HZ9 A;  1X3F A;  3RZD H;  2RCN A;  1EOV A;  4A3C H;  1I94 Q;  1VQ6 A;  2ES2 A;  4GOP C;  3G6E A;  1OXS C;  3CCR A;  1WJJ A;  1PHJ A;  4Y52 H;  1U5K A;  4DV6 L;  1FL0 A;  3PUV A;  1VQK A;  3E9H A;  3A5U A;  1NMG A;  4BBS G;  1X6O A;  2PI2 A;  4BY1 H;  1G29 1;  4J15 A;  1IXR A;  3IRB A;  4TVA B;  4JCV E;  2ZM6 Q;  2E2J H;  5HY6 A;  5HGQ A;  2OWO A;  3D0F A;  3GTO H;  1BKB A;  3S1R H;  3M85 A;  2CWA A;  4XTC S;  3MXN B;  2VW9 A;  3ULP A;  1WCM G;  1WI5 A;  3UDI A;  1SE8 A;  2WAQ E;  2LXK A;  3I4N G;  3ULJ A;  3S1Q H;  4A3G H;  2JA7 G;  5K36 G;  3B6Y A;  5DLQ E;  3CCL A;  1M1K C;  4HJ8 A;  1PVO A;  4DV3 Q;  1YIJ A;  3I4N H;  1AE3 A;  2N3S A;  2AWO A;  3JAM i;  1X65 A;  4JC0 A;  2YTX A;  4JI1 Q;  1NMF A;  2PQA A;  5C4J H;  3HOU G;  2UXB L;  5J3B A;  2GVA A;  3AFQ A;  3PUY A;  1WYD A;  2KEN A;  3OTO L;  5M3F H;  4JOI A;  3NEN A;  4ALP A;  1GD7 A;  2K50 A;  4YWK A;  1YI2 A;  4JI3 Q;  3T1H Q;  1HR0 Q;  4HJ5 A;  1HNX L;  1Z9F A;  1EUJ A;  2QA4 A;  2HHH Q;  3K0X A;  1N9W A;  4DUZ L;  2YTY A;  3RLF A;  4LUO A;  4X64 L;  1BBU A;  3J81 j;  1EIY B;  2UXC Q;  4WJ4 A;  1E24 A;  2RHQ B;  1NE3 A;  2IT1 A;  1P8L A;  1NBW A;  1PH1 A;  4GOP A;  4GN5 A;  1AE2 A;  3ERS X;  1QVF A;  4L5R C;  2E5L L;  5JJI A;  3U58 A;  2JA5 G;  2N78 A;  2I5M X;  3KF6 B;  5E7N A;  3FP9 A;  1KD1 C;  1S72 A;  4POG A;  2R92 H;  2PI2 E;  1T9H A;  3PF5 A;  3KFU A;  1VQM A;  2HIV A;  1MJE A;  2DUD A;  2JA5 H;  5M5Y H;  3GTG H;  4GKJ L;  1CSQ A;  2WFW A;  4JI8 L;  2ALY B;  1YJW A;  3JAM c;  3Q8D A;  2NN6 I;  3HKZ G;  4R4T A;  3PIO A;  3G48 A;  4NXN L;  3F2B A;  4YCV A;  1CKN B;  2UU9 L;  2JA9 A;  2GVB A;  4GLX A;  4BA1 I;  4EQ5 A;  1XNQ L;  2IY5 B;  2A8V A;  4DR5 L;  4C3J H;  1MJC A;  2VQF L;  2MO0 A;  1XPO A;  4BY7 G;  2JE6 I;  1PH8 A;  4APV A;  1ASZ A;  4L5T A;  5GAE C;  1HJP A;  3W1G A;  1VQP A;  1PH6 A;  4HIM A;  4DKA C;  3F2C A;  4UY8 C;  2YTV A;  3J7A 5;  1QUQ B;  3CCM A;  2OQ0 A;  1A63 A;  5AJ3 L;  1Q46 A;  3CPW A;  2VY3 A;  3HOX G;  1Q7Y C;  2Y0S E;  5ELN A;  3CMA A;  2VQE L;  3PCO B;  4A3K H;  4JBJ A;  4A3E G;  4JI4 L;  1HZB A;  1H95 A;  1GM5 A;  4P73 A;  2QGQ A;  3HOX H;  2UXB Q;  4A3L H;  3L7Z C;  1N36 L;  1HR0 W;  4X6A H;  1G6P A;  1C0A A;  3ULL A;  4QIW E;  3OTO Q;  4L5S A;  1GO3 E;  3F8T A;  3AQQ A;  2LXJ A;  3BZC A;  3HOZ G;  3S2D H;  1VQN A;  1CKO A;  5M3M G;  3PO2 G;  1B70 B;  1IYJ B;  2KCM A;  3M7N A;  3HOZ H;  4OWT B;  1VQ9 A;  3CCS A;  2VZA A;  3UDX A;  3KYH C;  4DUZ Q;  2BH8 A;  5M3M H;  1Q81 C;  1M90 C;  4X64 Q;  4AYB E;  2UUA L;  2ZJP A;  1XPR A;  2HT1 A;  1X55 A;  2VL6 A;  2ZJR A;  4NB3 A;  4B3S L;  1U0L A;  2Z0S A;  1K0R A;  2VUM G;  3HOW H;  2R93 G;  3H15 A;  1K83 H;  2E5L Q;  2WAQ G;  5GRO A;  1A0I A;  3PSI A;  4IFD G;  4PZ7 A;  1I3Q H;  2R7D A;  3RNU A;  1I6H H;  4IPH A;  1B7Y B;  2K5H A;  4A3B G;  3LGJ A;  1S40 A;  3I55 A;  4GKJ Q;  4A93 G;  4DR2 L;  3CC2 A;  4JI8 Q;  3D31 A;  2R7Z G;  2L15 A;  4O2D A;  4NXM L;  4DR3 Q;  4A93 H;  3OW2 A;  1YNX A;  1KC8 C;  2UU9 Q;  4LF5 L;  4NXN Q;  2YYZ A;  1E3P A;  1V43 A;  2RF4 A;  1N33 L;  5JJL A;  4ME3 A;  2YV5 A;  1CSP A;  3KLW A;  4HIK A;  2B29 A;  1HNX Q;  4OO1 I;  5H1S E;  1R9T H;  1LYL A;  1N8R C;  4DAY B;  1XNQ Q;  2AMC B;  1SLJ A;  2H5X A;  4DR5 Q;  1ASY A;  2VQF Q;  2F4V L;  2EQS A;  2IX1 A;  3PIP A;  4HIO A;  3M4O H;  1RL2 A;  5ELO A;  2JJQ A;  4BY1 G;  1PH4 A;  1HNZ L;  4LNQ A;  4B3T L;  4WJ3 M;  1YJ9 A;  2JA8 G;  4OX9 L;  4LF7 L;  4MZ9 A;  4RMF A;  3I7F A;  4PZ6 A;  5AJ3 Q;  2K52 A;  3H0G H;  3L0O A;  1PA6 A;  4PG3 A;  1KQS A;  1QZG A;  2AKW B;  1C7Y A;  5C0X J;  2JA8 H;  2VQE Q;  4JV5 L;  3S16 H;  4K0K L;  4P74 A;  2XGT A;  4JI4 Q;  4JI0 L;  1UE1 A;  2OTJ A;  3UDF A;  2CWP A;  5IYB G;  4A3G G;  4LF6 L;  5C0X G;  3E0E A;  1N36 Q;  2CKZ B;  4JYA L;  1LUZ A;  5IYB H;  1N32 L;  3TS0 A;  4R4C A;  2D0P A;  5C3E H;  4FDB A;  1K73 C;  1JB7 A;  3GTP H;  1VQB A;  4GKK L;  5LMN L;  3CD6 A;  1UE7 A;  4R4Q A;  1YHQ A;  1VQE A;  3RR5 A;  4B3R L;  3BU2 A;  5M3F G;  1C9O A;  3JC6 6;  2AWN A;  4PMW A;  1CKN A;  2B3G A;  1XTD A;  2WB1 G;  2F3I A;  3OYY A;  1NTG A;  4QQB X;  4B3S Q;  4KHP Q;  4GLV B;  2ZTC A;  4OWX B;  1TWG H;  4LUZ A;  3I56 A;  4B3M L;  1UE5 A;  4A76 A;  4X65 L;  5GAD C;  1XMQ L;  1KXL A;  4DPG A;  3CP0 A;  1AH9 A;  1UE6 A;  1JMC A;  2Y0S G;  1OXU A;  3ICE A;  2E2I H;  5IYC H;  4NXM Q;  2R92 G;  3CW2 C;  1WFQ A;  1SR3 A;  3MEF A;  4A3I G;  1N33 Q;  2NVT H;  1IZ6 A;  4YCW A;  4C2M H;  4YHH L;  4GNX B;  1EQQ A;  4JBM A;  4A3J H;  5GQO A;  1FVI A;  3PUX A;  4O0A A;  2YU9 H;  4A3I H;  2F4V Q;  4IJL A;  2K4K A;  1V9P A;  4QJF A;  3GTM H;  4HJA A;  4A3F G;  5IWA L;  1HNZ Q;  5EAY A;  4B3T Q;  1EQR A;  4DV6 Q;  3G71 A;  1JJG A;  3M4P A;  4A3F H;  2KBN A;  1VQ4 A;  3TRZ A;  3I4M G;  1S3O A;  2PNH A;  4LF7 Q;  4BA2 I;  4IPD A;  3F1Z A;  1TWC H;  3STB D;  5M5X H;  1Y14 B;  2I0Q A;  4BXX G;  3I4M H;  3AYH B;  4JV5 Q;  4DR7 L;  4K0K Q;  1IBL L;  3CCE A;  4JI0 Q;  3KDF B;  5GAG C;  4BXX H;  3PUW A;  1YIT A;  4LF6 Q;  5JEA J;  3S17 H;  4JYA Q;  3T1Y L;  3GTK H;  4GS3 A;  1N32 Q;  1SN8 A;  2ZTD A;  4XIG S;  1VQD A;  2MFI A;  5M5W H;  4A3K G;  5JEA G;  5IYD H;  1E1O A;  2PQA B;  1PH7 A;  1Q12 A;  4DR3 L;  4IOC A;  4GKK Q;  3I4O A;  3A5Z B;  5LMN Q;  4YWM A;  4A3L G;  4B3R Q;  4DV2 L;  4P75 A;  1K3R A;  1OXX K;  3GDE A;  4DNI A;  3TEH B;  1PH3 A;  2R7F A;  4AH6 A;  1N34 L;  2E8G A;  5IP7 H;  5BR8 L;  3UDG A;  1VQ7 A;  1TWF H;  2BA0 A;  4NPS A;  4P72 A;  2PMZ E;  3E9I A;  3PUZ A;  1PFS A;  4OXP A;  2ATW A;  5C4X G;  4X65 Q;  4GOP B;  2Z6K C;  3A0J A;  3F2D A;  2C35 B;  3SGI A;  3CF5 A;  3HOW G;  5C4X H;  4JI5 L;  1YHB A;  1GKH A;  2IHF A;  3CQZ H;  4DV5 L;  4LF9 L;  2N8N A;  1O7I A;  3CPF A;  3KJO A;  4DK6 C;  4GNX C;  3PO3 H;  1VQ5 A;  1SMX A;  1W2B A;  4OWW B;  2Q2I A;  1PYB A;  1MIU A;  2EIF A;  3AEV A;  3J7Z C;  1YJN A;  2B63 G;  4A3M G;  1XNR L;  3S15 H;  2KHI A;  4DR6 L;  2NZO A;  1E22 A;  3WWV A;  3S1M H;  3DM3 A;  1TXY A;  1CUK A;  1X54 A;  1YVC A;  1I5F A;  1VCI A;  4P71 A;  4DV0 L;  4A3M H;  1X9N A;  2B63 H;  1EIF A;  2F52 A;  1E1T A;  2XTI A;  3UE0 A;  5IWA Q;  4A75 A;  1FJG Q;  1VQA A;  1VQO A;  1IBM L;  1MKH A;  3HKZ E;  1QVG A;  1I50 H;  2JK8 A;  2K14 A;  3TQY A;  4PZ8 A;  1HZA A;  4A3D H;  4UP9 A;  3KOJ A;  3FHW A;  1IBK L;  4JI3 L;  2WP8 J;  4AQY L;  3RLO A;  3AFP A;  4DR7 Q;  1NJI C;  4YCU A;  3M9B A;  1IBL Q;  4LF4 L;  1Q86 C;  3NEL A;  1PH5 A;  2OCE A;  1TWH H;  4BBR G;  3H3V I;  3ZJY C;  1TWA H;  4KLK A;  3H0G G;  3K8A A;  3T1Y Q;  1A62 A;  4IPC A;  4UP7 A;  1K9M C;  2Q2U A;  2UXD L;  1B8A A;  5LMN W;  4BBR H;  1YEZ A;  3CC7 A;  3ER0 A;  1UEB A;  2JA6 H;  2NZH A;  4DV4 L;  4LFB L;  2LSS A;  2ZTE A;  1BVS A;  4DUY L;  1LM0 A;  1Y1V H;  4R4I A;  1Q8K A;  2Z6K A;  5C44 H;  5C3E G;  1XJV A;  2E2H H;  1OTC A;  3CAM A;  1OXV A;  1PV4 A;  4KI0 A;  1Q82 C;  4IJH A;  1SRU A;  2A1A A;  1G51 A;  3KF6 A;  3J80 c;  3J81 c;  2KHJ A;  4GNX A;  1XMO L;  1N34 Q;  1JJ2 A;  5BR8 Q;  2R6G A;  1KHI A;  4KHZ A;  3KJP A;  3RN2 A;  1X3E A;  4LF8 L;  1QVC A;  4Y7N H;  1W3S A;  1EFW A;  4HID A;  2UUA Q;  4IFD I;  4EX5 A;  2CFM A;  4LFA L;  4JI6 L;  2UUB L;  4DR4 L;  4X62 L;  1K8G A;  4BBS H;  4QL5 A;  4JI5 Q;  1L0W A;  4GN4 B;  3PGZ A;  4DV5 Q;  3M4Q A;  2NVY H;  2V1C C;  4YWL A;  1X3G A;  4JI7 L;  4LF9 Q;  2NN6 G;  1YHA A;  3RZO H;  4MNO A;  2BH2 A;  3S24 A;  3KF8 B;  5LMU L;  4UP8 A;  1Q1E A;  3W1B A;  1P16 A;  3CCU A;  3KDF A;  4LW1 A;  2OTL A;  1XNR Q;  1L1O B;  1WCM H;  3A74 A;  5IYC G;  4DR6 Q;  4DV0 Q;  2JA7 H;  3EBE A;  4DR2 Q;  1QUQ A;  1XPU A;  3S1N H;  1EYG A;  2RHS B;  2K75 A;  4JI6 Q;  4A3J G;  2EXD A;  1IBM Q;  1VQI A;  4LF5 Q;  4R4O A;  2HIX A;  3K7A H;  3HOU H;  1BBW A;  4AIM A;  3TS2 A;  1YZ6 A;  4IOA A;  2OQK A;  1IBK Q;  1CKM A;  3PV0 A;  3FKI G;  4MTN A;  4HJ9 A;  4AQY Q;  1Y1W G;  4JI2 L;  1VQ8 A;  3HFZ B;  3RLN A;  4LF4 Q;  3L2P A;  3G4S A;  3FKI H;  2K5N A;  4JG2 A;  4AYB G;  1Y1W H;  1RIP A;  2ZJQ A;  3S14 H;  1VS0 A;  2IX0 A;  5C0X I;  3HOY G;  2Q2H A;  2GN5 A;  4X66 L;  5IT9 c;  4DV7 L;  4DR1 L;  3CC4 A;  4OX9 Q;  2UXD Q;  2MO1 A;  3HOY H;  3BJU A;  3BZK A;  4GLA C;  2Q2T A;  1PYS B;  5FLX c;  1QZH A;  3DLL A;  3K80 C;  4RG1 A;  4DV4 Q;  4LFB Q;  1IL2 A;  1NY4 A;  4DUY Q;  3PF4 A;  1EWI A;  1VQJ A;  2QEX A;  1JJC B;  5IYD G;  1UWV A;  3CXC A;  1J6Q A;  1XMO Q;  1J5E L;  3HOV G;  2UUC L;  1WOC A;  3M3Y H;  1HNW L;  1VQF A;  4DV1 L;  2JEA I;  4YY3 L;  4JBK A;  4LFC L;  3HOV H;  1K8A C;  4LF8 Q;  2JEB I;  4HJ7 A;  4JBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...