2KHIA

Nmr structure of the domain 4 of the e. coli ribosomal protein s1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
WVAIAKRYPEGTKLTGRVTNLTDYGCFVEIEEGVEGLVHVSEMDWTNKNIHPSKVVNVGDVVEVMVLDIDEERRRISLGLKQCKANPWQQFAETH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the relationship between Gram-negative and Gram-positive S1 proteins by sequence analysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S1
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2khiA00
3SGIA 2K5HA 4IOAA 4AIMA 2I5LX 3A74A 5IP7G 3T1HQ 2HT1A 1Y14B 5IYCG 1BBUA 4HJ5A 4JI7Q 3S2HH 4JYAL 4DAMA 2ID0A 1MJCA 5FLMG 1CKNA 3GTQH 4DV4Q 4OWTB 2GVBA 2IX0A 1TWGH 1E22A 1VQFA 2ALYB 3AQQA 5C0XI 4LW1A 4JCVE 1M90C 3CPFA 4LWCA 1PV4A 2LXJA 3S1NH 4DV6L 4DV5Q 3STBC 3GTMH 2R6GA 3MEFA 3NELA 4PG3A 1KXLA 1B7YB 1I50H 4P71A 3S1QH 3NEMA 2R7ZH 3CCMA 2UUAL 1K8GA 2RHQB 1TWCH 3S1MH 4K0KQ 1GVPA 4GNXA 1EIYB 3NENA 3UE0A 2IHFA 1YI2A 1XPOA 4A3CH 1CKOA 3J7ZC 1N33L 4NXML 1QZHA 2NVTH 2H5XA 4A3JH 3HOUH 2VY3A 3HOVH 1X54A 3CW2C 3K80C 3S17H 1OXTA 2I5MX 1VQ4A 3G4SA 3KJOA 1E1OA 1FVIA 1Q82C 3H3VH 1OXVA 2LXKA 2D0PA 4H02A 1G51A 2Q2UA 3E0EA 4JI8Q 4A3EG 5GAHC 4PZ7A 2R92H 2NZHA 1YHAA 2JA7G 2Q2IA 1JJGA 3PSIA 4JI2L 2JE6I 2ATWA 4NXNL 4DUYL 3ULPA 4AYBE 4DV2L 4DAYB 1E3PA 4GLVB 1N34Q 4DR4Q 2XGTA 1SE8A 4DR7L 2ZJRA 1X55A 1HNZQ 4P75A 1Q81C 1AH9A 1Y1WG 1VQOA 1HR0Q 2DGYA 4GOPA 1S72A 2R7DA 4GKJQ 2VQEQ 1V43A 3M9BA 4BBRH 5M3FH 4JI4L 1MKHA 2NVYH 5C44H 5M3MH 4A3JG 1I94L 2ES2A 4IFDG 3KFUA 4KHZA 1Y1VG 1YNXA 2HHHQ 3DLLA 1D8LA 3H3VI 3PV0A 4JV5Q 1YJ9A 3K8AA 3PCOB 3W5OA 3F2CA 4HJ8A 2RF4A 2UUAQ 1YBYA 1WCMG 4JBJA 4JI5L 5LMNQ 4C3IH 3OW2A 3TS0A 3CMAA 1CUKA 1HZAA 3PUVA 2QEXA 1YEZA 2VL6A 4P73A 4PZ6A 2E5LQ 4DV1L 3M85A 2VUMG 4JI1Q 5C0XJ 4DV2Q 3A5UA 2K75A 4EX5A 3ICEA 3H15A 5BR8L 1X3GA 1X3FA 2F4VL 4GS3A 3GTGH 1P16A 1PYSB 1YHBA 3B6YA 1QUQB 2UXDL 2Z0SA 4IFDJ 4JI8L 1M1KC 4A3LH 1KD1C 4IFDI 3F1ZA 1XPRA 4O2DA 1DGSA 3CF5A 4POFA 5GROA 5C4JH 1H95A 3M4OH 1C9OA 2MO1A 1X56A 4YY3Q 1YIJA 4BA2I 3JAMc 1SFOH 4GNXB 4JBMA 2ZTEA 4YWKA 4A75A 3S16H 3L2PA 3CC7A 1KIXA 1UE7A 1N32L 1J5EL 3TS2A 1Z47A 2C35B 1JJCB 4IJHA 4DV4L 4A3KG 4MZ9A 2UXBL 2VQFL 3CCSA 4K0KL 5IY0A 1V9PA 1JE5A 1G6PA 2K14A 2WAQE 5BR8Q 1PH4A 1CKNB 1V1QA 3CCJA 2IX1A 4BBSG 1WFQA 5E7NA 1K0RA 4DR2Q 1EOVA 1BKBA 4IPHA 3D0FA 3PGZA 4A3GG 2XTIA 2B63H 4X66L 3GTLH 5HGQA 1S40A 1X65A 2YV5A 1L0WA 5M5YH 2K52A 3S24A 2K50A 1JJ2A 3PUXA 1CSPA 2CFMA 4P72A 4X65Q 4LFAQ 2VQEL 2PMZE 4B3TQ 3KDFA 3HOVG 4L5RC 3HOYH 2B63G 4JI6Q 2JA9A 2PQAA 5IE8A 2YTVA 1XPUA 4DR7Q 1N34L 1L1OA 1Q8KA 2RCNA 2JA6G 3I7FA 4TQUS 1N32Q 4JI7L 1A0IA 4BY7H 2N78A 4LNQA 1PH8A 4GKJL 2I0QA 4WJ3M 1X9NA 3A0JA 4XTCS 5IT9c 5JJKA 4BBRG 5M3FG 1UE6A 5ELOA 2OQKA 3PUWA 4BA1I 2K5NA 4QGUA 4IO9A 5M5WH 4LF9Q 3F8TA 1GD7A 5C4XH 1NMGA 2ZJPA 1Q7YC 5M5XH 2VZAA 4YCWA 1EYGA 3S2DH 4YCVA 4ALPA 3AEVA 4JYAQ 1VQPA 1HZ9A 1Q46A 5M3MG 1XMOL 4X6AH 3J81i 1TXYA 1B70B 1IBLL 4DV1Q 1QVFA 4YCUA 4HIDA 1IYJB 1GM5A 1RL2A 1EIFA 1S3OA 4LF6Q 4LUOA 2NVXH 1PH2A 4AQYQ 3T1YL 3PF5A 3HFZB 1XNQL 3RN2A 1YVCA 1G291 1EFWA 4BY7G 4OWWB 1BBWA 1JB7A 4OO1I 3FP9A 1Y1VH 2JQOA 3G48A 4GLAC 3PIPA 4J15A 4C3HH 2RHSB 4DK3C 5IWAL 4LF5Q 1K73C 2BH2A 1PVOA 4X64L 1LM0A 4DR1Q 4YY3L 1TWFH 3EBEA 4PMWA 2R7ZG 4OO1G 5LMUQ 1VQMA 1GO3E 4DV0Q 4JI3Q 4HJAA 2KCMA 4LFBL 4QQBX 1XJVA 4KHPL 5EAYA 3PO2G 1EUJA 1KAWA 1LUZA 3I4OA 2N49A 4GLXA 4O0AA 1VQBA 2QGQA 1E24A 3I2ZA 4LF5L 2Q2TA 5C44G 2MNAA 1PH3A 1XNRL 3M3YH 4UP8A 1XTDA 4LF6L 2PQAB 1JT8A 1HZCA 3EIVA 1XNQQ 4MTNA 2E2IH 1PH6A 1ASYA 3E9IA 4P74A 4BBSH 4A4IA 4DNIA 1FJGL 4GKKL 2VQFQ 4R4TA 1VQ8A 1IBKL 2E2JH 4A3LG 5IP9H 1AE3A 1VQ5A 1VQDA 3S14H 2OQ0A 5HY6A 2L15A 4A3BG 4DR6Q 1VQIA 3CXCA 3FHWA 3T1HL 4JV5L 5IYDH 2A1AA 3CCEA 3W1BA 3PO2H 3GD7A 4X65L 1VQEA 1SMXA 4DUZQ 4WJ4A 4YHHL 3LGJA 1FL0A 2I5HA 4UP9A 3CCRA 3RNUA 1QUQA 4A3FH 3I56A 4A76A 3J81j 2B3GA 3BZCA 4DR3Q 4L5SA 1HNWL 4BY1G 2R7FA 4DV3Q 1LTLA 4UP7A 4LF8Q 1N9WA 1T9HA 3HKZG 1KHIA 2WB1G 4GN4B 4KLKA 2YTXA 3HOXG 1HNXL 1L1OC 1C7YA 4DUZL 4A3IG 1ASZA 4GKKQ 4OONA 3CAMA 5IP7H 5JEAJ 3CQZH 3OYYA 1N33Q 2F3IA 3ULLA 4DR6L 1K3RA 3U4VA 2JA6H 3KYHC 5C0XG 4LF4L 2KHIA 4KI0A 4RMFA 4EQ5A 2UU9L 4POGA 5C4XG 4HIMA 3RLFA 2B29A 3HKZE 3HOXH 4GNXC 4A3KH 2OTLA 3HKSA 4DR5Q 2ZTDA 2CKZB 4B3SQ 3HOYG 1HJPA 2IY5B 2CWAA 2K5VA 1LYLA 2MQHA 3L0OA 3JAMi 2R92G 4BXXH 4JC0A 1E7ZA 3I55A 3UDIA 2D62A 2WAQG 3CMEA 1YZ6A 3IRBA 2HIVA 3AFQA 4B3ML 1OXXK 4QY7A 4JI3L 4DV0L 4DPGA 4LF7Q 4UY8C 3PUYA 2R93G 2AMCB 5JEAG 4QL5A 5LMNL 4Y52H 2OTJA 2N3SA 3RZDH 4IJLA 3RR5A 2A8VA 1JMCA 2HHHL 5LMUL 1OXSC 1B8AA 1W2BA 1E1TA 1VQAA 1IZ6A 4LFBQ 3OTOL 4NPSA 4GN5A 2QA4A 1EQRA 1X3EA 1N36Q 1UEBA 4R4CA 2LSSA 2A19A 4B3RQ 2GVAA 2YYZA 1HH2P 2NN6I 1HZBA 2KBNA 1IBKQ 1QVGA 3PO3H 2UUCL 2F4VQ 3KF6B 3U58A 3CC4A 2NN6G 1PYBA 5C3EG 4LF7L 1IL2A 2N8NA 2JK8A 1WYDA 1NE3A 2NVQH 1KL9A 1KRSA 2V1CC 3G71A 1K9MC 5FLXc 3ERSX 5AJ3L 5GAGC 1VQNA 2E5LL 3L7ZC 4HJ7A 1VQKA 1XNRQ 3TQYA 1IBMQ 2KENA 2UUCQ 3F2DA 1WJJA 1I6HH 3F2BA 4DV7Q 4DV3L 2JA8G 3S1RH 1NBWA 1Q1EA 3UE1A 3TREA 1R9TH 2JA5H 1OXUA 4UPAA 2PNHA 4BY1H 1D7QA 1NJIC 3FKIG 4DR2L 5JJIA 3KF6A 2EXDA 1BVSA 4IPDA 4YHHQ 4FDBA 4OXPA 5AJ3Q 4GOPC 2D0OA 1I94Q 2JEBI 2ASBA 2ZTCA 3TRZA 1KC8C 1L2FA 4DR4L 3H0GG 3TEHB 2CCZA 1C0AA 1XMQQ 3J80c 4LF8L 1U5KA 1EWIA 2OWOA 2JJQA 2Y0SE 2PI2E 3GO5A 3NBHB 5IYBH 3KOJA 1EQQA 3GTJH 2VUMH 1Y1WH 4JBWA 2YU9H 5IYBG 3W1GA 1U0LA 3M4QA 1HNZL 4A3DG 5DLQE 4R4IA 2AKWB 1A63A 4DKAC 1WI5A 1J6QA 4B3SL 3GTOH 4YWLA 1UE5A 3KF8B 2OCEA 3MXNB 3CCQA 2Z6KA 3GDEA 4X66Q 1OTCA 1VS0A 4OWXB 4JI6L 4A3MH 3GTKH 3KJPA 2KHJA 4Y7NH 3CP0A 1MJEA 4DV5L 2HQLA 4DK6C 2E8GA 4IOCA 3BJUA 4A3IH 4DR5L 3UDXA 3DM3A 3J7A5 5ELNA 1QVCA 3I4NH 3CCUA 1PH7A 3CCLA 3HOWG 5IP9G 2KCTA 4A3CG 4JI0Q 4OX9L 3PIOA 4A3GH 2NZOA 2WFWA 4DR3L 2JA7H 2JEAI 3HOWH 3G6EA 3OTOQ 3HOZG 3BZKA 3K81C 1Z9FA 2AWOA 4XIGS 1NTGA 1YHQA 1XMOQ 2BA0A 1PH1A 3HOZH 2AHOB 5IYDG 2ZJQA 5IWAQ 4NXMQ 1VQHA 1GKHA 4RG1A 2UUBL 3M7NA 4AYBG 1VQCA 2YTYA 4MNOA 1P8LA 3WWVA 3T1YQ 1PHJA 1VQ9A 1N36L 2VNUD 1Q1BA 1L1OB 4R4QA 3CPWA 4AH6A 4LFAL 4HIOA 2K4KA 1IBLQ 3RLNA 4BXXG 3FKIH 4DR1L 1PH5A 2BA1A 4JBKA 4C2MH 1N8RC 5C3EH 1K8AC 1NMFA 2UU9Q 3ZJYC 4ME3A 5FLMH 3M4PA 1RIPA 3H0GH 4TVAB 4JI4Q 4B3TL 4R4OA 2PI2A 3VDYA 3ER0A 2EIFA 3K7UC 2HIXA 3AYHB 4JI1L 1IXRA 2VS1A 2MO0A 4DV6Q 3PUZA 3UDFA 4YWMA 2ZM6L 4X62Q 4HIKA 3HOUG 1VQ7A 2JA5G 1CKMA 4IPGA 5J3BA 3UDGA 2UXDQ 1SN8A 4JI5Q 1TWHH 2Z6KC 1J5EQ 1VQJA 5FJ8H 4LFCQ 3CD6A 3U4ZA 1VQ6A 1O7IA 2JA8H 3RN5A 1VQGA 1YITA 1YJWA 2Q2HA 1HR0W 2R93H 1TWAH 3CC2A 4B3MQ 3U50C 1A62A 3EN2A 4A3FG 4LUVA 3I4MH 3Q8DA 3K0XA 4JOIA 1HNXQ 1HR0L 4L5QA 5GADC 3A5ZB 2VW9A 4R1JA 4LFCL 1UE1A 2UXBQ 1AE2A 1VCIA 2WP8J 3AFPA 5GAEC 4C3JH 2UXCQ 4DUYQ 4NXNQ 4QIWE 1PH9A 3J81c 4LF9L 5LMNW 3RLOA 4X62L 4JG2A 2ZM6Q 5H1SE 4A3EH 3JC66 1MIUA 2F52A 4AQYL 2BH8A 3I4MG 2WB1E 1SROA 1PFSA 3STBD 1UWVA 3D31A 4IPCA 2IHEA 3ULJA 1KRTA 3PF4A 4X64Q 1I3QH 1X6OA 4JI2Q 4A3MG 3KLWA 3I4NG 4QJFA 2GN5A 2CWPA 1IBML 2UXCL 3S15H 4HJ9A 1HNWQ 4DV7L 1SLJA 2E2HH 5FJ8G 4LF4Q 2CQOA 4GN3B 4PZ8A 1SRUA 2DUDA 1XMQL 4LUZA 1YJNA 1PA6A 1CSQA 2AWNA 3J80i 1VQLA 3CCVA 4A3DH 3E9HA 1FJGQ 2Y0SG 4APVA 1K83H 1Q12A 1SR3A 2EQSA 2FXQA 4JOIC 4A93H 1FGUA 4L5TA 3RZOH 1W3SA 4JI0L 4OX9Q 3KDFB 3K7AH 1WCMH 2UUBQ 4NB3A 5IYCH 4GOPB 1QZGA 3GTPH 4A3BH 3BU2A 1A8VA 4KHPQ 2MFIA 1WOCA 5JJLA 5GQOA 4B3RL 2IT1A 1Q86C 1I5FA 3PO3G 1NY4A 5K36G 1KQSA 4A93G
chains in the Genus database with same CATH superfamily
1Y1VB 3LNNA 2OT2A 1GUOA 2I5LX 5IP7G 3CKIB 3TSSA 2HT1A 4F7XA 4HJ5A 1RHPA 1SJHD 1MJCA 5FLMG 2K01A 1X3QA 1TWGH 3VR6A 1VQFA 1CQVA 2ALYB 1R9TB 2LXJA 5IGBA 3D4RA 4DV5Q 3STBC 5FO7B 2R6GA 3MEFA 1ZKOA 1I6HB 3D8GA 3S1QH 4DGZA 2R7ZH 3CCMA 3KLRA 3LX0A 2RHQB 1TWCH 4GNXA 3M7GA 1I4GA 2PW5A 2NVTH 4GZYC 4NXML 1QZHA 4FXDA 1CI3M 2I5MX 1VQ4A 3BDCA 2XVSA 1E1OA 1FVIA 2X6GA 4IUUA 2R7ZB 4A3EG 5GAHC 1YHAA 2NVYB 1JJGA 1B50A 4DUYL 1I4QA 4DV2L 4DAYB 1SE3A 1SE8A 3H91A 4P75A 4KMUC 1AH9A 5IT9L 3Q24A 3A55A 2R7DA 3VYSA 3M9BA 4JI4L 5C44H 1I94L 1A3UA 1RTOA 1VF7A 1YNXA 2HHHQ 3DLLA 2RSOA 3BG3A 2FMMA 1GUWA 3TS0A 3CMAA 1CUKA 1MD2D 2QEXA 4H0LC 1WTOA 4PZ6A 2MUYA 4JI1Q 2A68C 5C0XJ 3VYTA 2MPMA 1X3GA 3G6JB 2JA6B 2Z6BA 3BYTB 4IFDJ 4A3LH 1WTRA 4IFDI 3F1ZA 1LTSD 4FF1A 2NBFA 1YNJC 3WDNA 2K1BA 3JAML 1X56A 1Y8PB 2P5ZX 4CDEC 3S16H 3MWYW 1KIXA 5C4XB 3GTGB 5M5WB 1J5EL 1Z47A 4DV4L 4B9XA 1M4VA 2WAQE 5BR8Q 4KKUA 1PH4A 1V1QA 2IX1A 4HCSA 4HMIA 4BBSG 1WFQA 1CFMA 1K0RA 2Z1CA 1BKBA 1EY4A 1TR5A 3PGZA 5IGGA 2B63H 1AZQA 1BCPF 4A93B 1FNUA 3X3MA 3BYYB 1X65A 2YV5A 3S24A 1CSPA 1IHZA 5JEAH 1R4PB 3Q6SA 4X65Q 4JPBW 2PMZE 5DAUA 3KDFA 4DNTB 4U68A 4JI6Q 2VUMB 2AUKA 5KNDA 4DR7Q 1N34L 3C2PA 4HSPA 3VYRA 4JI7L 1HCZA 3V2TA 5KRUA 1PH8A 5J22A 5IT9c 1SYGA 5M3FG 5JJKA 2DY7A 3F2UA 4C3HG 5ELOA 4BA1I 3KK7A 4QGUA 1PMRA 1LTRD 1NMGA 2KCNA 4OEMB 5M5XH 3S2DH 4J6HA 4YCVA 3AEVA 2D5DA 5EKIA 3VA7A 2WKCA 2F0LA 3MC0B 1Q46A 5KNBA 3D3RA 4ZCKA 3I3CA 3NWTA 2HCCA 3S2DB 1S3OA 3DWQA 1PH2A 1GHJA 1EFWA 1JB7A 1C48A 3G48A 2JQOA 5DEHA 4KN4C 4DK3C 4A3GB 1KABA 1LM0A 1E2VA 3EBEA 1GO3E 1HA5A 3MEHA 4FVMA 4MIUA 2EPBA 2A6HC 5JJZA 1FNVA 5ELCA 4GLXA 3DHQA 1ZEQX 2B8GA 2QGQA 4IQZA 2MNAA 3O13A 4LF6L 2PQAB 1JT8A 2XRSD 4JW0A 2F0FA 1PH6A 3P1HA 3E9IA 2B2WA 5IT9E 1BO0A 1T5XD 1CT1D 1VQ8A 1C8CA 1QNKA 4K6DA 1VQ5A 3S14H 2F0GA 2L15A 3P20A 1VQIA 4FNFA 1WVLA 2CW0C 3PO2H 4K8JA 3K5OA 4WJ4A 2NVTB 1ESFA 3LGJA 3CCRA 1ENCA 2I5HA 4NW2A 1WTPA 1W6JA 1NSNS 4A3FH 3J81j 1HNWL 1S4ZA 2A6HD 4BS9A 1WTXA 4V0BA 4LF8Q 3HOXG 3W3AA 1HNXL 3A7LA 1L1OC 4RFBA 1HUNA 1F77A 1PTOC 3CAMA 5IP7H 4S3SA 3CQZH 1QE6A 2F3IA 4X3UA 3JAME 4MN3A 2JA6H 3KYHC 2PYKA 4RMFA 1FYCA 5NUCA 3RLFA 2B29A 2TSSA 3HOXH 2OTLA 3HKSA 4DR5Q 4G7OC 2CKZB 4ZAIA 2CWAA 2K5VA 5D14A 3GTJB 1EL0A 1J8IA 2H4OA 1JOOA 1MHWC 3CMEA 3KBXA 3IRBA 2HIVA 1OXXK 1TY0A 2B39A 3PUYA 3SK6A 4C2MB 4BBSB 2OTJA 4CJ1B 4BBRB 3Q0AA 1G6ZA 4IJLA 4HSVA 5LMUL 1CQFA 1W2BA 1VQAA 4LFBQ 4XQQA 1EQRA 3TP5A 5I2XA 2A19A 4B3RQ 1A3VA 2K5WA 5IGDA 1QVGA 2EJGC 3U58A 2NN6G 1G8ZD 3MFGA 1KL9A 3G71A 1D6EC 2J7ZA 1Q3LA 3ONAB 3E5SA 4ZK9B 3LWUA 1IBMQ 4MTKA 4ZKCB 4KKTA 3S1QB 1I6HH 5CV5A 3EFXD 5DM73 4DAVA 5JJIA 1E0BA 3KF6A 3J7AV 2ASBA 3GTOB 1L2FA 3H0GG 2JXMB 3MHBA 1SYEA 3J80c 2L11A 4BY7B 2Y0SE 3VYUA 2EYHA 5J39A 4CJ0B 3GTJH 1SNDA 2A68D 2EZVA 4JBWA 3DEPA 5BN5A 1HNZL 5DLQE 4DAPA 4DKAC 4B3SL 4YWLA 1UE5A 3KF8B 2Z6KA 5EQ0A 1NR2A 1EU3A 4TRDA 3GTKH 1MJEA 3CP0A 1EIGA 2HQLA 4DK6C 3HKZB 4IOCA 3D6CA 1JWMD 3DM3A 5ELNA 5EGTA 1L0YB 3I4NH 5IP9G 2KCTA 4A3CG 3S17B 4DR3L 2WFWA 2JA7H 4A3EB 2JEAI 2KEEA 1G91A 2EDGA 1Z9FA 1NTGA 4ZLTF 1PH1A 4R8IA 1TS2A 3I4MB 1GKHA 4RG1A 2UUBL 1TWAB 4MNOA 1P8LA 1PHJA 5LHY1 2R93B 2VNUD 4AH6A 4RH6A 4CHTB 2CVRA 5IGFA 4JBKA 1N8RC 4E6IA 2UU9Q 4ME5A 3M4PA 2RBMA 3H0GH 3AU7A 4TVAB 5CORA 4B3TL 5JPMC 2RQXA 2F0OA 5I6YA 4OO1H 3K7UC 1W6KA 3HOYB 2VS1A 3H94A 3UDFA 2WIIB 2ZM6L 3HOUG 1CKMA 2VB3X 5J3BA 2KEDA 1KLUD 4ODGA 3C3LA 1VQJA 3CD6A 2EYLA 2C9OA 5C6AA 3DM1A 1CZGA 4G57A 2R93H 1HQMC 5C4ZA 5IODA 1SNCA 2QKIC 3C1FA 3I4MH 1SMYC 1V1PA 4CDCC 1ENFA 3K0XA 1HNXQ 3NP8A 5GADC 3A5ZB 2JN4A 3HGBA 3N6RA 1VCIA 3NWSA 4WJWA 3T13A 1NR4A 4LK1C 4DUYQ 2FJ2A 2B2VC 4N8X1 4X62L 4A3EH 4RKBA 2F52A 2BH8A 2QCPX 1PRTF 3QOJA 4FXGC 2O2LD 2PCFB 2Z4IA 3MXPA 1UNSA 1KRTA 4XT1B 1K3BC 4JI2Q 3KLWA 2GN5A 1ESRA 3C46A 1SSOA 4DV7L 2E2HH 5C0XH 1ET9A 2AWNA 2NTSA 1Z7TA 3E9HA 4A93H 2FXQA 4X3TA 2B63B 4LAAA 2WKDA 1PFBA 1W3SA 4JI0L 3KDFB 5ELDA 4NB3A 1B1ZA 1SEBD 1EFID 4LMQD 3BU2A 1A8VA 2RDFA 1A2UA 3H0GB 5GQOA 4B3RL 3I72A 1Q86C 1H9SA 2HQEA 3SGIA 2K5HA 4IOAA 1CA5A 3A74A 3T1HQ 3MVVA 4JYAL 1HTLD 1SNMA 4DAMA 2ID0A 1QG7A 2HCIA 1JOQA 3GTQH 1CKNA 4DV4Q 2GVBA 2IX0A 1E22A 1MSGA 2JP1A 3AQQA 4RHSA 4JCVE 3S1RB 1M90C 3CPFA 1G2TA 3J7AF 4PG3A 1B7YB 1I4RA 3MAQA 1BCPC 2UUAL 1YNND 3S1MH 2B2UC 4K0KQ 3NENA 3I90A 3E6ZX 1CKOA 3J7ZC 3HOVH 1SYBA 2JSOA 4IZ8A 3NSWA 4A3JH 3HOUH 1X54A 3S17H 2PZWA 1OXTA 5LL6X 4RCOA 3G4SA 1HUMA 1AW7A 1Q82C 1OXVA 2LXKA 2D0PA 4EQPA 3NQIA 3VR4A 1BUVT 2AQ1B 4KJOA 4CBVA 1TS5A 2Q2IA 5I6WA 3K58A 1N34Q 4DR4Q 1X55A 5E3FA 1HNZQ 2NUCA 1Q81C 4N9PA 1HR0Q 5M5YB 1NNXA 4GKJQ 1V43A 4BBRH 1SE2A 5FLXE 4IFDG 4HMJA 4DK1A 1D8LA 3H3VI 2F0SA 3K8AA 4HJ8A 1YBYA 3ITPA 2FFKB 2ZT9C 3HOUB 2ENBA 1BF4A 1LTBD 1YNJD 2KHSA 3A5UA 2K75A 3H15A 1MI2A 1LTID 1RD9D 1P16A 2WB1B 1YHBA 4JI8L 1KD1C 2N88A 4O2DA 3CF5A 2JA5B 5C4JH 1H95A 5C4JB 3D4DA 1YIJA 3JAMc 4GNXB 2ZTEA 4YWKA 4NP5A 3CC7A 2RDGA 1TT2A 1UE7A 1N32L 3TS2A 2VXWA 2C35B 4A3KG 2UXBL 1DM0B 2JA7B 3A8KE 1QILA 5E4WC 1G6PA 4ULLA 2XN9C 1CKNB 4A3GG 2E2IB 1K83B 4X66L 3GTKB 4X3KA 1F9RA 2K50A 2Y0SB 4ZRZA 1H9JA 1M8AA 4LFAQ 1EEFD 2ZXPA 5KGUA 1AFPA 1CHPD 1TIID 1D5MC 1I6VC 1F2ZA 1L1OA 2V4DA 3P75A 1A0IA 2N78A 4LNQA 1F9PA 4AYBB 1B9MA 1Z6HA 2KUMA 3A0JA 3M4YA 3TDQA 3FPPA 3PUWA 2K5NA 1QJOA 2KQ3A 4DN4M 2B8FA 2ZJPA 1Q7YC 1EYGA 4YIJA 1VQPA 1HZ9A 1STGA 5M3MG 1TXYA 1B70B 4K2LA 1U4MA 2N55A 3W2DA 4YCUA 2B2TC 4BWGB 2NVXH 3HFZB 1XNQL 3RN2A 4C3IG 3HS0C 1BBWA 3FP9A 4J15A 2BH2A 2NWGA 4X64L 4DR1Q 4PNYA 5LMUQ 4JI3Q 3G7LA 2KCMA 2LKVA 1WCMB 3CU7A 1EUJA 1F9SA 1KAWA 2G9DA 4PMCA 2N49A 4OIJA 3AB9A 1VQBA 1A2TA 1PH3A 1BNZA 2KCCA 1XTDA 1LT4D 2M9VA 3BS1A 1B2TA 3EIVA 3BVGA 1JE4A 1ASYA 1TS3A 4BBSH 1JR0D 4A4IA 1FJGL 2HDLA 2L1BA 4R4TA 4A3LG 3NE5B 1VQDA 4JV5L 4A3BG 1K0SA 3ND8A 3GD7A 1F2MA 1SMXA 3CHBD 3RNUA 4UP9A 1I4PA 4FF2A 3I56A 4X3SA 2B3GA 3GV3A 4BY1G 4DV3Q 1JORA 4UP7A 1N9WA 2B2UA 4J1MA 2AQ2B 4A3IG 4QIWB 1ASZA 4GKKQ 2JA8B 2LMCB 2OXPA 3OYYA 1N33Q 3DWAA 1ICFB 3ULLA 1ZYRC 3U4VA 2DNCA 5C4XG 4HIMA 1Q90A 3HKZE 4GNXC 3HOYG 4B3SQ 1STAA 1LYLA 3L0OA 1RODA 4BXXH 5C4HA 1E7ZA 3I55A 3TMEA 3QWNA 2A5HA 3TP7A 1IKMA 1YZ6A 3AFQA 4J8QA 4UY8C 4LF7Q 4KD4A 3QJYA 2Q8IB 4Q0FA 2KA7A 4QL5A 2K04A 2N3SA 3RZDH 2E74C 1XYIA 1OXSC 1E1TA 3OTOL 2B2WC 3OWEB 4GN5A 2QA4A 1UEBA 2LSSA 1U4RA 2R92B 3BZDB 1HZBA 2UUCL 2F4VQ 2HUGA 4L8JA 1V8QA 2XSCA 1IL2A 2N8NA 2SNSA 1EY0A 2K05A 3BVMA 2BDOA 1TY2A 3KLSA 2SEBD 1K9MC 1D2BA 4U673 5FLXc 3ERSX 2SNMA 5AJ3L 2B2YA 2E5LL 3I4NB 1XNRQ 3TQYA 4DU9A 4MHEA 2Z9HA 2UUCQ 1WJJA 3F2BA 1NBWA 2F0IA 3UE1A 1R9TH 2CH4A 3FKIG 2EXDA 4IPDA 5AJ3Q 2K7VA 1QNUA 1EWHA 4GOPC 3PMFA 1I94Q 2JEBI 3TEHB 1BCPB 2CCZA 1U9RA 4PV1C 4EVOA 4QUCA 5C5LA 1DOMA 1PZID 4C3IB 3V96A 2IPKD 3FMCA 5IYBH 3OW7A 4N9TA 5JPNC 1D1KA 4IUPA 2E2JB 1B9NA 5K5PA 2VUMH 1Y1WH 2L0CA 2DY8A 2L9HA 3M4QA 3NHHA 4R4IA 2AKWB 4KY5A 1S5CD 1WI5A 4ZQ3A 3T56B 2QW7A 3MXNB 3TP6A 3GDEA 2RSNA 3M3YB 1OTCA 1VS0A 2KHJA 4DV5L 1ICWA 1RTNA 2E8GA 1SMYD 1JWUD 3H09A 3R2TA 4B08A 1EOTA 3OMGA 2BDNA 1PYWD 3ERQA 3GV6A 5BN4A 3CCUA 4A3FB 1EWCA 3QB3A 1PH7A 2O4XA 4JI0Q 3HOWH 3BZKA 4QB4A 3LWEA 2NTTA 1QCBD 1YHQA 5IYDG 4NXMQ 3FRPB 4ILWA 1VQHA 4KKSA 4A3IB 5FKAC 4KD3A 1PLFA 1PZJD 3T1YQ 4Y7NB 3IAYA 1Q1BA 4R4QA 3CPWA 5D65A 2F0WA 5FO8B 4HIOA 5K36H 1PTOH 2K4KA 1IBLQ 1EQVA 3RLNA 1BBXC 1PH5A 2BA1A 1NUCA 2E2DC 1PFMA 2F03A 4KK7A 4L6TB 1NMFA 2RCFA 3ZJYC 4WRDA 3KBGA 3K59A 4V190 4JI4Q 2PI2A 1I4HA 1SNOA 2XNAC 3VDYA 1SYFA 3AYHB 1IXRA 4JI1L 5I2YA 4HIKA 4X62Q 5C3EB 2JA5G 3I4LA 1UUPA 3UDGA 1PTOB 1SN8A 1TWHH 2Z6KC 3DEOA 2RDHA 4RGMA 2JA8H 1B53A 2ZXOA 2MHVA 5C5MA 1HR0W 3CC2A 4LUVA 3HOZB 1HR0L 4KJNA 3V05A 2F0KA 1AE2A 3AFPA 5CMDA 5GAEC 4C3JH 5FO9B 3J81c 4LF9L 5C3WA 1GOZA 3RLOA 4JG2A 1KDCA 1MIUA 2DN8A 3I4MG 1PFSA 4IPCA 2IHEA 5JVG3 3PF4A 4QJFA 1IBML 3S15H 2K5DA 4LF4Q 2CQOA 2B2VA 1XMQL 1YJNA 3GTQB 1DD2A 3OWFA 1EZ6A 3Q22A 2Y0SG 4APVA 1SR3A 3GTLB 4JOIC 1MGSA 4L5TA 2FMCA 5E4XA 1GUTA 3HEJA 1WCMH 1B44D 4GOPB 2A6ED 1WTVA 3GTPH 4A3BH 1LT5D 4KHPQ 2MFIA 2F0PA 5JJLA 2IT1A 3WOEA 1I5FA 5K36G 1KQSA 5ELFA 3A7AB 4AIMA 3D6WA 1DJRD 1Y14B 4JI7Q 2WAQB 4OWTB 1TU2B 1I4XA 1SNPA 5C0XI 2LS01 1PV4A 1HPCA 3S1NH 3GTMH 1A6XA 4K2KA 1FNWA 1KXLA 1GVPA 4C1NK 1YI2A 2IHFA 4A3CH 1GUGA 3PO3G 2WACA 3I91A 2VY3A 3CW2C 3K80C 3QIAA 3IKJA 3KJOA 2PW7A 1PTOD 3H3VH 2XIWA 4H02A 4ZUJA 2Q2UA 2LFNA 2L55A 4PZ7A 5C44B 4JI2L 2ATWA 4AYBE 1RCVD 1E3PA 4GLVB 5E1FA 1VMCA 3TZDA 1Y1WG 1VQOA 4UHVA 2VQEQ 2F0QA 2NVYH 4A3JG 1MBYA 2ES2A 1Y1VG 5COYA 2M2LA 3PQIA 1JOKA 3PV0A 1YJ9A 4UDUC 4CGYB 3PCOB 3F2CA 4JI5L 4JBJA 1PRTB 5LMNQ 5ELBA 4A3BB 1FD7D 3PUVA 1YEZA 2VL6A 4DV1L 5EJWA 2VUMG 5IOCA 1PZKD 4DNRB 4IUTA 4EX5A 5BR8L 1NAPA 1X3FA 2F4VL 3HG9A 2J0TD 1LT6D 3GTGH 1CK1A 1ML0D 1PYSB 1KAAA 4JK1C 2UXDL 4IN3A 3S16B 2Z0SA 4BY1B 3L3OC 2EY1A 1DGSA 5EPJA 4POFA 4FF4A 5GROA 4IFDH 1RDPD 2D9UA 3MZ5A 4BA2I 1TWGB 4KN7C 4NDXA 3MA2B 5ISRA 2F0NA 4IALA 4MZ9A 3A56A 3CCSA 4K0KL 5IY0A 1V9PA 1IKLA 5A2QE 4FO2A 2F0UA 3VR5A 4IUVA 1CZWA 4G4KA 3U9OA 1SNQA 3D0FA 2QDLA 2XTIA 1JICA 1PRTD 2MP1A 5HGQA 1D5XC 1S40A 2EY5A 4OHJA 5M5YH 3J80E 3EQLC 1JJ2A 4XT3B 2K03A 2CFMA 5CV6A 1LLRD 4QUFA 1I3QB 1O80A 5ELEA 3HOYH 2B63G 2PQAA 5IE8A 4K8IA 1XPUA 1C4QA 2RCNA 4TQUS 4BY7H 4GKJL 3TP8A 3K57A 5CV9A 4BBRG 5CBAE 1UE6A 1LTGD 2OQKA 3S1MB 2K32A 1SYDA 1O7LA 1CHQD 4IO9A 2HD3A 4LF9Q 1T5EA 3F8TA 4YCWA 1TQOA 1B3AA 4XDXA 4K6LA 2VB2X 1KNEA 1QVFA 3DXJC 5FLXL 1IYJB 5AFWA 2AUJD 4LF6Q 1G291 4CJ2C 4OWWB 4OO1I 1FGBD 3GP7A 4GLAC 2RHSB 4LF5Q 4FXKC 2H1EA 3T4AC 1K73C 1AZPA 4B9WA 4XQJA 4YY3L 3SEBA 2I07B 3PO3B 3KF8A 2K6AA 1VQMA 4DV0Q 3H3VC 4HJAA 1QWYA 4QQBX 4KHPL 3R2IA 5EAYA 3I4OA 4RA8A 1ONLA 2RA4A 3I2ZA 4LF5L 2Q2TA 3DWPA 5C44G 1XNRL 3M3YH 4UP8A 3SVMA 4KV6A 1SDFA 4MTNA 2E2IH 5BN3A 4P74A 4F8MA 2VQFQ 4CKCA 3U9SA 1IBKL 2E2JH 5IP9H 3SHLA 5HY6A 5IYDH 2K28A 3EROA 5EBCA 4ZUIA 3W1BA 1VQEA 1FL0A 2RKSA 5EKKA 3A54A 1QUQA 4A76A 3BZCA 4DR3Q 3K5NA 4L5SA 1H9RA 2R7FA 1LTLA 5CGKA 3A8JE 3HKZG 2WB1G 5KNCA 4KLKA 3M4OB 2QILA 2OF1A 4XQNA 3C1EA 2WV6D 4DR6L 1SXTA 3OPOA 4ZYSA 4WFN3 2PZUA 4LF4L 2KHIA 4KI0A 2UU9L 5CV7A 4K14A 3ZYYX 4A3KH 3QG1A 1BQQT 1HJPA 5HGTA 4O1NA 3JAMi 2R92G 5IGEA 2KECA 3VA5A 2SOBA 3UDIA 1HTPA 1SE4A 5F2DA 4QY7A 4JI3L 3GTPB 4DPGA 2R93G 2AMCB 2MGSA 5JEAG 1HRJA 5LMNL 2XWBB 3SK5A 3OIPA 1ILQA 5M3FB 5D3DA 4DF7A 3NTKA 2A8VA 3TZUA 2HHHL 3J7YW 2E2HB 1IZ6A 2A73B 4R4CA 1O7YA 4OGQC 2GVAA 1EY5A 2KBNA 5KYIA 3HOVB 2JK8A 1NE3A 2NVQH 1KRSA 4OIKA 1IYUA 1EU4A 1OO9B 2F3WA 5GAGC 3AMUA 4JVZA 2KENA 3GTMB 3BDOA 4DV7Q 2JA8G 4DV3L 3S1RH 2XWJB 3GQBA 1TKWB 1OXUA 2EY6A 2PNHA 5FK9C 1D7QA 1LT3D 4YHHQ 4XYQA 5L37A 2IW3A 4EQNA 2D0OA 2EYOA 1H9MA 4DR4L 1C0AA 1DXMA 1EY8A 1EWIA 2OWOA 2JJQA 1KNAA 2PI2E 4G7ZC 3QR8A 1EQQA 3KOJA 2J4XA 4M8AA 2BCOA 2YU9H 1DOLA 3J81L 1U0LA 1CA6A 4A3DG 1EYDA 1F9QA 1SAPA 1A63A 4KHVA 1H9SB 1J6QA 3X3NA 1D5ZC 1VF5C 3GTOH 1B4OA 3CCQA 3HP3A 2EYPA 4JI6L 4A3MH 3KJPA 4Y7NH 4WORA 4C1NI 1HA6A 1S5DD 2M00A 2EYFA 4A3IH 1XWEA 2Q8RE 2A74C 3BJUA 1DONA 1MSHA 3UDXA 4F87A 4QCLA 2A69C 3HOWG 1V1PB 3P7JA 3PIO3 3PIOA 1A15A 3OTOQ 3HOZG 3K81C 3IL8A 4IUNA 2EE1A 5CYUA 1QOHA 1XMOQ 2BA0A 3HOZH 2ZJQA 5KYLA 1GHKA 4G7HC 2ICIA 1R4QB 3NUCA 3S1NB 3R93A 1V1OA 4AYBG 1VQCA 1STEA 2YTYA 2EXZA 3WWVA 2CHBD 1WD1A 1N36L 1L1OB 4LFAL 4F88A 5M5XB 4HEDA 4BXXG 1UAPA 3FKIH 1SYCA 5LL6S 2F4IA 2PMZB 1SJED 4C2MH 1BDOA 2Z4HA 1RIPA 3NBIA 2HIXA 4JBMA 2EYMA 4L63B 2MO0A 4YWMA 5M3MB 1VQ7A 4I7AA 4IPGA 3NK9A 2CW0D 2BE5C 3U4ZA 1VQ6A 3RN5A 1ET6A 2KOLA 3K6OA 5A35A 1YITA 1YJWA 2Q2HA 3U50C 1A62A 2EYJA 2Q8TA 1E2ZA 4A3FG 1JCKB 3Q8DA 2X69A 5CV8A 4L5QA 2VW9A 3I73A 1UE1A 2UXBQ 2KJXA 2BOSA 1J9OA 4FYDA 3WOFA 1KDAA 5LMNW 2ZM6Q 3OOCA 4C3JB 5H1SE 1BXTA 1LO5D 1U4PA 3FEWX 3D31A 2E76C 3ULJA 1U4LA 4EGVA 5M9OA 4K5WA 4X64Q 3I4NG 4A3MG 2PNRC 1Q8IA 1KLGD 1HFNA 4HJ9A 1HNWQ 1JB3A 2JYOA 1SLJA 5FJ8G 4GN3B 4PZ8A 1SRUA 2C5CA 2DUDA 4LUZA 5KIXA 1VQLA 3J80i 4I7ZC 4A3DH 1FJGQ 1WTQA 2SDFA 4XXEA 4TSSA 4OELB 1KDBA 1FGUA 3RZOH 2QDBA 4OX9Q 1YNNC 5IYCH 2IWHA 2YU9B 2PO4A 1NY4A 4C3HB 2O5JC 5EPLA 4A93G 4K5VA 3RZOB 1S5BD 1H9KA 2ZXRA 5IYCG 3S2HH 1BBUA 4A3DB 3E3XA 5HURA 2X6LA 5EKLA 1A3TA 4LW1A 1DZ1A 4LWCA 4DV6L 3NELA 1GXDC 1I50H 4P71A 1CM9A 4RGNA 2Z8LA 3NEMA 1EY6A 1K8GA 4C56C 1EIYB 3UE0A 1XPOA 3HOWB 4A3JB 1N33L 2H5XA 3PO2B 2I46A 1G51A 4NKLA 3E0EA 5JOBA 4JI8Q 3TN2A 2R92H 2NZHA 4HAEA 3SK8A 2G9HD 2JA7G 3PSIA 2JE6I 1DOKA 4NXNL 2BE5D 3ULPA 1O78A 1GUSA 4H7BA 3RUZA 2XGTA 4DR7L 2ZJRA 3RD4A 1AEXA 4O42A 2B2TA 1VDZA 2DGYA 4GOPA 3RZDB 1S72A 3NPPA 5M3FH 1RKNA 1ZYRD 3NXWA 4CKBA 1MKHA 3Q23A 3DUZA 3EJIA 5M3MH 4HCEA 1CTMA 4KHZA 3KFUA 2NYZD 4JV5Q 4HR7B 3W5OA 3UI2A 2RF4A 2UUAQ 1TS4A 1WCMG 3OW2A 4C3IH 4K5XA 5I9OA 4ZKBB 1BOSA 1HZAA 1XX8A 3K7AB 4P73A 1ILPA 4DXFA 2E5LQ 3M85A 4DV2Q 3FKIB 3ICEA 4DFAA 1E2WA 4GS3A 3CQZB 4PQXA 1STBA 1I50B 3B6YA 1QUQB 3K5LA 1M1KC 1LTTD 3I70A 4I65A 1XPRA 4IURA 3FPUB 3M4OH 1C9OA 2MO1A 4YY3Q 1SFOH 1IW7D 4EQOA 4A75A 4M1UB 3L2PA 3S2HB 4IJHA 1JJCB 2F0VA 2VQFL 1O7ZA 4OL7A 4C3JG 1STHA 1JE5A 4KY7A 1PRTC 5IGCA 3S14B 2K14A 2K5QA 5CV4A 3CCJA 5E7NA 4DR2Q 1EOVA 4IPHA 1DCZA 2F1MA 3GTLH 4ID6A 2MJ8A 4A3MB 3HZXA 5EPKA 3T53B 3OSOA 1L0WA 2K52A 3H6MA 1IYVA 3PUXA 4KTAA 2F0DA 4RGOS 4P72A 1BCPD 3QOLA 2NZ1D 4KY6A 3SR1A 1JQYD 3CRLC 2E75C 3SDZA 2VQEL 4B3TQ 2A69D 3HOVG 2NB0A 1S5ED 5C3XA 4L5RC 2JA9A 2YTVA 3SE0A 5DNFA 1EY7A 1Q8KA 3MFYA 2JA6G 3I7FA 1N32Q 2FHTA 4WJ3M 2I0QA 1X9NA 3HRZC 4XTCS 1VMPA 1XXGA 3NTIA 1TWCB 2F0JA 5M5WH 1GD7A 5C4XH 2NVXB 1L0XB 4JYAQ 2VZAA 4ALPA 1HQRD 4N8FA 3D4WA 1K8OA 1XMOL 4X6AH 3J81i 1IBLL 4DV1Q 2F0HA 5JVH3 4HIDA 1GM5A 1RL2A 1EIFA 4DK0A 3EA6A 1TWHB 4LUOA 1HXYD 4AQYQ 4H13C 4RKLA 3T1YL 3PF5A 1YVCA 4BY7G 1Y1VH 3PIP3 3PIPA 4C3HH 5IWAL 1PVOA 2RVLA 1TWFH 3MXNA 4PMWA 2R7ZG 4OO1G 2B2YC 1HFGA 4LFBL 1XJVA 5J1ZA 3PO2G 1LUZA 4O0AA 1E24A 1JWSD 2PZTA 5T1IA 5G3LF 5CBEE 5I9PA 1HHVA 1HZCA 1XNQQ 1SBBB 4HN7A 4DNIA 4GKKL 3BVZA 4FF3A 1EYCA 4CDDC 5CR3A 5TSSA 2AQ3B 1AE3A 2F3VA 5EBDA 2OQ0A 4DR6Q 4H44C 5A2QL 3CXCA 3FHWA 3T1HL 2A1AA 3CCEA 3CRKC 4X65L 4DUZQ 4YHHL 5T1GA 1PXUA 3FVQA 2L5TA 1LACA 1AP0A 1T9HA 3J80L 1KHIA 4GN4B 2YTXA 4LJZC 1TVXA 3S9WA 1UEAB 2F0MA 1C7YA 4DUZL 1WD0A 1BR9A 4OONA 5JAVA 5FOBB 3EVQA 5JEAJ 3N52A 2QF7A 3BDLA 2QEJC 4RWSC 1K3RA 5C0XG 4POGA 1STYA 4EQ5A 2IY5B 1F2YA 2ZTDA 2EVBA 2MQHA 4JC0A 2TMPA 5I4DA 2D62A 2WAQG 4B3ML 4DV0L 1WTHA 4R9WA 2DNEA 4RHRA 2DJGC 4P2CB 1Y8OB 1LTAD 4Y52H 2O5IC 4CDFC 3OHXC 3RR5A 1JMCA 1B8AA 2GA4B 2G5DA 4NPSA 1X3EA 1N36Q 3NTHA 2EOTA 4TKOB 5DM63 2YYZA 1HH2P 2A6EC 2NN6I 1IBKQ 3PO3H 1KTKA 3R8BA 3KF6B 3CC4A 3KLSX 1PYBA 5C3EG 4LF7L 3HOXB 1WYDA 2V1CC 3E0JA 1EEID 3T16A 2CQAA 2NN6H 3K0YA 4RGTA 1VQNA 1VQKA 3L7ZC 4HJ7A 1PFNA 1GJXA 4UAIA 3KUPA 3F2DA 1Q1EA 3T51B 3TREA 2F0TA 2JA5H 4UPAA 4BY1H 1NJIC 4DR2L 1BVSA 4FDBA 4OXPA 2ZTCA 3QO2A 2HDMA 1KC8C 3TRZA 5D3IB 2L12A 3NQTA 1XMQQ 4LF8L 1U5KA 1K8MA 3ND9A 3GO5A 3NBHB 1X3PA 5G3LD 4Q5VA 5IYBG 1B3QA 3W1GA 4A3KB 2DJFC 1EQTA 2EY2A 2OCEA 2XRQD 4X66Q 3K5MA 4OWXB 4DA2A 1EZ8A 1AN8A 2IL8A 3S15B 2WINB 4RAUC 3OIQA 4DR5L 1GUNA 3J7A5 1EY9A 1QVCA 3MXUA 1LV9A 1JC7A 3VR2A 3CCLA 3IFTA 2F0EA 1TWFB 3SK4A 4DXGA 4IUQA 4QMGA 4OX9L 4A3GH 2NZOA 2NVQB 3G6EA 1STNA 2AWOA 4XIGS 1IW7C 1Y8NB 4RCNA 2AHOB 5IWAQ 1SFOB 1RF2D 3SXHA 4ABNA 3M7NA 5IIFA 2EJMA 2R3ZA 1VQ9A 3TBIB 1F2LA 1PTOF 1WTWA 1LABA 3RMHA 1X32A 3URYA 4R8NA 4XYOA 1NCVA 4DR1L 1XTCD 3OMCA 5C3EH 1FR3A 1K8AC 2ICEC 4ME3A 5FLMH 4FP5D 4Z9CB 4NMZA 4R4OA 3ER0A 2EIFA 4DV6Q 2FINB 3PUZA 2D2CC 2L4NA 2UXDQ 4JI5Q 1J5EQ 3DMUA 5FJ8H 4LFCQ 4HTHA 1O7IA 3FDTA 2OEOA 1ZXTA 3L9AX 1VQGA 5CC4A 1TWAH 1Y69U 4B3MQ 1D1IA 3EN2A 1EIHA 1IL8A 4JOIA 2KVMA 2R61A 4R1JA 4LFCL 2PPBC 4PMBA 2WP8J 4CKEA 2UXCQ 2LY7A 4NXNQ 4QIWE 1PH9A 1G2SA 3JC66 4AQYL 3J81E 2WB1E 1SROA 3STBD 3R3OA 1UWVA 2K33A 1I3QH 3MXGA 1PDQA 1X6OA 2UXCL 2CWPA 1DYQA 2CH4W 1II3A 1PA6A 1CSQA 3NBHA 1ENAA 3CCVA 3IFDA 1K83H 1Q12A 2EQSA 1QB5D 2PQEA 3VR3A 1K28A 1EYAA 3K7AH 2UUBQ 1QZGA 5KEEA 1Y1WB 3I8ZA 3A8IE 1WOCA 1S5FD 2IX3A 4DAYA 4QF4A 2EJFC 1RJTA 3MTSA 2IJ0A
chains in the Genus database with same CATH topology
3SGIA 2K5HA 4IOAA 4AIMA 2I5LX 3A74A 5IP7G 3T1HQ 2HT1A 1Y14B 5IYCG 1BBUA 4HJ5A 4JI7Q 3S2HH 4JYAL 4DAMA 2ID0A 1MJCA 5FLMG 1CKNA 3GTQH 4DV4Q 4OWTB 2GVBA 2IX0A 1TWGH 1E22A 1VQFA 2ALYB 3AQQA 5C0XI 4LW1A 4JCVE 1M90C 3CPFA 4LWCA 1PV4A 2LXJA 3S1NH 4DV6L 4DV5Q 3STBC 3GTMH 2R6GA 3MEFA 3NELA 4PG3A 1KXLA 1B7YB 1I50H 4P71A 3S1QH 3NEMA 2R7ZH 3CCMA 2UUAL 1K8GA 2RHQB 1TWCH 3S1MH 4K0KQ 1GVPA 4GNXA 1EIYB 3NENA 3UE0A 2IHFA 1YI2A 1XPOA 4A3CH 1CKOA 3J7ZC 1N33L 4NXML 1QZHA 2NVTH 2H5XA 4A3JH 3HOUH 2VY3A 3HOVH 1X54A 3CW2C 3K80C 3S17H 1OXTA 2I5MX 1VQ4A 3G4SA 3KJOA 1E1OA 1FVIA 1Q82C 3H3VH 1OXVA 2LXKA 2D0PA 4H02A 1G51A 2Q2UA 3E0EA 4JI8Q 4A3EG 5GAHC 4PZ7A 2R92H 2NZHA 1YHAA 2JA7G 2Q2IA 1JJGA 3PSIA 4JI2L 2JE6I 2ATWA 4NXNL 4DUYL 3ULPA 4AYBE 4DV2L 4DAYB 1E3PA 4GLVB 1N34Q 4DR4Q 2XGTA 1SE8A 4DR7L 2ZJRA 1X55A 1HNZQ 4P75A 1Q81C 1AH9A 1Y1WG 1VQOA 1HR0Q 2DGYA 4GOPA 1S72A 2R7DA 4GKJQ 2VQEQ 1V43A 3M9BA 4BBRH 5M3FH 4JI4L 1MKHA 2NVYH 5C44H 5M3MH 4A3JG 1I94L 2ES2A 4IFDG 3KFUA 4KHZA 1Y1VG 1YNXA 2HHHQ 3DLLA 1D8LA 3H3VI 3PV0A 4JV5Q 1YJ9A 3K8AA 3PCOB 3W5OA 3F2CA 4HJ8A 2RF4A 2UUAQ 1YBYA 1WCMG 4JBJA 4JI5L 5LMNQ 4C3IH 3OW2A 3TS0A 3CMAA 1CUKA 1HZAA 3PUVA 2QEXA 1YEZA 2VL6A 4P73A 4PZ6A 2E5LQ 4DV1L 3M85A 2VUMG 4JI1Q 5C0XJ 4DV2Q 3A5UA 2K75A 4EX5A 3ICEA 3H15A 5BR8L 1X3GA 1X3FA 2F4VL 4GS3A 3GTGH 1P16A 1PYSB 1YHBA 3B6YA 1QUQB 2UXDL 2Z0SA 4IFDJ 4JI8L 1M1KC 4A3LH 1KD1C 4IFDI 3F1ZA 1XPRA 4O2DA 1DGSA 3CF5A 4POFA 5GROA 5C4JH 1H95A 3M4OH 1C9OA 2MO1A 1X56A 4YY3Q 1YIJA 4BA2I 3JAMc 1SFOH 4GNXB 4JBMA 2ZTEA 4YWKA 4A75A 3S16H 3L2PA 3CC7A 1KIXA 1UE7A 1N32L 1J5EL 3TS2A 1Z47A 2C35B 1JJCB 4IJHA 4DV4L 4A3KG 4MZ9A 2UXBL 2VQFL 3CCSA 4K0KL 5IY0A 1V9PA 1JE5A 1G6PA 2K14A 2WAQE 5BR8Q 1PH4A 1CKNB 1V1QA 3CCJA 2IX1A 4BBSG 1WFQA 5E7NA 1K0RA 4DR2Q 1EOVA 1BKBA 4IPHA 3D0FA 3PGZA 4A3GG 2XTIA 2B63H 4X66L 3GTLH 5HGQA 1S40A 1X65A 2YV5A 1L0WA 5M5YH 2K52A 3S24A 2K50A 1JJ2A 3PUXA 1CSPA 2CFMA 4P72A 4X65Q 4LFAQ 2VQEL 2PMZE 4B3TQ 3KDFA 3HOVG 4L5RC 3HOYH 2B63G 4JI6Q 2JA9A 2PQAA 5IE8A 2YTVA 1XPUA 4DR7Q 1N34L 1L1OA 1Q8KA 2RCNA 2JA6G 3I7FA 4TQUS 1N32Q 4JI7L 1A0IA 4BY7H 2N78A 4LNQA 1PH8A 4GKJL 2I0QA 4WJ3M 1X9NA 3A0JA 4XTCS 5IT9c 5JJKA 4BBRG 5M3FG 1UE6A 5ELOA 2OQKA 3PUWA 4BA1I 2K5NA 4QGUA 4IO9A 5M5WH 4LF9Q 3F8TA 1GD7A 5C4XH 1NMGA 2ZJPA 1Q7YC 5M5XH 2VZAA 4YCWA 1EYGA 3S2DH 4YCVA 4ALPA 3AEVA 4JYAQ 1VQPA 1HZ9A 1Q46A 5M3MG 1XMOL 4X6AH 3J81i 1TXYA 1B70B 1IBLL 4DV1Q 1QVFA 4YCUA 4HIDA 1IYJB 1GM5A 1RL2A 1EIFA 1S3OA 4LF6Q 4LUOA 2NVXH 1PH2A 4AQYQ 3T1YL 3PF5A 3HFZB 1XNQL 3RN2A 1YVCA 1G291 1EFWA 4BY7G 4OWWB 1BBWA 1JB7A 4OO1I 3FP9A 1Y1VH 2JQOA 3G48A 4GLAC 3PIPA 4J15A 4C3HH 2RHSB 4DK3C 5IWAL 4LF5Q 1K73C 2BH2A 1PVOA 4X64L 1LM0A 4DR1Q 4YY3L 1TWFH 3EBEA 4PMWA 2R7ZG 4OO1G 5LMUQ 1VQMA 1GO3E 4DV0Q 4JI3Q 4HJAA 2KCMA 4LFBL 4QQBX 1XJVA 4KHPL 5EAYA 3PO2G 1EUJA 1KAWA 1LUZA 3I4OA 2N49A 4GLXA 4O0AA 1VQBA 2QGQA 1E24A 3I2ZA 4LF5L 2Q2TA 5C44G 2MNAA 1PH3A 1XNRL 3M3YH 4UP8A 1XTDA 4LF6L 2PQAB 1JT8A 1HZCA 3EIVA 1XNQQ 4MTNA 2E2IH 1PH6A 1ASYA 3E9IA 4P74A 4BBSH 4A4IA 4DNIA 1FJGL 4GKKL 2VQFQ 4R4TA 1VQ8A 1IBKL 2E2JH 4A3LG 5IP9H 1AE3A 1VQ5A 1VQDA 3S14H 2OQ0A 5HY6A 2L15A 4A3BG 4DR6Q 1VQIA 3CXCA 3FHWA 3T1HL 4JV5L 5IYDH 2A1AA 3CCEA 3W1BA 3PO2H 3GD7A 4X65L 1VQEA 1SMXA 4DUZQ 4WJ4A 4YHHL 3LGJA 1FL0A 2I5HA 4UP9A 3CCRA 3RNUA 1QUQA 4A3FH 3I56A 4A76A 3J81j 2B3GA 3BZCA 4DR3Q 4L5SA 1HNWL 4BY1G 2R7FA 4DV3Q 1LTLA 4UP7A 4LF8Q 1N9WA 1T9HA 3HKZG 1KHIA 2WB1G 4GN4B 4KLKA 2YTXA 3HOXG 1HNXL 1L1OC 1C7YA 4DUZL 4A3IG 1ASZA 4GKKQ 4OONA 3CAMA 5IP7H 5JEAJ 3CQZH 3OYYA 1N33Q 2F3IA 3ULLA 4DR6L 1K3RA 3U4VA 2JA6H 3KYHC 5C0XG 4LF4L 2KHIA 4KI0A 4RMFA 4EQ5A 2UU9L 4POGA 5C4XG 4HIMA 3RLFA 2B29A 3HKZE 3HOXH 4GNXC 4A3KH 2OTLA 3HKSA 4DR5Q 2ZTDA 2CKZB 4B3SQ 3HOYG 1HJPA 2IY5B 2CWAA 2K5VA 1LYLA 2MQHA 3L0OA 3JAMi 2R92G 4BXXH 4JC0A 1E7ZA 3I55A 3UDIA 2D62A 2WAQG 3CMEA 1YZ6A 3IRBA 2HIVA 3AFQA 4B3ML 1OXXK 4QY7A 4JI3L 4DV0L 4DPGA 4LF7Q 4UY8C 3PUYA 2R93G 2AMCB 5JEAG 4QL5A 5LMNL 4Y52H 2OTJA 2N3SA 3RZDH 4IJLA 3RR5A 2A8VA 1JMCA 2HHHL 5LMUL 1OXSC 1B8AA 1W2BA 1E1TA 1VQAA 1IZ6A 4LFBQ 3OTOL 4NPSA 4GN5A 2QA4A 1EQRA 1X3EA 1N36Q 1UEBA 4R4CA 2LSSA 2A19A 4B3RQ 2GVAA 2YYZA 1HH2P 2NN6I 1HZBA 2KBNA 1IBKQ 1QVGA 3PO3H 2UUCL 2F4VQ 3KF6B 3U58A 3CC4A 2NN6G 1PYBA 5C3EG 4LF7L 1IL2A 2N8NA 2JK8A 1WYDA 1NE3A 2NVQH 1KL9A 1KRSA 2V1CC 3G71A 1K9MC 5FLXc 3ERSX 5AJ3L 5GAGC 1VQNA 2E5LL 3L7ZC 4HJ7A 1VQKA 1XNRQ 3TQYA 1IBMQ 2KENA 2UUCQ 3F2DA 1WJJA 1I6HH 3F2BA 4DV7Q 4DV3L 2JA8G 3S1RH 1NBWA 1Q1EA 3UE1A 3TREA 1R9TH 2JA5H 1OXUA 4UPAA 2PNHA 4BY1H 1D7QA 1NJIC 3FKIG 4DR2L 5JJIA 3KF6A 2EXDA 1BVSA 4IPDA 4YHHQ 4FDBA 4OXPA 5AJ3Q 4GOPC 2D0OA 1I94Q 2JEBI 2ASBA 2ZTCA 3TRZA 1KC8C 1L2FA 4DR4L 3H0GG 3TEHB 2CCZA 1C0AA 1XMQQ 3J80c 4LF8L 1U5KA 1EWIA 2OWOA 2JJQA 2Y0SE 2PI2E 3GO5A 3NBHB 5IYBH 3KOJA 1EQQA 3GTJH 2VUMH 1Y1WH 4JBWA 2YU9H 5IYBG 3W1GA 1U0LA 3M4QA 1HNZL 4A3DG 5DLQE 4R4IA 2AKWB 1A63A 4DKAC 1WI5A 1J6QA 4B3SL 3GTOH 4YWLA 1UE5A 3KF8B 2OCEA 3MXNB 3CCQA 2Z6KA 3GDEA 4X66Q 1OTCA 1VS0A 4OWXB 4JI6L 4A3MH 3GTKH 3KJPA 2KHJA 4Y7NH 3CP0A 1MJEA 4DV5L 2HQLA 4DK6C 2E8GA 4IOCA 3BJUA 4A3IH 4DR5L 3UDXA 3DM3A 3J7A5 5ELNA 1QVCA 3I4NH 3CCUA 1PH7A 3CCLA 3HOWG 5IP9G 2KCTA 4A3CG 4JI0Q 4OX9L 3PIOA 4A3GH 2NZOA 2WFWA 4DR3L 2JA7H 2JEAI 3HOWH 3G6EA 3OTOQ 3HOZG 3BZKA 3K81C 1Z9FA 2AWOA 4XIGS 1NTGA 1YHQA 1XMOQ 2BA0A 1PH1A 3HOZH 2AHOB 5IYDG 2ZJQA 5IWAQ 4NXMQ 1VQHA 1GKHA 4RG1A 2UUBL 3M7NA 4AYBG 1VQCA 2YTYA 4MNOA 1P8LA 3WWVA 3T1YQ 1PHJA 1VQ9A 1N36L 2VNUD 1Q1BA 1L1OB 4R4QA 3CPWA 4AH6A 4LFAL 4HIOA 2K4KA 1IBLQ 3RLNA 4BXXG 3FKIH 4DR1L 1PH5A 2BA1A 4JBKA 4C2MH 1N8RC 5C3EH 1K8AC 1NMFA 2UU9Q 3ZJYC 4ME3A 5FLMH 3M4PA 1RIPA 3H0GH 4TVAB 4JI4Q 4B3TL 4R4OA 2PI2A 3VDYA 3ER0A 2EIFA 3K7UC 2HIXA 3AYHB 4JI1L 1IXRA 2VS1A 2MO0A 4DV6Q 3PUZA 3UDFA 4YWMA 2ZM6L 4X62Q 4HIKA 3HOUG 1VQ7A 2JA5G 1CKMA 4IPGA 5J3BA 3UDGA 2UXDQ 1SN8A 4JI5Q 1TWHH 2Z6KC 1J5EQ 1VQJA 5FJ8H 4LFCQ 3CD6A 3U4ZA 1VQ6A 1O7IA 2JA8H 3RN5A 1VQGA 1YITA 1YJWA 2Q2HA 1HR0W 2R93H 1TWAH 3CC2A 4B3MQ 3U50C 1A62A 3EN2A 4A3FG 4LUVA 3I4MH 3Q8DA 3K0XA 4JOIA 1HNXQ 1HR0L 4L5QA 5GADC 3A5ZB 2VW9A 4R1JA 4LFCL 1UE1A 2UXBQ 1AE2A 1VCIA 2WP8J 3AFPA 5GAEC 4C3JH 2UXCQ 4DUYQ 4NXNQ 4QIWE 1PH9A 3J81c 4LF9L 5LMNW 3RLOA 4X62L 4JG2A 2ZM6Q 5H1SE 4A3EH 3JC66 1MIUA 2F52A 4AQYL 2BH8A 3I4MG 2WB1E 1SROA 1PFSA 3STBD 1UWVA 3D31A 4IPCA 2IHEA 3ULJA 1KRTA 3PF4A 4X64Q 1I3QH 1X6OA 4JI2Q 4A3MG 3KLWA 3I4NG 4QJFA 2GN5A 2CWPA 1IBML 2UXCL 3S15H 4HJ9A 1HNWQ 4DV7L 1SLJA 2E2HH 5FJ8G 4LF4Q 2CQOA 4GN3B 4PZ8A 1SRUA 2DUDA 1XMQL 4LUZA 1YJNA 1PA6A 1CSQA 2AWNA 3J80i 1VQLA 3CCVA 4A3DH 3E9HA 1FJGQ 2Y0SG 4APVA 1K83H 1Q12A 1SR3A 2EQSA 2FXQA 4JOIC 4A93H 1FGUA 4L5TA 3RZOH 1W3SA 4JI0L 4OX9Q 3KDFB 3K7AH 1WCMH 2UUBQ 4NB3A 5IYCH 4GOPB 1QZGA 3GTPH 4A3BH 3BU2A 1A8VA 4KHPQ 2MFIA 1WOCA 5JJLA 5GQOA 4B3RL 2IT1A 1Q86C 1I5FA 3PO3G 1NY4A 5K36G 1KQSA 4A93G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SGI A;  2K5H A;  4IOA A;  4AIM A;  2I5L X;  3A74 A;  5IP7 G;  3T1H Q;  2HT1 A;  1Y14 B;  5IYC G;  1BBU A;  4HJ5 A;  4JI7 Q;  3S2H H;  4JYA L;  4DAM A;  2ID0 A;  1MJC A;  5FLM G;  1CKN A;  3GTQ H;  4DV4 Q;  4OWT B;  2GVB A;  2IX0 A;  1TWG H;  1E22 A;  1VQF A;  2ALY B;  3AQQ A;  5C0X I;  4LW1 A;  4JCV E;  1M90 C;  3CPF A;  4LWC A;  1PV4 A;  2LXJ A;  3S1N H;  4DV6 L;  4DV5 Q;  3STB C;  3GTM H;  2R6G A;  3MEF A;  3NEL A;  4PG3 A;  1KXL A;  1B7Y B;  1I50 H;  4P71 A;  3S1Q H;  3NEM A;  2R7Z H;  3CCM A;  2UUA L;  1K8G A;  2RHQ B;  1TWC H;  3S1M H;  4K0K Q;  1GVP A;  4GNX A;  1EIY B;  3NEN A;  3UE0 A;  2IHF A;  1YI2 A;  1XPO A;  4A3C H;  1CKO A;  3J7Z C;  1N33 L;  4NXM L;  1QZH A;  2NVT H;  2H5X A;  4A3J H;  3HOU H;  2VY3 A;  3HOV H;  1X54 A;  3CW2 C;  3K80 C;  3S17 H;  1OXT A;  2I5M X;  1VQ4 A;  3G4S A;  3KJO A;  1E1O A;  1FVI A;  1Q82 C;  3H3V H;  1OXV A;  2LXK A;  2D0P A;  4H02 A;  1G51 A;  2Q2U A;  3E0E A;  4JI8 Q;  4A3E G;  5GAH C;  4PZ7 A;  2R92 H;  2NZH A;  1YHA A;  2JA7 G;  2Q2I A;  1JJG A;  3PSI A;  4JI2 L;  2JE6 I;  2ATW A;  4NXN L;  4DUY L;  3ULP A;  4AYB E;  4DV2 L;  4DAY B;  1E3P A;  4GLV B;  1N34 Q;  4DR4 Q;  2XGT A;  1SE8 A;  4DR7 L;  2ZJR A;  1X55 A;  1HNZ Q;  4P75 A;  1Q81 C;  1AH9 A;  1Y1W G;  1VQO A;  1HR0 Q;  2DGY A;  4GOP A;  1S72 A;  2R7D A;  4GKJ Q;  2VQE Q;  1V43 A;  3M9B A;  4BBR H;  5M3F H;  4JI4 L;  1MKH A;  2NVY H;  5C44 H;  5M3M H;  4A3J G;  1I94 L;  2ES2 A;  4IFD G;  3KFU A;  4KHZ A;  1Y1V G;  1YNX A;  2HHH Q;  3DLL A;  1D8L A;  3H3V I;  3PV0 A;  4JV5 Q;  1YJ9 A;  3K8A A;  3PCO B;  3W5O A;  3F2C A;  4HJ8 A;  2RF4 A;  2UUA Q;  1YBY A;  1WCM G;  4JBJ A;  4JI5 L;  5LMN Q;  4C3I H;  3OW2 A;  3TS0 A;  3CMA A;  1CUK A;  1HZA A;  3PUV A;  2QEX A;  1YEZ A;  2VL6 A;  4P73 A;  4PZ6 A;  2E5L Q;  4DV1 L;  3M85 A;  2VUM G;  4JI1 Q;  5C0X J;  4DV2 Q;  3A5U A;  2K75 A;  4EX5 A;  3ICE A;  3H15 A;  5BR8 L;  1X3G A;  1X3F A;  2F4V L;  4GS3 A;  3GTG H;  1P16 A;  1PYS B;  1YHB A;  3B6Y A;  1QUQ B;  2UXD L;  2Z0S A;  4IFD J;  4JI8 L;  1M1K C;  4A3L H;  1KD1 C;  4IFD I;  3F1Z A;  1XPR A;  4O2D A;  1DGS A;  3CF5 A;  4POF A;  5GRO A;  5C4J H;  1H95 A;  3M4O H;  1C9O A;  2MO1 A;  1X56 A;  4YY3 Q;  1YIJ A;  4BA2 I;  3JAM c;  1SFO H;  4GNX B;  4JBM A;  2ZTE A;  4YWK A;  4A75 A;  3S16 H;  3L2P A;  3CC7 A;  1KIX A;  1UE7 A;  1N32 L;  1J5E L;  3TS2 A;  1Z47 A;  2C35 B;  1JJC B;  4IJH A;  4DV4 L;  4A3K G;  4MZ9 A;  2UXB L;  2VQF L;  3CCS A;  4K0K L;  5IY0 A;  1V9P A;  1JE5 A;  1G6P A;  2K14 A;  2WAQ E;  5BR8 Q;  1PH4 A;  1CKN B;  1V1Q A;  3CCJ A;  2IX1 A;  4BBS G;  1WFQ A;  5E7N A;  1K0R A;  4DR2 Q;  1EOV A;  1BKB A;  4IPH A;  3D0F A;  3PGZ A;  4A3G G;  2XTI A;  2B63 H;  4X66 L;  3GTL H;  5HGQ A;  1S40 A;  1X65 A;  2YV5 A;  1L0W A;  5M5Y H;  2K52 A;  3S24 A;  2K50 A;  1JJ2 A;  3PUX A;  1CSP A;  2CFM A;  4P72 A;  4X65 Q;  4LFA Q;  2VQE L;  2PMZ E;  4B3T Q;  3KDF A;  3HOV G;  4L5R C;  3HOY H;  2B63 G;  4JI6 Q;  2JA9 A;  2PQA A;  5IE8 A;  2YTV A;  1XPU A;  4DR7 Q;  1N34 L;  1L1O A;  1Q8K A;  2RCN A;  2JA6 G;  3I7F A;  4TQU S;  1N32 Q;  4JI7 L;  1A0I A;  4BY7 H;  2N78 A;  4LNQ A;  1PH8 A;  4GKJ L;  2I0Q A;  4WJ3 M;  1X9N A;  3A0J A;  4XTC S;  5IT9 c;  5JJK A;  4BBR G;  5M3F G;  1UE6 A;  5ELO A;  2OQK A;  3PUW A;  4BA1 I;  2K5N A;  4QGU A;  4IO9 A;  5M5W H;  4LF9 Q;  3F8T A;  1GD7 A;  5C4X H;  1NMG A;  2ZJP A;  1Q7Y C;  5M5X H;  2VZA A;  4YCW A;  1EYG A;  3S2D H;  4YCV A;  4ALP A;  3AEV A;  4JYA Q;  1VQP A;  1HZ9 A;  1Q46 A;  5M3M G;  1XMO L;  4X6A H;  3J81 i;  1TXY A;  1B70 B;  1IBL L;  4DV1 Q;  1QVF A;  4YCU A;  4HID A;  1IYJ B;  1GM5 A;  1RL2 A;  1EIF A;  1S3O A;  4LF6 Q;  4LUO A;  2NVX H;  1PH2 A;  4AQY Q;  3T1Y L;  3PF5 A;  3HFZ B;  1XNQ L;  3RN2 A;  1YVC A;  1G29 1;  1EFW A;  4BY7 G;  4OWW B;  1BBW A;  1JB7 A;  4OO1 I;  3FP9 A;  1Y1V H;  2JQO A;  3G48 A;  4GLA C;  3PIP A;  4J15 A;  4C3H H;  2RHS B;  4DK3 C;  5IWA L;  4LF5 Q;  1K73 C;  2BH2 A;  1PVO A;  4X64 L;  1LM0 A;  4DR1 Q;  4YY3 L;  1TWF H;  3EBE A;  4PMW A;  2R7Z G;  4OO1 G;  5LMU Q;  1VQM A;  1GO3 E;  4DV0 Q;  4JI3 Q;  4HJA A;  2KCM A;  4LFB L;  4QQB X;  1XJV A;  4KHP L;  5EAY A;  3PO2 G;  1EUJ A;  1KAW A;  1LUZ A;  3I4O A;  2N49 A;  4GLX A;  4O0A A;  1VQB A;  2QGQ A;  1E24 A;  3I2Z A;  4LF5 L;  2Q2T A;  5C44 G;  2MNA A;  1PH3 A;  1XNR L;  3M3Y H;  4UP8 A;  1XTD A;  4LF6 L;  2PQA B;  1JT8 A;  1HZC A;  3EIV A;  1XNQ Q;  4MTN A;  2E2I H;  1PH6 A;  1ASY A;  3E9I A;  4P74 A;  4BBS H;  4A4I A;  4DNI A;  1FJG L;  4GKK L;  2VQF Q;  4R4T A;  1VQ8 A;  1IBK L;  2E2J H;  4A3L G;  5IP9 H;  1AE3 A;  1VQ5 A;  1VQD A;  3S14 H;  2OQ0 A;  5HY6 A;  2L15 A;  4A3B G;  4DR6 Q;  1VQI A;  3CXC A;  3FHW A;  3T1H L;  4JV5 L;  5IYD H;  2A1A A;  3CCE A;  3W1B A;  3PO2 H;  3GD7 A;  4X65 L;  1VQE A;  1SMX A;  4DUZ Q;  4WJ4 A;  4YHH L;  3LGJ A;  1FL0 A;  2I5H A;  4UP9 A;  3CCR A;  3RNU A;  1QUQ A;  4A3F H;  3I56 A;  4A76 A;  3J81 j;  2B3G A;  3BZC A;  4DR3 Q;  4L5S A;  1HNW L;  4BY1 G;  2R7F A;  4DV3 Q;  1LTL A;  4UP7 A;  4LF8 Q;  1N9W A;  1T9H A;  3HKZ G;  1KHI A;  2WB1 G;  4GN4 B;  4KLK A;  2YTX A;  3HOX G;  1HNX L;  1L1O C;  1C7Y A;  4DUZ L;  4A3I G;  1ASZ A;  4GKK Q;  4OON A;  3CAM A;  5IP7 H;  5JEA J;  3CQZ H;  3OYY A;  1N33 Q;  2F3I A;  3ULL A;  4DR6 L;  1K3R A;  3U4V A;  2JA6 H;  3KYH C;  5C0X G;  4LF4 L;  2KHI A;  4KI0 A;  4RMF A;  4EQ5 A;  2UU9 L;  4POG A;  5C4X G;  4HIM A;  3RLF A;  2B29 A;  3HKZ E;  3HOX H;  4GNX C;  4A3K H;  2OTL A;  3HKS A;  4DR5 Q;  2ZTD A;  2CKZ B;  4B3S Q;  3HOY G;  1HJP A;  2IY5 B;  2CWA A;  2K5V A;  1LYL A;  2MQH A;  3L0O A;  3JAM i;  2R92 G;  4BXX H;  4JC0 A;  1E7Z A;  3I55 A;  3UDI A;  2D62 A;  2WAQ G;  3CME A;  1YZ6 A;  3IRB A;  2HIV A;  3AFQ A;  4B3M L;  1OXX K;  4QY7 A;  4JI3 L;  4DV0 L;  4DPG A;  4LF7 Q;  4UY8 C;  3PUY A;  2R93 G;  2AMC B;  5JEA G;  4QL5 A;  5LMN L;  4Y52 H;  2OTJ A;  2N3S A;  3RZD H;  4IJL A;  3RR5 A;  2A8V A;  1JMC A;  2HHH L;  5LMU L;  1OXS C;  1B8A A;  1W2B A;  1E1T A;  1VQA A;  1IZ6 A;  4LFB Q;  3OTO L;  4NPS A;  4GN5 A;  2QA4 A;  1EQR A;  1X3E A;  1N36 Q;  1UEB A;  4R4C A;  2LSS A;  2A19 A;  4B3R Q;  2GVA A;  2YYZ A;  1HH2 P;  2NN6 I;  1HZB A;  2KBN A;  1IBK Q;  1QVG A;  3PO3 H;  2UUC L;  2F4V Q;  3KF6 B;  3U58 A;  3CC4 A;  2NN6 G;  1PYB A;  5C3E G;  4LF7 L;  1IL2 A;  2N8N A;  2JK8 A;  1WYD A;  1NE3 A;  2NVQ H;  1KL9 A;  1KRS A;  2V1C C;  3G71 A;  1K9M C;  5FLX c;  3ERS X;  5AJ3 L;  5GAG C;  1VQN A;  2E5L L;  3L7Z C;  4HJ7 A;  1VQK A;  1XNR Q;  3TQY A;  1IBM Q;  2KEN A;  2UUC Q;  3F2D A;  1WJJ A;  1I6H H;  3F2B A;  4DV7 Q;  4DV3 L;  2JA8 G;  3S1R H;  1NBW A;  1Q1E A;  3UE1 A;  3TRE A;  1R9T H;  2JA5 H;  1OXU A;  4UPA A;  2PNH A;  4BY1 H;  1D7Q A;  1NJI C;  3FKI G;  4DR2 L;  5JJI A;  3KF6 A;  2EXD A;  1BVS A;  4IPD A;  4YHH Q;  4FDB A;  4OXP A;  5AJ3 Q;  4GOP C;  2D0O A;  1I94 Q;  2JEB I;  2ASB A;  2ZTC A;  3TRZ A;  1KC8 C;  1L2F A;  4DR4 L;  3H0G G;  3TEH B;  2CCZ A;  1C0A A;  1XMQ Q;  3J80 c;  4LF8 L;  1U5K A;  1EWI A;  2OWO A;  2JJQ A;  2Y0S E;  2PI2 E;  3GO5 A;  3NBH B;  5IYB H;  3KOJ A;  1EQQ A;  3GTJ H;  2VUM H;  1Y1W H;  4JBW A;  2YU9 H;  5IYB G;  3W1G A;  1U0L A;  3M4Q A;  1HNZ L;  4A3D G;  5DLQ E;  4R4I A;  2AKW B;  1A63 A;  4DKA C;  1WI5 A;  1J6Q A;  4B3S L;  3GTO H;  4YWL A;  1UE5 A;  3KF8 B;  2OCE A;  3MXN B;  3CCQ A;  2Z6K A;  3GDE A;  4X66 Q;  1OTC A;  1VS0 A;  4OWX B;  4JI6 L;  4A3M H;  3GTK H;  3KJP A;  2KHJ A;  4Y7N H;  3CP0 A;  1MJE A;  4DV5 L;  2HQL A;  4DK6 C;  2E8G A;  4IOC A;  3BJU A;  4A3I H;  4DR5 L;  3UDX A;  3DM3 A;  3J7A 5;  5ELN A;  1QVC A;  3I4N H;  3CCU A;  1PH7 A;  3CCL A;  3HOW G;  5IP9 G;  2KCT A;  4A3C G;  4JI0 Q;  4OX9 L;  3PIO A;  4A3G H;  2NZO A;  2WFW A;  4DR3 L;  2JA7 H;  2JEA I;  3HOW H;  3G6E A;  3OTO Q;  3HOZ G;  3BZK A;  3K81 C;  1Z9F A;  2AWO A;  4XIG S;  1NTG A;  1YHQ A;  1XMO Q;  2BA0 A;  1PH1 A;  3HOZ H;  2AHO B;  5IYD G;  2ZJQ A;  5IWA Q;  4NXM Q;  1VQH A;  1GKH A;  4RG1 A;  2UUB L;  3M7N A;  4AYB G;  1VQC A;  2YTY A;  4MNO A;  1P8L A;  3WWV A;  3T1Y Q;  1PHJ A;  1VQ9 A;  1N36 L;  2VNU D;  1Q1B A;  1L1O B;  4R4Q A;  3CPW A;  4AH6 A;  4LFA L;  4HIO A;  2K4K A;  1IBL Q;  3RLN A;  4BXX G;  3FKI H;  4DR1 L;  1PH5 A;  2BA1 A;  4JBK A;  4C2M H;  1N8R C;  5C3E H;  1K8A C;  1NMF A;  2UU9 Q;  3ZJY C;  4ME3 A;  5FLM H;  3M4P A;  1RIP A;  3H0G H;  4TVA B;  4JI4 Q;  4B3T L;  4R4O A;  2PI2 A;  3VDY A;  3ER0 A;  2EIF A;  3K7U C;  2HIX A;  3AYH B;  4JI1 L;  1IXR A;  2VS1 A;  2MO0 A;  4DV6 Q;  3PUZ A;  3UDF A;  4YWM A;  2ZM6 L;  4X62 Q;  4HIK A;  3HOU G;  1VQ7 A;  2JA5 G;  1CKM A;  4IPG A;  5J3B A;  3UDG A;  2UXD Q;  1SN8 A;  4JI5 Q;  1TWH H;  2Z6K C;  1J5E Q;  1VQJ A;  5FJ8 H;  4LFC Q;  3CD6 A;  3U4Z A;  1VQ6 A;  1O7I A;  2JA8 H;  3RN5 A;  1VQG A;  1YIT A;  1YJW A;  2Q2H A;  1HR0 W;  2R93 H;  1TWA H;  3CC2 A;  4B3M Q;  3U50 C;  1A62 A;  3EN2 A;  4A3F G;  4LUV A;  3I4M H;  3Q8D A;  3K0X A;  4JOI A;  1HNX Q;  1HR0 L;  4L5Q A;  5GAD C;  3A5Z B;  2VW9 A;  4R1J A;  4LFC L;  1UE1 A;  2UXB Q;  1AE2 A;  1VCI A;  2WP8 J;  3AFP A;  5GAE C;  4C3J H;  2UXC Q;  4DUY Q;  4NXN Q;  4QIW E;  1PH9 A;  3J81 c;  4LF9 L;  5LMN W;  3RLO A;  4X62 L;  4JG2 A;  2ZM6 Q;  5H1S E;  4A3E H;  3JC6 6;  1MIU A;  2F52 A;  4AQY L;  2BH8 A;  3I4M G;  2WB1 E;  1SRO A;  1PFS A;  3STB D;  1UWV A;  3D31 A;  4IPC A;  2IHE A;  3ULJ A;  1KRT A;  3PF4 A;  4X64 Q;  1I3Q H;  1X6O A;  4JI2 Q;  4A3M G;  3KLW A;  3I4N G;  4QJF A;  2GN5 A;  2CWP A;  1IBM L;  2UXC L;  3S15 H;  4HJ9 A;  1HNW Q;  4DV7 L;  1SLJ A;  2E2H H;  5FJ8 G;  4LF4 Q;  2CQO A;  4GN3 B;  4PZ8 A;  1SRU A;  2DUD A;  1XMQ L;  4LUZ A;  1YJN A;  1PA6 A;  1CSQ A;  2AWN A;  3J80 i;  1VQL A;  3CCV A;  4A3D H;  3E9H A;  1FJG Q;  2Y0S G;  4APV A;  1K83 H;  1Q12 A;  1SR3 A;  2EQS A;  2FXQ A;  4JOI C;  4A93 H;  1FGU A;  4L5T A;  3RZO H;  1W3S A;  4JI0 L;  4OX9 Q;  3KDF B;  3K7A H;  1WCM H;  2UUB Q;  4NB3 A;  5IYC H;  4GOP B;  1QZG A;  3GTP H;  4A3B H;  3BU2 A;  1A8V A;  4KHP Q;  2MFI A;  1WOC A;  5JJL A;  5GQO A;  4B3R L;  2IT1 A;  1Q86 C;  1I5F A;  3PO3 G;  1NY4 A;  5K36 G;  1KQS A;  4A93 G; 
#chains in the Genus database with same CATH topology
 1Y1V B;  3LNN A;  2OT2 A;  1GUO A;  2I5L X;  5IP7 G;  3CKI B;  3TSS A;  2HT1 A;  4F7X A;  4HJ5 A;  1RHP A;  1SJH D;  1MJC A;  5FLM G;  2K01 A;  1X3Q A;  1TWG H;  3VR6 A;  1VQF A;  1CQV A;  2ALY B;  1R9T B;  2LXJ A;  5IGB A;  3D4R A;  4DV5 Q;  3STB C;  5FO7 B;  2R6G A;  3MEF A;  1ZKO A;  1I6H B;  3D8G A;  3S1Q H;  4DGZ A;  2R7Z H;  3CCM A;  3KLR A;  3LX0 A;  2RHQ B;  1TWC H;  4GNX A;  3M7G A;  1I4G A;  2PW5 A;  2NVT H;  4GZY C;  4NXM L;  1QZH A;  4FXD A;  1CI3 M;  2I5M X;  1VQ4 A;  3BDC A;  2XVS A;  1E1O A;  1FVI A;  2X6G A;  4IUU A;  2R7Z B;  4A3E G;  5GAH C;  1YHA A;  2NVY B;  1JJG A;  1B50 A;  4DUY L;  1I4Q A;  4DV2 L;  4DAY B;  1SE3 A;  1SE8 A;  3H91 A;  4P75 A;  4KMU C;  1AH9 A;  5IT9 L;  3Q24 A;  3A55 A;  2R7D A;  3VYS A;  3M9B A;  4JI4 L;  5C44 H;  1I94 L;  1A3U A;  1RTO A;  1VF7 A;  1YNX A;  2HHH Q;  3DLL A;  2RSO A;  3BG3 A;  2FMM A;  1GUW A;  3TS0 A;  3CMA A;  1CUK A;  1MD2 D;  2QEX A;  4H0L C;  1WTO A;  4PZ6 A;  2MUY A;  4JI1 Q;  2A68 C;  5C0X J;  3VYT A;  2MPM A;  1X3G A;  3G6J B;  2JA6 B;  2Z6B A;  3BYT B;  4IFD J;  4A3L H;  1WTR A;  4IFD I;  3F1Z A;  1LTS D;  4FF1 A;  2NBF A;  1YNJ C;  3WDN A;  2K1B A;  3JAM L;  1X56 A;  1Y8P B;  2P5Z X;  4CDE C;  3S16 H;  3MWY W;  1KIX A;  5C4X B;  3GTG B;  5M5W B;  1J5E L;  1Z47 A;  4DV4 L;  4B9X A;  1M4V A;  2WAQ E;  5BR8 Q;  4KKU A;  1PH4 A;  1V1Q A;  2IX1 A;  4HCS A;  4HMI A;  4BBS G;  1WFQ A;  1CFM A;  1K0R A;  2Z1C A;  1BKB A;  1EY4 A;  1TR5 A;  3PGZ A;  5IGG A;  2B63 H;  1AZQ A;  1BCP F;  4A93 B;  1FNU A;  3X3M A;  3BYY B;  1X65 A;  2YV5 A;  3S24 A;  1CSP A;  1IHZ A;  5JEA H;  1R4P B;  3Q6S A;  4X65 Q;  4JPB W;  2PMZ E;  5DAU A;  3KDF A;  4DNT B;  4U68 A;  4JI6 Q;  2VUM B;  2AUK A;  5KND A;  4DR7 Q;  1N34 L;  3C2P A;  4HSP A;  3VYR A;  4JI7 L;  1HCZ A;  3V2T A;  5KRU A;  1PH8 A;  5J22 A;  5IT9 c;  1SYG A;  5M3F G;  5JJK A;  2DY7 A;  3F2U A;  4C3H G;  5ELO A;  4BA1 I;  3KK7 A;  4QGU A;  1PMR A;  1LTR D;  1NMG A;  2KCN A;  4OEM B;  5M5X H;  3S2D H;  4J6H A;  4YCV A;  3AEV A;  2D5D A;  5EKI A;  3VA7 A;  2WKC A;  2F0L A;  3MC0 B;  1Q46 A;  5KNB A;  3D3R A;  4ZCK A;  3I3C A;  3NWT A;  2HCC A;  3S2D B;  1S3O A;  3DWQ A;  1PH2 A;  1GHJ A;  1EFW A;  1JB7 A;  1C48 A;  3G48 A;  2JQO A;  5DEH A;  4KN4 C;  4DK3 C;  4A3G B;  1KAB A;  1LM0 A;  1E2V A;  3EBE A;  1GO3 E;  1HA5 A;  3MEH A;  4FVM A;  4MIU A;  2EPB A;  2A6H C;  5JJZ A;  1FNV A;  5ELC A;  4GLX A;  3DHQ A;  1ZEQ X;  2B8G A;  2QGQ A;  4IQZ A;  2MNA A;  3O13 A;  4LF6 L;  2PQA B;  1JT8 A;  2XRS D;  4JW0 A;  2F0F A;  1PH6 A;  3P1H A;  3E9I A;  2B2W A;  5IT9 E;  1BO0 A;  1T5X D;  1CT1 D;  1VQ8 A;  1C8C A;  1QNK A;  4K6D A;  1VQ5 A;  3S14 H;  2F0G A;  2L15 A;  3P20 A;  1VQI A;  4FNF A;  1WVL A;  2CW0 C;  3PO2 H;  4K8J A;  3K5O A;  4WJ4 A;  2NVT B;  1ESF A;  3LGJ A;  3CCR A;  1ENC A;  2I5H A;  4NW2 A;  1WTP A;  1W6J A;  1NSN S;  4A3F H;  3J81 j;  1HNW L;  1S4Z A;  2A6H D;  4BS9 A;  1WTX A;  4V0B A;  4LF8 Q;  3HOX G;  3W3A A;  1HNX L;  3A7L A;  1L1O C;  4RFB A;  1HUN A;  1F77 A;  1PTO C;  3CAM A;  5IP7 H;  4S3S A;  3CQZ H;  1QE6 A;  2F3I A;  4X3U A;  3JAM E;  4MN3 A;  2JA6 H;  3KYH C;  2PYK A;  4RMF A;  1FYC A;  5NUC A;  3RLF A;  2B29 A;  2TSS A;  3HOX H;  2OTL A;  3HKS A;  4DR5 Q;  4G7O C;  2CKZ B;  4ZAI A;  2CWA A;  2K5V A;  5D14 A;  3GTJ B;  1EL0 A;  1J8I A;  2H4O A;  1JOO A;  1MHW C;  3CME A;  3KBX A;  3IRB A;  2HIV A;  1OXX K;  1TY0 A;  2B39 A;  3PUY A;  3SK6 A;  4C2M B;  4BBS B;  2OTJ A;  4CJ1 B;  4BBR B;  3Q0A A;  1G6Z A;  4IJL A;  4HSV A;  5LMU L;  1CQF A;  1W2B A;  1VQA A;  4LFB Q;  4XQQ A;  1EQR A;  3TP5 A;  5I2X A;  2A19 A;  4B3R Q;  1A3V A;  2K5W A;  5IGD A;  1QVG A;  2EJG C;  3U58 A;  2NN6 G;  1G8Z D;  3MFG A;  1KL9 A;  3G71 A;  1D6E C;  2J7Z A;  1Q3L A;  3ONA B;  3E5S A;  4ZK9 B;  3LWU A;  1IBM Q;  4MTK A;  4ZKC B;  4KKT A;  3S1Q B;  1I6H H;  5CV5 A;  3EFX D;  5DM7 3;  4DAV A;  5JJI A;  1E0B A;  3KF6 A;  3J7A V;  2ASB A;  3GTO B;  1L2F A;  3H0G G;  2JXM B;  3MHB A;  1SYE A;  3J80 c;  2L11 A;  4BY7 B;  2Y0S E;  3VYU A;  2EYH A;  5J39 A;  4CJ0 B;  3GTJ H;  1SND A;  2A68 D;  2EZV A;  4JBW A;  3DEP A;  5BN5 A;  1HNZ L;  5DLQ E;  4DAP A;  4DKA C;  4B3S L;  4YWL A;  1UE5 A;  3KF8 B;  2Z6K A;  5EQ0 A;  1NR2 A;  1EU3 A;  4TRD A;  3GTK H;  1MJE A;  3CP0 A;  1EIG A;  2HQL A;  4DK6 C;  3HKZ B;  4IOC A;  3D6C A;  1JWM D;  3DM3 A;  5ELN A;  5EGT A;  1L0Y B;  3I4N H;  5IP9 G;  2KCT A;  4A3C G;  3S17 B;  4DR3 L;  2WFW A;  2JA7 H;  4A3E B;  2JEA I;  2KEE A;  1G91 A;  2EDG A;  1Z9F A;  1NTG A;  4ZLT F;  1PH1 A;  4R8I A;  1TS2 A;  3I4M B;  1GKH A;  4RG1 A;  2UUB L;  1TWA B;  4MNO A;  1P8L A;  1PHJ A;  5LHY 1;  2R93 B;  2VNU D;  4AH6 A;  4RH6 A;  4CHT B;  2CVR A;  5IGF A;  4JBK A;  1N8R C;  4E6I A;  2UU9 Q;  4ME5 A;  3M4P A;  2RBM A;  3H0G H;  3AU7 A;  4TVA B;  5COR A;  4B3T L;  5JPM C;  2RQX A;  2F0O A;  5I6Y A;  4OO1 H;  3K7U C;  1W6K A;  3HOY B;  2VS1 A;  3H94 A;  3UDF A;  2WII B;  2ZM6 L;  3HOU G;  1CKM A;  2VB3 X;  5J3B A;  2KED A;  1KLU D;  4ODG A;  3C3L A;  1VQJ A;  3CD6 A;  2EYL A;  2C9O A;  5C6A A;  3DM1 A;  1CZG A;  4G57 A;  2R93 H;  1HQM C;  5C4Z A;  5IOD A;  1SNC A;  2QKI C;  3C1F A;  3I4M H;  1SMY C;  1V1P A;  4CDC C;  1ENF A;  3K0X A;  1HNX Q;  3NP8 A;  5GAD C;  3A5Z B;  2JN4 A;  3HGB A;  3N6R A;  1VCI A;  3NWS A;  4WJW A;  3T13 A;  1NR4 A;  4LK1 C;  4DUY Q;  2FJ2 A;  2B2V C;  4N8X 1;  4X62 L;  4A3E H;  4RKB A;  2F52 A;  2BH8 A;  2QCP X;  1PRT F;  3QOJ A;  4FXG C;  2O2L D;  2PCF B;  2Z4I A;  3MXP A;  1UNS A;  1KRT A;  4XT1 B;  1K3B C;  4JI2 Q;  3KLW A;  2GN5 A;  1ESR A;  3C46 A;  1SSO A;  4DV7 L;  2E2H H;  5C0X H;  1ET9 A;  2AWN A;  2NTS A;  1Z7T A;  3E9H A;  4A93 H;  2FXQ A;  4X3T A;  2B63 B;  4LAA A;  2WKD A;  1PFB A;  1W3S A;  4JI0 L;  3KDF B;  5ELD A;  4NB3 A;  1B1Z A;  1SEB D;  1EFI D;  4LMQ D;  3BU2 A;  1A8V A;  2RDF A;  1A2U A;  3H0G B;  5GQO A;  4B3R L;  3I72 A;  1Q86 C;  1H9S A;  2HQE A;  3SGI A;  2K5H A;  4IOA A;  1CA5 A;  3A74 A;  3T1H Q;  3MVV A;  4JYA L;  1HTL D;  1SNM A;  4DAM A;  2ID0 A;  1QG7 A;  2HCI A;  1JOQ A;  3GTQ H;  1CKN A;  4DV4 Q;  2GVB A;  2IX0 A;  1E22 A;  1MSG A;  2JP1 A;  3AQQ A;  4RHS A;  4JCV E;  3S1R B;  1M90 C;  3CPF A;  1G2T A;  3J7A F;  4PG3 A;  1B7Y B;  1I4R A;  3MAQ A;  1BCP C;  2UUA L;  1YNN D;  3S1M H;  2B2U C;  4K0K Q;  3NEN A;  3I90 A;  3E6Z X;  1CKO A;  3J7Z C;  3HOV H;  1SYB A;  2JSO A;  4IZ8 A;  3NSW A;  4A3J H;  3HOU H;  1X54 A;  3S17 H;  2PZW A;  1OXT A;  5LL6 X;  4RCO A;  3G4S A;  1HUM A;  1AW7 A;  1Q82 C;  1OXV A;  2LXK A;  2D0P A;  4EQP A;  3NQI A;  3VR4 A;  1BUV T;  2AQ1 B;  4KJO A;  4CBV A;  1TS5 A;  2Q2I A;  5I6W A;  3K58 A;  1N34 Q;  4DR4 Q;  1X55 A;  5E3F A;  1HNZ Q;  2NUC A;  1Q81 C;  4N9P A;  1HR0 Q;  5M5Y B;  1NNX A;  4GKJ Q;  1V43 A;  4BBR H;  1SE2 A;  5FLX E;  4IFD G;  4HMJ A;  4DK1 A;  1D8L A;  3H3V I;  2F0S A;  3K8A A;  4HJ8 A;  1YBY A;  3ITP A;  2FFK B;  2ZT9 C;  3HOU B;  2ENB A;  1BF4 A;  1LTB D;  1YNJ D;  2KHS A;  3A5U A;  2K75 A;  3H15 A;  1MI2 A;  1LTI D;  1RD9 D;  1P16 A;  2WB1 B;  1YHB A;  4JI8 L;  1KD1 C;  2N88 A;  4O2D A;  3CF5 A;  2JA5 B;  5C4J H;  1H95 A;  5C4J B;  3D4D A;  1YIJ A;  3JAM c;  4GNX B;  2ZTE A;  4YWK A;  4NP5 A;  3CC7 A;  2RDG A;  1TT2 A;  1UE7 A;  1N32 L;  3TS2 A;  2VXW A;  2C35 B;  4A3K G;  2UXB L;  1DM0 B;  2JA7 B;  3A8K E;  1QIL A;  5E4W C;  1G6P A;  4ULL A;  2XN9 C;  1CKN B;  4A3G G;  2E2I B;  1K83 B;  4X66 L;  3GTK B;  4X3K A;  1F9R A;  2K50 A;  2Y0S B;  4ZRZ A;  1H9J A;  1M8A A;  4LFA Q;  1EEF D;  2ZXP A;  5KGU A;  1AFP A;  1CHP D;  1TII D;  1D5M C;  1I6V C;  1F2Z A;  1L1O A;  2V4D A;  3P75 A;  1A0I A;  2N78 A;  4LNQ A;  1F9P A;  4AYB B;  1B9M A;  1Z6H A;  2KUM A;  3A0J A;  3M4Y A;  3TDQ A;  3FPP A;  3PUW A;  2K5N A;  1QJO A;  2KQ3 A;  4DN4 M;  2B8F A;  2ZJP A;  1Q7Y C;  1EYG A;  4YIJ A;  1VQP A;  1HZ9 A;  1STG A;  5M3M G;  1TXY A;  1B70 B;  4K2L A;  1U4M A;  2N55 A;  3W2D A;  4YCU A;  2B2T C;  4BWG B;  2NVX H;  3HFZ B;  1XNQ L;  3RN2 A;  4C3I G;  3HS0 C;  1BBW A;  3FP9 A;  4J15 A;  2BH2 A;  2NWG A;  4X64 L;  4DR1 Q;  4PNY A;  5LMU Q;  4JI3 Q;  3G7L A;  2KCM A;  2LKV A;  1WCM B;  3CU7 A;  1EUJ A;  1F9S A;  1KAW A;  2G9D A;  4PMC A;  2N49 A;  4OIJ A;  3AB9 A;  1VQB A;  1A2T A;  1PH3 A;  1BNZ A;  2KCC A;  1XTD A;  1LT4 D;  2M9V A;  3BS1 A;  1B2T A;  3EIV A;  3BVG A;  1JE4 A;  1ASY A;  1TS3 A;  4BBS H;  1JR0 D;  4A4I A;  1FJG L;  2HDL A;  2L1B A;  4R4T A;  4A3L G;  3NE5 B;  1VQD A;  4JV5 L;  4A3B G;  1K0S A;  3ND8 A;  3GD7 A;  1F2M A;  1SMX A;  3CHB D;  3RNU A;  4UP9 A;  1I4P A;  4FF2 A;  3I56 A;  4X3S A;  2B3G A;  3GV3 A;  4BY1 G;  4DV3 Q;  1JOR A;  4UP7 A;  1N9W A;  2B2U A;  4J1M A;  2AQ2 B;  4A3I G;  4QIW B;  1ASZ A;  4GKK Q;  2JA8 B;  2LMC B;  2OXP A;  3OYY A;  1N33 Q;  3DWA A;  1ICF B;  3ULL A;  1ZYR C;  3U4V A;  2DNC A;  5C4X G;  4HIM A;  1Q90 A;  3HKZ E;  4GNX C;  3HOY G;  4B3S Q;  1STA A;  1LYL A;  3L0O A;  1ROD A;  4BXX H;  5C4H A;  1E7Z A;  3I55 A;  3TME A;  3QWN A;  2A5H A;  3TP7 A;  1IKM A;  1YZ6 A;  3AFQ A;  4J8Q A;  4UY8 C;  4LF7 Q;  4KD4 A;  3QJY A;  2Q8I B;  4Q0F A;  2KA7 A;  4QL5 A;  2K04 A;  2N3S A;  3RZD H;  2E74 C;  1XYI A;  1OXS C;  1E1T A;  3OTO L;  2B2W C;  3OWE B;  4GN5 A;  2QA4 A;  1UEB A;  2LSS A;  1U4R A;  2R92 B;  3BZD B;  1HZB A;  2UUC L;  2F4V Q;  2HUG A;  4L8J A;  1V8Q A;  2XSC A;  1IL2 A;  2N8N A;  2SNS A;  1EY0 A;  2K05 A;  3BVM A;  2BDO A;  1TY2 A;  3KLS A;  2SEB D;  1K9M C;  1D2B A;  4U67 3;  5FLX c;  3ERS X;  2SNM A;  5AJ3 L;  2B2Y A;  2E5L L;  3I4N B;  1XNR Q;  3TQY A;  4DU9 A;  4MHE A;  2Z9H A;  2UUC Q;  1WJJ A;  3F2B A;  1NBW A;  2F0I A;  3UE1 A;  1R9T H;  2CH4 A;  3FKI G;  2EXD A;  4IPD A;  5AJ3 Q;  2K7V A;  1QNU A;  1EWH A;  4GOP C;  3PMF A;  1I94 Q;  2JEB I;  3TEH B;  1BCP B;  2CCZ A;  1U9R A;  4PV1 C;  4EVO A;  4QUC A;  5C5L A;  1DOM A;  1PZI D;  4C3I B;  3V96 A;  2IPK D;  3FMC A;  5IYB H;  3OW7 A;  4N9T A;  5JPN C;  1D1K A;  4IUP A;  2E2J B;  1B9N A;  5K5P A;  2VUM H;  1Y1W H;  2L0C A;  2DY8 A;  2L9H A;  3M4Q A;  3NHH A;  4R4I A;  2AKW B;  4KY5 A;  1S5C D;  1WI5 A;  4ZQ3 A;  3T56 B;  2QW7 A;  3MXN B;  3TP6 A;  3GDE A;  2RSN A;  3M3Y B;  1OTC A;  1VS0 A;  2KHJ A;  4DV5 L;  1ICW A;  1RTN A;  2E8G A;  1SMY D;  1JWU D;  3H09 A;  3R2T A;  4B08 A;  1EOT A;  3OMG A;  2BDN A;  1PYW D;  3ERQ A;  3GV6 A;  5BN4 A;  3CCU A;  4A3F B;  1EWC A;  3QB3 A;  1PH7 A;  2O4X A;  4JI0 Q;  3HOW H;  3BZK A;  4QB4 A;  3LWE A;  2NTT A;  1QCB D;  1YHQ A;  5IYD G;  4NXM Q;  3FRP B;  4ILW A;  1VQH A;  4KKS A;  4A3I B;  5FKA C;  4KD3 A;  1PLF A;  1PZJ D;  3T1Y Q;  4Y7N B;  3IAY A;  1Q1B A;  4R4Q A;  3CPW A;  5D65 A;  2F0W A;  5FO8 B;  4HIO A;  5K36 H;  1PTO H;  2K4K A;  1IBL Q;  1EQV A;  3RLN A;  1BBX C;  1PH5 A;  2BA1 A;  1NUC A;  2E2D C;  1PFM A;  2F03 A;  4KK7 A;  4L6T B;  1NMF A;  2RCF A;  3ZJY C;  4WRD A;  3KBG A;  3K59 A;  4V19 0;  4JI4 Q;  2PI2 A;  1I4H A;  1SNO A;  2XNA C;  3VDY A;  1SYF A;  3AYH B;  1IXR A;  4JI1 L;  5I2Y A;  4HIK A;  4X62 Q;  5C3E B;  2JA5 G;  3I4L A;  1UUP A;  3UDG A;  1PTO B;  1SN8 A;  1TWH H;  2Z6K C;  3DEO A;  2RDH A;  4RGM A;  2JA8 H;  1B53 A;  2ZXO A;  2MHV A;  5C5M A;  1HR0 W;  3CC2 A;  4LUV A;  3HOZ B;  1HR0 L;  4KJN A;  3V05 A;  2F0K A;  1AE2 A;  3AFP A;  5CMD A;  5GAE C;  4C3J H;  5FO9 B;  3J81 c;  4LF9 L;  5C3W A;  1GOZ A;  3RLO A;  4JG2 A;  1KDC A;  1MIU A;  2DN8 A;  3I4M G;  1PFS A;  4IPC A;  2IHE A;  5JVG 3;  3PF4 A;  4QJF A;  1IBM L;  3S15 H;  2K5D A;  4LF4 Q;  2CQO A;  2B2V A;  1XMQ L;  1YJN A;  3GTQ B;  1DD2 A;  3OWF A;  1EZ6 A;  3Q22 A;  2Y0S G;  4APV A;  1SR3 A;  3GTL B;  4JOI C;  1MGS A;  4L5T A;  2FMC A;  5E4X A;  1GUT A;  3HEJ A;  1WCM H;  1B44 D;  4GOP B;  2A6E D;  1WTV A;  3GTP H;  4A3B H;  1LT5 D;  4KHP Q;  2MFI A;  2F0P A;  5JJL A;  2IT1 A;  3WOE A;  1I5F A;  5K36 G;  1KQS A;  5ELF A;  3A7A B;  4AIM A;  3D6W A;  1DJR D;  1Y14 B;  4JI7 Q;  2WAQ B;  4OWT B;  1TU2 B;  1I4X A;  1SNP A;  5C0X I;  2LS0 1;  1PV4 A;  1HPC A;  3S1N H;  3GTM H;  1A6X A;  4K2K A;  1FNW A;  1KXL A;  1GVP A;  4C1N K;  1YI2 A;  2IHF A;  4A3C H;  1GUG A;  3PO3 G;  2WAC A;  3I91 A;  2VY3 A;  3CW2 C;  3K80 C;  3QIA A;  3IKJ A;  3KJO A;  2PW7 A;  1PTO D;  3H3V H;  2XIW A;  4H02 A;  4ZUJ A;  2Q2U A;  2LFN A;  2L55 A;  4PZ7 A;  5C44 B;  4JI2 L;  2ATW A;  4AYB E;  1RCV D;  1E3P A;  4GLV B;  5E1F A;  1VMC A;  3TZD A;  1Y1W G;  1VQO A;  4UHV A;  2VQE Q;  2F0Q A;  2NVY H;  4A3J G;  1MBY A;  2ES2 A;  1Y1V G;  5COY A;  2M2L A;  3PQI A;  1JOK A;  3PV0 A;  1YJ9 A;  4UDU C;  4CGY B;  3PCO B;  3F2C A;  4JI5 L;  4JBJ A;  1PRT B;  5LMN Q;  5ELB A;  4A3B B;  1FD7 D;  3PUV A;  1YEZ A;  2VL6 A;  4DV1 L;  5EJW A;  2VUM G;  5IOC A;  1PZK D;  4DNR B;  4IUT A;  4EX5 A;  5BR8 L;  1NAP A;  1X3F A;  2F4V L;  3HG9 A;  2J0T D;  1LT6 D;  3GTG H;  1CK1 A;  1ML0 D;  1PYS B;  1KAA A;  4JK1 C;  2UXD L;  4IN3 A;  3S16 B;  2Z0S A;  4BY1 B;  3L3O C;  2EY1 A;  1DGS A;  5EPJ A;  4POF A;  4FF4 A;  5GRO A;  4IFD H;  1RDP D;  2D9U A;  3MZ5 A;  4BA2 I;  1TWG B;  4KN7 C;  4NDX A;  3MA2 B;  5ISR A;  2F0N A;  4IAL A;  4MZ9 A;  3A56 A;  3CCS A;  4K0K L;  5IY0 A;  1V9P A;  1IKL A;  5A2Q E;  4FO2 A;  2F0U A;  3VR5 A;  4IUV A;  1CZW A;  4G4K A;  3U9O A;  1SNQ A;  3D0F A;  2QDL A;  2XTI A;  1JIC A;  1PRT D;  2MP1 A;  5HGQ A;  1D5X C;  1S40 A;  2EY5 A;  4OHJ A;  5M5Y H;  3J80 E;  3EQL C;  1JJ2 A;  4XT3 B;  2K03 A;  2CFM A;  5CV6 A;  1LLR D;  4QUF A;  1I3Q B;  1O80 A;  5ELE A;  3HOY H;  2B63 G;  2PQA A;  5IE8 A;  4K8I A;  1XPU A;  1C4Q A;  2RCN A;  4TQU S;  4BY7 H;  4GKJ L;  3TP8 A;  3K57 A;  5CV9 A;  4BBR G;  5CBA E;  1UE6 A;  1LTG D;  2OQK A;  3S1M B;  2K32 A;  1SYD A;  1O7L A;  1CHQ D;  4IO9 A;  2HD3 A;  4LF9 Q;  1T5E A;  3F8T A;  4YCW A;  1TQO A;  1B3A A;  4XDX A;  4K6L A;  2VB2 X;  1KNE A;  1QVF A;  3DXJ C;  5FLX L;  1IYJ B;  5AFW A;  2AUJ D;  4LF6 Q;  1G29 1;  4CJ2 C;  4OWW B;  4OO1 I;  1FGB D;  3GP7 A;  4GLA C;  2RHS B;  4LF5 Q;  4FXK C;  2H1E A;  3T4A C;  1K73 C;  1AZP A;  4B9W A;  4XQJ A;  4YY3 L;  3SEB A;  2I07 B;  3PO3 B;  3KF8 A;  2K6A A;  1VQM A;  4DV0 Q;  3H3V C;  4HJA A;  1QWY A;  4QQB X;  4KHP L;  3R2I A;  5EAY A;  3I4O A;  4RA8 A;  1ONL A;  2RA4 A;  3I2Z A;  4LF5 L;  2Q2T A;  3DWP A;  5C44 G;  1XNR L;  3M3Y H;  4UP8 A;  3SVM A;  4KV6 A;  1SDF A;  4MTN A;  2E2I H;  5BN3 A;  4P74 A;  4F8M A;  2VQF Q;  4CKC A;  3U9S A;  1IBK L;  2E2J H;  5IP9 H;  3SHL A;  5HY6 A;  5IYD H;  2K28 A;  3ERO A;  5EBC A;  4ZUI A;  3W1B A;  1VQE A;  1FL0 A;  2RKS A;  5EKK A;  3A54 A;  1QUQ A;  4A76 A;  3BZC A;  4DR3 Q;  3K5N A;  4L5S A;  1H9R A;  2R7F A;  1LTL A;  5CGK A;  3A8J E;  3HKZ G;  2WB1 G;  5KNC A;  4KLK A;  3M4O B;  2QIL A;  2OF1 A;  4XQN A;  3C1E A;  2WV6 D;  4DR6 L;  1SXT A;  3OPO A;  4ZYS A;  4WFN 3;  2PZU A;  4LF4 L;  2KHI A;  4KI0 A;  2UU9 L;  5CV7 A;  4K14 A;  3ZYY X;  4A3K H;  3QG1 A;  1BQQ T;  1HJP A;  5HGT A;  4O1N A;  3JAM i;  2R92 G;  5IGE A;  2KEC A;  3VA5 A;  2SOB A;  3UDI A;  1HTP A;  1SE4 A;  5F2D A;  4QY7 A;  4JI3 L;  3GTP B;  4DPG A;  2R93 G;  2AMC B;  2MGS A;  5JEA G;  1HRJ A;  5LMN L;  2XWB B;  3SK5 A;  3OIP A;  1ILQ A;  5M3F B;  5D3D A;  4DF7 A;  3NTK A;  2A8V A;  3TZU A;  2HHH L;  3J7Y W;  2E2H B;  1IZ6 A;  2A73 B;  4R4C A;  1O7Y A;  4OGQ C;  2GVA A;  1EY5 A;  2KBN A;  5KYI A;  3HOV B;  2JK8 A;  1NE3 A;  2NVQ H;  1KRS A;  4OIK A;  1IYU A;  1EU4 A;  1OO9 B;  2F3W A;  5GAG C;  3AMU A;  4JVZ A;  2KEN A;  3GTM B;  3BDO A;  4DV7 Q;  2JA8 G;  4DV3 L;  3S1R H;  2XWJ B;  3GQB A;  1TKW B;  1OXU A;  2EY6 A;  2PNH A;  5FK9 C;  1D7Q A;  1LT3 D;  4YHH Q;  4XYQ A;  5L37 A;  2IW3 A;  4EQN A;  2D0O A;  2EYO A;  1H9M A;  4DR4 L;  1C0A A;  1DXM A;  1EY8 A;  1EWI A;  2OWO A;  2JJQ A;  1KNA A;  2PI2 E;  4G7Z C;  3QR8 A;  1EQQ A;  3KOJ A;  2J4X A;  4M8A A;  2BCO A;  2YU9 H;  1DOL A;  3J81 L;  1U0L A;  1CA6 A;  4A3D G;  1EYD A;  1F9Q A;  1SAP A;  1A63 A;  4KHV A;  1H9S B;  1J6Q A;  3X3N A;  1D5Z C;  1VF5 C;  3GTO H;  1B4O A;  3CCQ A;  3HP3 A;  2EYP A;  4JI6 L;  4A3M H;  3KJP A;  4Y7N H;  4WOR A;  4C1N I;  1HA6 A;  1S5D D;  2M00 A;  2EYF A;  4A3I H;  1XWE A;  2Q8R E;  2A74 C;  3BJU A;  1DON A;  1MSH A;  3UDX A;  4F87 A;  4QCL A;  2A69 C;  3HOW G;  1V1P B;  3P7J A;  3PIO 3;  3PIO A;  1A15 A;  3OTO Q;  3HOZ G;  3K81 C;  3IL8 A;  4IUN A;  2EE1 A;  5CYU A;  1QOH A;  1XMO Q;  2BA0 A;  3HOZ H;  2ZJQ A;  5KYL A;  1GHK A;  4G7H C;  2ICI A;  1R4Q B;  3NUC A;  3S1N B;  3R93 A;  1V1O A;  4AYB G;  1VQC A;  1STE A;  2YTY A;  2EXZ A;  3WWV A;  2CHB D;  1WD1 A;  1N36 L;  1L1O B;  4LFA L;  4F88 A;  5M5X B;  4HED A;  4BXX G;  1UAP A;  3FKI H;  1SYC A;  5LL6 S;  2F4I A;  2PMZ B;  1SJE D;  4C2M H;  1BDO A;  2Z4H A;  1RIP A;  3NBI A;  2HIX A;  4JBM A;  2EYM A;  4L63 B;  2MO0 A;  4YWM A;  5M3M B;  1VQ7 A;  4I7A A;  4IPG A;  3NK9 A;  2CW0 D;  2BE5 C;  3U4Z A;  1VQ6 A;  3RN5 A;  1ET6 A;  2KOL A;  3K6O A;  5A35 A;  1YIT A;  1YJW A;  2Q2H A;  3U50 C;  1A62 A;  2EYJ A;  2Q8T A;  1E2Z A;  4A3F G;  1JCK B;  3Q8D A;  2X69 A;  5CV8 A;  4L5Q A;  2VW9 A;  3I73 A;  1UE1 A;  2UXB Q;  2KJX A;  2BOS A;  1J9O A;  4FYD A;  3WOF A;  1KDA A;  5LMN W;  2ZM6 Q;  3OOC A;  4C3J B;  5H1S E;  1BXT A;  1LO5 D;  1U4P A;  3FEW X;  3D31 A;  2E76 C;  3ULJ A;  1U4L A;  4EGV A;  5M9O A;  4K5W A;  4X64 Q;  3I4N G;  4A3M G;  2PNR C;  1Q8I A;  1KLG D;  1HFN A;  4HJ9 A;  1HNW Q;  1JB3 A;  2JYO A;  1SLJ A;  5FJ8 G;  4GN3 B;  4PZ8 A;  1SRU A;  2C5C A;  2DUD A;  4LUZ A;  5KIX A;  1VQL A;  3J80 i;  4I7Z C;  4A3D H;  1FJG Q;  1WTQ A;  2SDF A;  4XXE A;  4TSS A;  4OEL B;  1KDB A;  1FGU A;  3RZO H;  2QDB A;  4OX9 Q;  1YNN C;  5IYC H;  2IWH A;  2YU9 B;  2PO4 A;  1NY4 A;  4C3H B;  2O5J C;  5EPL A;  4A93 G;  4K5V A;  3RZO B;  1S5B D;  1H9K A;  2ZXR A;  5IYC G;  3S2H H;  1BBU A;  4A3D B;  3E3X A;  5HUR A;  2X6L A;  5EKL A;  1A3T A;  4LW1 A;  1DZ1 A;  4LWC A;  4DV6 L;  3NEL A;  1GXD C;  1I50 H;  4P71 A;  1CM9 A;  4RGN A;  2Z8L A;  3NEM A;  1EY6 A;  1K8G A;  4C56 C;  1EIY B;  3UE0 A;  1XPO A;  3HOW B;  4A3J B;  1N33 L;  2H5X A;  3PO2 B;  2I46 A;  1G51 A;  4NKL A;  3E0E A;  5JOB A;  4JI8 Q;  3TN2 A;  2R92 H;  2NZH A;  4HAE A;  3SK8 A;  2G9H D;  2JA7 G;  3PSI A;  2JE6 I;  1DOK A;  4NXN L;  2BE5 D;  3ULP A;  1O78 A;  1GUS A;  4H7B A;  3RUZ A;  2XGT A;  4DR7 L;  2ZJR A;  3RD4 A;  1AEX A;  4O42 A;  2B2T A;  1VDZ A;  2DGY A;  4GOP A;  3RZD B;  1S72 A;  3NPP A;  5M3F H;  1RKN A;  1ZYR D;  3NXW A;  4CKB A;  1MKH A;  3Q23 A;  3DUZ A;  3EJI A;  5M3M H;  4HCE A;  1CTM A;  4KHZ A;  3KFU A;  2NYZ D;  4JV5 Q;  4HR7 B;  3W5O A;  3UI2 A;  2RF4 A;  2UUA Q;  1TS4 A;  1WCM G;  3OW2 A;  4C3I H;  4K5X A;  5I9O A;  4ZKB B;  1BOS A;  1HZA A;  1XX8 A;  3K7A B;  4P73 A;  1ILP A;  4DXF A;  2E5L Q;  3M85 A;  4DV2 Q;  3FKI B;  3ICE A;  4DFA A;  1E2W A;  4GS3 A;  3CQZ B;  4PQX A;  1STB A;  1I50 B;  3B6Y A;  1QUQ B;  3K5L A;  1M1K C;  1LTT D;  3I70 A;  4I65 A;  1XPR A;  4IUR A;  3FPU B;  3M4O H;  1C9O A;  2MO1 A;  4YY3 Q;  1SFO H;  1IW7 D;  4EQO A;  4A75 A;  4M1U B;  3L2P A;  3S2H B;  4IJH A;  1JJC B;  2F0V A;  2VQF L;  1O7Z A;  4OL7 A;  4C3J G;  1STH A;  1JE5 A;  4KY7 A;  1PRT C;  5IGC A;  3S14 B;  2K14 A;  2K5Q A;  5CV4 A;  3CCJ A;  5E7N A;  4DR2 Q;  1EOV A;  4IPH A;  1DCZ A;  2F1M A;  3GTL H;  4ID6 A;  2MJ8 A;  4A3M B;  3HZX A;  5EPK A;  3T53 B;  3OSO A;  1L0W A;  2K52 A;  3H6M A;  1IYV A;  3PUX A;  4KTA A;  2F0D A;  4RGO S;  4P72 A;  1BCP D;  3QOL A;  2NZ1 D;  4KY6 A;  3SR1 A;  1JQY D;  3CRL C;  2E75 C;  3SDZ A;  2VQE L;  4B3T Q;  2A69 D;  3HOV G;  2NB0 A;  1S5E D;  5C3X A;  4L5R C;  2JA9 A;  2YTV A;  3SE0 A;  5DNF A;  1EY7 A;  1Q8K A;  3MFY A;  2JA6 G;  3I7F A;  1N32 Q;  2FHT A;  4WJ3 M;  2I0Q A;  1X9N A;  3HRZ C;  4XTC S;  1VMP A;  1XXG A;  3NTI A;  1TWC B;  2F0J A;  5M5W H;  1GD7 A;  5C4X H;  2NVX B;  1L0X B;  4JYA Q;  2VZA A;  4ALP A;  1HQR D;  4N8F A;  3D4W A;  1K8O A;  1XMO L;  4X6A H;  3J81 i;  1IBL L;  4DV1 Q;  2F0H A;  5JVH 3;  4HID A;  1GM5 A;  1RL2 A;  1EIF A;  4DK0 A;  3EA6 A;  1TWH B;  4LUO A;  1HXY D;  4AQY Q;  4H13 C;  4RKL A;  3T1Y L;  3PF5 A;  1YVC A;  4BY7 G;  1Y1V H;  3PIP 3;  3PIP A;  4C3H H;  5IWA L;  1PVO A;  2RVL A;  1TWF H;  3MXN A;  4PMW A;  2R7Z G;  4OO1 G;  2B2Y C;  1HFG A;  4LFB L;  1XJV A;  5J1Z A;  3PO2 G;  1LUZ A;  4O0A A;  1E24 A;  1JWS D;  2PZT A;  5T1I A;  5G3L F;  5CBE E;  5I9P A;  1HHV A;  1HZC A;  1XNQ Q;  1SBB B;  4HN7 A;  4DNI A;  4GKK L;  3BVZ A;  4FF3 A;  1EYC A;  4CDD C;  5CR3 A;  5TSS A;  2AQ3 B;  1AE3 A;  2F3V A;  5EBD A;  2OQ0 A;  4DR6 Q;  4H44 C;  5A2Q L;  3CXC A;  3FHW A;  3T1H L;  2A1A A;  3CCE A;  3CRK C;  4X65 L;  4DUZ Q;  4YHH L;  5T1G A;  1PXU A;  3FVQ A;  2L5T A;  1LAC A;  1AP0 A;  1T9H A;  3J80 L;  1KHI A;  4GN4 B;  2YTX A;  4LJZ C;  1TVX A;  3S9W A;  1UEA B;  2F0M A;  1C7Y A;  4DUZ L;  1WD0 A;  1BR9 A;  4OON A;  5JAV A;  5FOB B;  3EVQ A;  5JEA J;  3N52 A;  2QF7 A;  3BDL A;  2QEJ C;  4RWS C;  1K3R A;  5C0X G;  4POG A;  1STY A;  4EQ5 A;  2IY5 B;  1F2Y A;  2ZTD A;  2EVB A;  2MQH A;  4JC0 A;  2TMP A;  5I4D A;  2D62 A;  2WAQ G;  4B3M L;  4DV0 L;  1WTH A;  4R9W A;  2DNE A;  4RHR A;  2DJG C;  4P2C B;  1Y8O B;  1LTA D;  4Y52 H;  2O5I C;  4CDF C;  3OHX C;  3RR5 A;  1JMC A;  1B8A A;  2GA4 B;  2G5D A;  4NPS A;  1X3E A;  1N36 Q;  3NTH A;  2EOT A;  4TKO B;  5DM6 3;  2YYZ A;  1HH2 P;  2A6E C;  2NN6 I;  1IBK Q;  3PO3 H;  1KTK A;  3R8B A;  3KF6 B;  3CC4 A;  3KLS X;  1PYB A;  5C3E G;  4LF7 L;  3HOX B;  1WYD A;  2V1C C;  3E0J A;  1EEI D;  3T16 A;  2CQA A;  2NN6 H;  3K0Y A;  4RGT A;  1VQN A;  1VQK A;  3L7Z C;  4HJ7 A;  1PFN A;  1GJX A;  4UAI A;  3KUP A;  3F2D A;  1Q1E A;  3T51 B;  3TRE A;  2F0T A;  2JA5 H;  4UPA A;  4BY1 H;  1NJI C;  4DR2 L;  1BVS A;  4FDB A;  4OXP A;  2ZTC A;  3QO2 A;  2HDM A;  1KC8 C;  3TRZ A;  5D3I B;  2L12 A;  3NQT A;  1XMQ Q;  4LF8 L;  1U5K A;  1K8M A;  3ND9 A;  3GO5 A;  3NBH B;  1X3P A;  5G3L D;  4Q5V A;  5IYB G;  1B3Q A;  3W1G A;  4A3K B;  2DJF C;  1EQT A;  2EY2 A;  2OCE A;  2XRQ D;  4X66 Q;  3K5M A;  4OWX B;  4DA2 A;  1EZ8 A;  1AN8 A;  2IL8 A;  3S15 B;  2WIN B;  4RAU C;  3OIQ A;  4DR5 L;  1GUN A;  3J7A 5;  1EY9 A;  1QVC A;  3MXU A;  1LV9 A;  1JC7 A;  3VR2 A;  3CCL A;  3IFT A;  2F0E A;  1TWF B;  3SK4 A;  4DXG A;  4IUQ A;  4QMG A;  4OX9 L;  4A3G H;  2NZO A;  2NVQ B;  3G6E A;  1STN A;  2AWO A;  4XIG S;  1IW7 C;  1Y8N B;  4RCN A;  2AHO B;  5IWA Q;  1SFO B;  1RF2 D;  3SXH A;  4ABN A;  3M7N A;  5IIF A;  2EJM A;  2R3Z A;  1VQ9 A;  3TBI B;  1F2L A;  1PTO F;  1WTW A;  1LAB A;  3RMH A;  1X32 A;  3URY A;  4R8N A;  4XYO A;  1NCV A;  4DR1 L;  1XTC D;  3OMC A;  5C3E H;  1FR3 A;  1K8A C;  2ICE C;  4ME3 A;  5FLM H;  4FP5 D;  4Z9C B;  4NMZ A;  4R4O A;  3ER0 A;  2EIF A;  4DV6 Q;  2FIN B;  3PUZ A;  2D2C C;  2L4N A;  2UXD Q;  4JI5 Q;  1J5E Q;  3DMU A;  5FJ8 H;  4LFC Q;  4HTH A;  1O7I A;  3FDT A;  2OEO A;  1ZXT A;  3L9A X;  1VQG A;  5CC4 A;  1TWA H;  1Y69 U;  4B3M Q;  1D1I A;  3EN2 A;  1EIH A;  1IL8 A;  4JOI A;  2KVM A;  2R61 A;  4R1J A;  4LFC L;  2PPB C;  4PMB A;  2WP8 J;  4CKE A;  2UXC Q;  2LY7 A;  4NXN Q;  4QIW E;  1PH9 A;  1G2S A;  3JC6 6;  4AQY L;  3J81 E;  2WB1 E;  1SRO A;  3STB D;  3R3O A;  1UWV A;  2K33 A;  1I3Q H;  3MXG A;  1PDQ A;  1X6O A;  2UXC L;  2CWP A;  1DYQ A;  2CH4 W;  1II3 A;  1PA6 A;  1CSQ A;  3NBH A;  1ENA A;  3CCV A;  3IFD A;  1K83 H;  1Q12 A;  2EQS A;  1QB5 D;  2PQE A;  3VR3 A;  1K28 A;  1EYA A;  3K7A H;  2UUB Q;  1QZG A;  5KEE A;  1Y1W B;  3I8Z A;  3A8I E;  1WOC A;  1S5F D;  2IX3 A;  4DAY A;  4QF4 A;  2EJF C;  1RJT A;  3MTS A;  2IJ0 A; 
#chains in the Genus database with same CATH homology
 3SGI A;  2K5H A;  4IOA A;  4AIM A;  2I5L X;  3A74 A;  5IP7 G;  3T1H Q;  2HT1 A;  1Y14 B;  5IYC G;  1BBU A;  4HJ5 A;  4JI7 Q;  3S2H H;  4JYA L;  4DAM A;  2ID0 A;  1MJC A;  5FLM G;  1CKN A;  3GTQ H;  4DV4 Q;  4OWT B;  2GVB A;  2IX0 A;  1TWG H;  1E22 A;  1VQF A;  2ALY B;  3AQQ A;  5C0X I;  4LW1 A;  4JCV E;  1M90 C;  3CPF A;  4LWC A;  1PV4 A;  2LXJ A;  3S1N H;  4DV6 L;  4DV5 Q;  3STB C;  3GTM H;  2R6G A;  3MEF A;  3NEL A;  4PG3 A;  1KXL A;  1B7Y B;  1I50 H;  4P71 A;  3S1Q H;  3NEM A;  2R7Z H;  3CCM A;  2UUA L;  1K8G A;  2RHQ B;  1TWC H;  3S1M H;  4K0K Q;  1GVP A;  4GNX A;  1EIY B;  3NEN A;  3UE0 A;  2IHF A;  1YI2 A;  1XPO A;  4A3C H;  1CKO A;  3J7Z C;  1N33 L;  4NXM L;  1QZH A;  2NVT H;  2H5X A;  4A3J H;  3HOU H;  2VY3 A;  3HOV H;  1X54 A;  3CW2 C;  3K80 C;  3S17 H;  1OXT A;  2I5M X;  1VQ4 A;  3G4S A;  3KJO A;  1E1O A;  1FVI A;  1Q82 C;  3H3V H;  1OXV A;  2LXK A;  2D0P A;  4H02 A;  1G51 A;  2Q2U A;  3E0E A;  4JI8 Q;  4A3E G;  5GAH C;  4PZ7 A;  2R92 H;  2NZH A;  1YHA A;  2JA7 G;  2Q2I A;  1JJG A;  3PSI A;  4JI2 L;  2JE6 I;  2ATW A;  4NXN L;  4DUY L;  3ULP A;  4AYB E;  4DV2 L;  4DAY B;  1E3P A;  4GLV B;  1N34 Q;  4DR4 Q;  2XGT A;  1SE8 A;  4DR7 L;  2ZJR A;  1X55 A;  1HNZ Q;  4P75 A;  1Q81 C;  1AH9 A;  1Y1W G;  1VQO A;  1HR0 Q;  2DGY A;  4GOP A;  1S72 A;  2R7D A;  4GKJ Q;  2VQE Q;  1V43 A;  3M9B A;  4BBR H;  5M3F H;  4JI4 L;  1MKH A;  2NVY H;  5C44 H;  5M3M H;  4A3J G;  1I94 L;  2ES2 A;  4IFD G;  3KFU A;  4KHZ A;  1Y1V G;  1YNX A;  2HHH Q;  3DLL A;  1D8L A;  3H3V I;  3PV0 A;  4JV5 Q;  1YJ9 A;  3K8A A;  3PCO B;  3W5O A;  3F2C A;  4HJ8 A;  2RF4 A;  2UUA Q;  1YBY A;  1WCM G;  4JBJ A;  4JI5 L;  5LMN Q;  4C3I H;  3OW2 A;  3TS0 A;  3CMA A;  1CUK A;  1HZA A;  3PUV A;  2QEX A;  1YEZ A;  2VL6 A;  4P73 A;  4PZ6 A;  2E5L Q;  4DV1 L;  3M85 A;  2VUM G;  4JI1 Q;  5C0X J;  4DV2 Q;  3A5U A;  2K75 A;  4EX5 A;  3ICE A;  3H15 A;  5BR8 L;  1X3G A;  1X3F A;  2F4V L;  4GS3 A;  3GTG H;  1P16 A;  1PYS B;  1YHB A;  3B6Y A;  1QUQ B;  2UXD L;  2Z0S A;  4IFD J;  4JI8 L;  1M1K C;  4A3L H;  1KD1 C;  4IFD I;  3F1Z A;  1XPR A;  4O2D A;  1DGS A;  3CF5 A;  4POF A;  5GRO A;  5C4J H;  1H95 A;  3M4O H;  1C9O A;  2MO1 A;  1X56 A;  4YY3 Q;  1YIJ A;  4BA2 I;  3JAM c;  1SFO H;  4GNX B;  4JBM A;  2ZTE A;  4YWK A;  4A75 A;  3S16 H;  3L2P A;  3CC7 A;  1KIX A;  1UE7 A;  1N32 L;  1J5E L;  3TS2 A;  1Z47 A;  2C35 B;  1JJC B;  4IJH A;  4DV4 L;  4A3K G;  4MZ9 A;  2UXB L;  2VQF L;  3CCS A;  4K0K L;  5IY0 A;  1V9P A;  1JE5 A;  1G6P A;  2K14 A;  2WAQ E;  5BR8 Q;  1PH4 A;  1CKN B;  1V1Q A;  3CCJ A;  2IX1 A;  4BBS G;  1WFQ A;  5E7N A;  1K0R A;  4DR2 Q;  1EOV A;  1BKB A;  4IPH A;  3D0F A;  3PGZ A;  4A3G G;  2XTI A;  2B63 H;  4X66 L;  3GTL H;  5HGQ A;  1S40 A;  1X65 A;  2YV5 A;  1L0W A;  5M5Y H;  2K52 A;  3S24 A;  2K50 A;  1JJ2 A;  3PUX A;  1CSP A;  2CFM A;  4P72 A;  4X65 Q;  4LFA Q;  2VQE L;  2PMZ E;  4B3T Q;  3KDF A;  3HOV G;  4L5R C;  3HOY H;  2B63 G;  4JI6 Q;  2JA9 A;  2PQA A;  5IE8 A;  2YTV A;  1XPU A;  4DR7 Q;  1N34 L;  1L1O A;  1Q8K A;  2RCN A;  2JA6 G;  3I7F A;  4TQU S;  1N32 Q;  4JI7 L;  1A0I A;  4BY7 H;  2N78 A;  4LNQ A;  1PH8 A;  4GKJ L;  2I0Q A;  4WJ3 M;  1X9N A;  3A0J A;  4XTC S;  5IT9 c;  5JJK A;  4BBR G;  5M3F G;  1UE6 A;  5ELO A;  2OQK A;  3PUW A;  4BA1 I;  2K5N A;  4QGU A;  4IO9 A;  5M5W H;  4LF9 Q;  3F8T A;  1GD7 A;  5C4X H;  1NMG A;  2ZJP A;  1Q7Y C;  5M5X H;  2VZA A;  4YCW A;  1EYG A;  3S2D H;  4YCV A;  4ALP A;  3AEV A;  4JYA Q;  1VQP A;  1HZ9 A;  1Q46 A;  5M3M G;  1XMO L;  4X6A H;  3J81 i;  1TXY A;  1B70 B;  1IBL L;  4DV1 Q;  1QVF A;  4YCU A;  4HID A;  1IYJ B;  1GM5 A;  1RL2 A;  1EIF A;  1S3O A;  4LF6 Q;  4LUO A;  2NVX H;  1PH2 A;  4AQY Q;  3T1Y L;  3PF5 A;  3HFZ B;  1XNQ L;  3RN2 A;  1YVC A;  1G29 1;  1EFW A;  4BY7 G;  4OWW B;  1BBW A;  1JB7 A;  4OO1 I;  3FP9 A;  1Y1V H;  2JQO A;  3G48 A;  4GLA C;  3PIP A;  4J15 A;  4C3H H;  2RHS B;  4DK3 C;  5IWA L;  4LF5 Q;  1K73 C;  2BH2 A;  1PVO A;  4X64 L;  1LM0 A;  4DR1 Q;  4YY3 L;  1TWF H;  3EBE A;  4PMW A;  2R7Z G;  4OO1 G;  5LMU Q;  1VQM A;  1GO3 E;  4DV0 Q;  4JI3 Q;  4HJA A;  2KCM A;  4LFB L;  4QQB X;  1XJV A;  4KHP L;  5EAY A;  3PO2 G;  1EUJ A;  1KAW A;  1LUZ A;  3I4O A;  2N49 A;  4GLX A;  4O0A A;  1VQB A;  2QGQ A;  1E24 A;  3I2Z A;  4LF5 L;  2Q2T A;  5C44 G;  2MNA A;  1PH3 A;  1XNR L;  3M3Y H;  4UP8 A;  1XTD A;  4LF6 L;  2PQA B;  1JT8 A;  1HZC A;  3EIV A;  1XNQ Q;  4MTN A;  2E2I H;  1PH6 A;  1ASY A;  3E9I A;  4P74 A;  4BBS H;  4A4I A;  4DNI A;  1FJG L;  4GKK L;  2VQF Q;  4R4T A;  1VQ8 A;  1IBK L;  2E2J H;  4A3L G;  5IP9 H;  1AE3 A;  1VQ5 A;  1VQD A;  3S14 H;  2OQ0 A;  5HY6 A;  2L15 A;  4A3B G;  4DR6 Q;  1VQI A;  3CXC A;  3FHW A;  3T1H L;  4JV5 L;  5IYD H;  2A1A A;  3CCE A;  3W1B A;  3PO2 H;  3GD7 A;  4X65 L;  1VQE A;  1SMX A;  4DUZ Q;  4WJ4 A;  4YHH L;  3LGJ A;  1FL0 A;  2I5H A;  4UP9 A;  3CCR A;  3RNU A;  1QUQ A;  4A3F H;  3I56 A;  4A76 A;  3J81 j;  2B3G A;  3BZC A;  4DR3 Q;  4L5S A;  1HNW L;  4BY1 G;  2R7F A;  4DV3 Q;  1LTL A;  4UP7 A;  4LF8 Q;  1N9W A;  1T9H A;  3HKZ G;  1KHI A;  2WB1 G;  4GN4 B;  4KLK A;  2YTX A;  3HOX G;  1HNX L;  1L1O C;  1C7Y A;  4DUZ L;  4A3I G;  1ASZ A;  4GKK Q;  4OON A;  3CAM A;  5IP7 H;  5JEA J;  3CQZ H;  3OYY A;  1N33 Q;  2F3I A;  3ULL A;  4DR6 L;  1K3R A;  3U4V A;  2JA6 H;  3KYH C;  5C0X G;  4LF4 L;  2KHI A;  4KI0 A;  4RMF A;  4EQ5 A;  2UU9 L;  4POG A;  5C4X G;  4HIM A;  3RLF A;  2B29 A;  3HKZ E;  3HOX H;  4GNX C;  4A3K H;  2OTL A;  3HKS A;  4DR5 Q;  2ZTD A;  2CKZ B;  4B3S Q;  3HOY G;  1HJP A;  2IY5 B;  2CWA A;  2K5V A;  1LYL A;  2MQH A;  3L0O A;  3JAM i;  2R92 G;  4BXX H;  4JC0 A;  1E7Z A;  3I55 A;  3UDI A;  2D62 A;  2WAQ G;  3CME A;  1YZ6 A;  3IRB A;  2HIV A;  3AFQ A;  4B3M L;  1OXX K;  4QY7 A;  4JI3 L;  4DV0 L;  4DPG A;  4LF7 Q;  4UY8 C;  3PUY A;  2R93 G;  2AMC B;  5JEA G;  4QL5 A;  5LMN L;  4Y52 H;  2OTJ A;  2N3S A;  3RZD H;  4IJL A;  3RR5 A;  2A8V A;  1JMC A;  2HHH L;  5LMU L;  1OXS C;  1B8A A;  1W2B A;  1E1T A;  1VQA A;  1IZ6 A;  4LFB Q;  3OTO L;  4NPS A;  4GN5 A;  2QA4 A;  1EQR A;  1X3E A;  1N36 Q;  1UEB A;  4R4C A;  2LSS A;  2A19 A;  4B3R Q;  2GVA A;  2YYZ A;  1HH2 P;  2NN6 I;  1HZB A;  2KBN A;  1IBK Q;  1QVG A;  3PO3 H;  2UUC L;  2F4V Q;  3KF6 B;  3U58 A;  3CC4 A;  2NN6 G;  1PYB A;  5C3E G;  4LF7 L;  1IL2 A;  2N8N A;  2JK8 A;  1WYD A;  1NE3 A;  2NVQ H;  1KL9 A;  1KRS A;  2V1C C;  3G71 A;  1K9M C;  5FLX c;  3ERS X;  5AJ3 L;  5GAG C;  1VQN A;  2E5L L;  3L7Z C;  4HJ7 A;  1VQK A;  1XNR Q;  3TQY A;  1IBM Q;  2KEN A;  2UUC Q;  3F2D A;  1WJJ A;  1I6H H;  3F2B A;  4DV7 Q;  4DV3 L;  2JA8 G;  3S1R H;  1NBW A;  1Q1E A;  3UE1 A;  3TRE A;  1R9T H;  2JA5 H;  1OXU A;  4UPA A;  2PNH A;  4BY1 H;  1D7Q A;  1NJI C;  3FKI G;  4DR2 L;  5JJI A;  3KF6 A;  2EXD A;  1BVS A;  4IPD A;  4YHH Q;  4FDB A;  4OXP A;  5AJ3 Q;  4GOP C;  2D0O A;  1I94 Q;  2JEB I;  2ASB A;  2ZTC A;  3TRZ A;  1KC8 C;  1L2F A;  4DR4 L;  3H0G G;  3TEH B;  2CCZ A;  1C0A A;  1XMQ Q;  3J80 c;  4LF8 L;  1U5K A;  1EWI A;  2OWO A;  2JJQ A;  2Y0S E;  2PI2 E;  3GO5 A;  3NBH B;  5IYB H;  3KOJ A;  1EQQ A;  3GTJ H;  2VUM H;  1Y1W H;  4JBW A;  2YU9 H;  5IYB G;  3W1G A;  1U0L A;  3M4Q A;  1HNZ L;  4A3D G;  5DLQ E;  4R4I A;  2AKW B;  1A63 A;  4DKA C;  1WI5 A;  1J6Q A;  4B3S L;  3GTO H;  4YWL A;  1UE5 A;  3KF8 B;  2OCE A;  3MXN B;  3CCQ A;  2Z6K A;  3GDE A;  4X66 Q;  1OTC A;  1VS0 A;  4OWX B;  4JI6 L;  4A3M H;  3GTK H;  3KJP A;  2KHJ A;  4Y7N H;  3CP0 A;  1MJE A;  4DV5 L;  2HQL A;  4DK6 C;  2E8G A;  4IOC A;  3BJU A;  4A3I H;  4DR5 L;  3UDX A;  3DM3 A;  3J7A 5;  5ELN A;  1QVC A;  3I4N H;  3CCU A;  1PH7 A;  3CCL A;  3HOW G;  5IP9 G;  2KCT A;  4A3C G;  4JI0 Q;  4OX9 L;  3PIO A;  4A3G H;  2NZO A;  2WFW A;  4DR3 L;  2JA7 H;  2JEA I;  3HOW H;  3G6E A;  3OTO Q;  3HOZ G;  3BZK A;  3K81 C;  1Z9F A;  2AWO A;  4XIG S;  1NTG A;  1YHQ A;  1XMO Q;  2BA0 A;  1PH1 A;  3HOZ H;  2AHO B;  5IYD G;  2ZJQ A;  5IWA Q;  4NXM Q;  1VQH A;  1GKH A;  4RG1 A;  2UUB L;  3M7N A;  4AYB G;  1VQC A;  2YTY A;  4MNO A;  1P8L A;  3WWV A;  3T1Y Q;  1PHJ A;  1VQ9 A;  1N36 L;  2VNU D;  1Q1B A;  1L1O B;  4R4Q A;  3CPW A;  4AH6 A;  4LFA L;  4HIO A;  2K4K A;  1IBL Q;  3RLN A;  4BXX G;  3FKI H;  4DR1 L;  1PH5 A;  2BA1 A;  4JBK A;  4C2M H;  1N8R C;  5C3E H;  1K8A C;  1NMF A;  2UU9 Q;  3ZJY C;  4ME3 A;  5FLM H;  3M4P A;  1RIP A;  3H0G H;  4TVA B;  4JI4 Q;  4B3T L;  4R4O A;  2PI2 A;  3VDY A;  3ER0 A;  2EIF A;  3K7U C;  2HIX A;  3AYH B;  4JI1 L;  1IXR A;  2VS1 A;  2MO0 A;  4DV6 Q;  3PUZ A;  3UDF A;  4YWM A;  2ZM6 L;  4X62 Q;  4HIK A;  3HOU G;  1VQ7 A;  2JA5 G;  1CKM A;  4IPG A;  5J3B A;  3UDG A;  2UXD Q;  1SN8 A;  4JI5 Q;  1TWH H;  2Z6K C;  1J5E Q;  1VQJ A;  5FJ8 H;  4LFC Q;  3CD6 A;  3U4Z A;  1VQ6 A;  1O7I A;  2JA8 H;  3RN5 A;  1VQG A;  1YIT A;  1YJW A;  2Q2H A;  1HR0 W;  2R93 H;  1TWA H;  3CC2 A;  4B3M Q;  3U50 C;  1A62 A;  3EN2 A;  4A3F G;  4LUV A;  3I4M H;  3Q8D A;  3K0X A;  4JOI A;  1HNX Q;  1HR0 L;  4L5Q A;  5GAD C;  3A5Z B;  2VW9 A;  4R1J A;  4LFC L;  1UE1 A;  2UXB Q;  1AE2 A;  1VCI A;  2WP8 J;  3AFP A;  5GAE C;  4C3J H;  2UXC Q;  4DUY Q;  4NXN Q;  4QIW E;  1PH9 A;  3J81 c;  4LF9 L;  5LMN W;  3RLO A;  4X62 L;  4JG2 A;  2ZM6 Q;  5H1S E;  4A3E H;  3JC6 6;  1MIU A;  2F52 A;  4AQY L;  2BH8 A;  3I4M G;  2WB1 E;  1SRO A;  1PFS A;  3STB D;  1UWV A;  3D31 A;  4IPC A;  2IHE A;  3ULJ A;  1KRT A;  3PF4 A;  4X64 Q;  1I3Q H;  1X6O A;  4JI2 Q;  4A3M G;  3KLW A;  3I4N G;  4QJF A;  2GN5 A;  2CWP A;  1IBM L;  2UXC L;  3S15 H;  4HJ9 A;  1HNW Q;  4DV7 L;  1SLJ A;  2E2H H;  5FJ8 G;  4LF4 Q;  2CQO A;  4GN3 B;  4PZ8 A;  1SRU A;  2DUD A;  1XMQ L;  4LUZ A;  1YJN A;  1PA6 A;  1CSQ A;  2AWN A;  3J80 i;  1VQL A;  3CCV A;  4A3D H;  3E9H A;  1FJG Q;  2Y0S G;  4APV A;  1K83 H;  1Q12 A;  1SR3 A;  2EQS A;  2FXQ A;  4JOI C;  4A93 H;  1FGU A;  4L5T A;  3RZO H;  1W3S A;  4JI0 L;  4OX9 Q;  3KDF B;  3K7A H;  1WCM H;  2UUB Q;  4NB3 A;  5IYC H;  4GOP B;  1QZG A;  3GTP H;  4A3B H;  3BU2 A;  1A8V A;  4KHP Q;  2MFI A;  1WOC A;  5JJL A;  5GQO A;  4B3R L;  2IT1 A;  1Q86 C;  1I5F A;  3PO3 G;  1NY4 A;  5K36 G;  1KQS A;  4A93 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...