2KHIA

Nmr structure of the domain 4 of the e. coli ribosomal protein s1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
b'WVAIAKRYPEGTKLTGRVTNLTDYGCFVEIEEGVEGLVHVSEMDWTNKNIHPSKVVNVGDVVEVMVLDIDEERRRISLGLKQCKANPWQQFAETH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 30S ribosomal protein S1
molecule tags Ribosomal protein
source organism Escherichia coli
publication title Probing the relationship between Gram-negative and Gram-positive S1 proteins by sequence analysis
pubmed doi rcsb
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2khiA00
2R7DA 5BR8Q 1XMOQ 3I7FA 5LMUQ 1PH1A 4QIWE 4NPSA 1YHQA 4JG2A 1IZ6A 4B3MQ 4C3IH 3Q8DA 1CKMA 2Z6KA 4A3LH 4DV3Q 2VQEL 2N78A 1AE2A 2N3SA 4X66L 3KFUA 2WAQG 5JEAJ 2IHFA 1YVCA 2YTXA 3K81C 3UDXA 4AQYQ 3PUXA 3G48A 3CPFA 2UUAQ 4LNQA 2OQKA 4BA1I 3HOWG 2VL6A 4BA2I 3E9IA 2A1AA 2VQFQ 3HOZG 1X56A 3CXCA 3PIOA 1RIPA 1K8AC 5C3EH 1NTGA 1OXVA 3I55A 2PQAB 3M9BA 3MXNB 4A3BG 2CCZA 2JEAI 2VUMG 3U50C 2YTYA 3A5ZB 3T1YQ 1UE7A 2E2HH 3G71A 5M5WH 1K3RA 3GTQH 3G4SA 4GLXA 4B3SL 1MIUA 1E7ZA 2NVYH 4H02A 3KF6B 4X65L 4BBRH 2WB1G 4KI0A 5M3MH 4B3SQ 1WCMH 2RHSB 1WYDA 4LUVA 1HR0L 5M3FH 3I4NH 4RG1A 5ELNA 2PNHA 5E7NA 3DLLA 2UUAL 2JA7G 1SRUA 1ASZA 4GKJL 3KDFB 3OTOQ 4DV0Q 3U4ZA 1KRSA 3PO2H 4A3CG 2ZTEA 1X6OA 4JI3L 1CSPA 1TWCH 1YNXA 4JI7Q 1VQDA 2UXCQ 5IYDG 3PV0A 4JOIC 1VQ5A 4DV4L 4X64Q 4YCWA 4DR6L 4GLVB 4UP7A 1EQRA 4JI3Q 1HZ9A 2JA8G 4JI0Q 2BH2A 4IFDJ 2LSSA 4GN4B 3KYHC 4GS3A 4XIGS 4JBWA 4JBJA 4HJ7A 1G51A 1PH2A 4DV0L 4JI0L 1IL2A 1YEZA 3GTPH 1WOCA 2K52A 3S16H 2E2JH 1HJPA 4GOPC 4A3KG 5C44H 2UXCL 2R6GA 4A3EG 1QVFA 1KC8C 2ZM6L 4LF9L 2HQLA 3T1HL 3MEFA 1I94L 1YHAA 4LFAL 3A5UA 5JJKA 4P73A 4OX9L 4JI5Q 1TWAH 4DUYL 4KHPQ 2R93H 1IBLL 5LMNQ 1J5EL 1OTCA 3UE0A 1N32Q 1UE5A 1CUKA 3A0JA 3PCOB 4YCUA 3AFPA 5IYCH 3PSIA 2UU9L 4BY1H 1XNRL 1U5KA 4DV1L 4DR1L 4PMWA 4NXMQ 1V1QA 1NJIC 4X62Q 4DV6L 3TRZA 4HJ9A 3T1YL 1OXXK 2PI2E 3RLNA 5ELOA 4KLKA 4POFA 1Y1WH 1QVCA 3S2DH 2F52A 1L0WA 2ES2A 4X66Q 2NVXH 3HKZG 1EIFA 4GNXB 1HZAA 3WWVA 4GOPA 1QVGA 2MFIA 4LF4L 4B3ML 3HOVG 4DR1Q 3BJUA 5M5XH 4NXML 2R92G 2UU9Q 1PYBA 1X3EA 1XMOL 1IYJB 1G291 3GTGH 3GTOH 2CFMA 3B6YA 4Y7NH 3K7AH 1Q8KA 3CP0A 4DV3L 1PFSA 4GN3B 3M7NA 3E0EA 5M5YH 3RZDH 4LFAQ 4DPGA 2KCTA 5GAHC 5IP7H 1T9HA 1I94Q 1A0IA 5LMUL 1BKBA 1P8LA 1SMXA 2VY3A 4JI2L 3PF4A 4IOAA 2IT1A 1HH2P 4IPHA 2IX1A 4QL5A 3W1BA 3UDIA 3KJPA 1QZHA 2R92H 1X9NA 1Z9FA 5DLQE 4BY7G 1KXLA 4JYAQ 1O7IA 1Q1EA 1Y1VG 2BA0A 4PG3A 3U4VA 3RN2A 4YY3L 1PVOA 4C3HH 4LF8Q 4YWKA 4B3TQ 3TQYA 3S1QH 1OXSC 2QA4A 3UE1A 2MQHA 3ULLA 1PH6A 4X64L 4DR6Q 4DK6C 2MO1A 1EWIA 3M85A 5J3BA 3L0OA 4LF5Q 1L1OA 4R1JA 2ZJQA 3S2HH 1MJEA 5IYCG 1VQ4A 3HOYG 2GVAA 1YBYA 4O0AA 1KIXA 2R7ZG 1Q12A 4A3FH 3PUWA 4LF7Q 2R93G 1EOVA 4IFDI 3UDGA 1VQNA 1SN8A 1XTDA 4IOCA 3NELA 4YCVA 1IBKQ 1W2BA 5FJ8G 1PH7A 4IPDA 1KRTA 1N32L 1J5EQ 1N36L 3GTKH 1Q82C 4EX5A 5HY6A 3CCRA 4KHPL 4RMFA 1CKNA 1YHBA 3PUZA 1Q7YC 2K5NA 4Y52H 3W1GA 2JA8H 1AE3A 5IYBG 3F1ZA 3ICEA 1VQLA 1KL9A 2HHHL 1SR3A 3TREA 1VQFA 5IWAL 3KOJA 2UXBL 3I2ZA 5IYBH 1EIYB 2PMZE 3RR5A 2ZTDA 2LXKA 2EQSA 4DV5L 4GNXC 1XPOA 1XMQQ 1BVSA 1K73C 3F2DA 4DUZL 1CSQA 4OONA 2VW9A 4IJLA 1VQ7A 2XTIA 2AHOB 4LF6Q 5FLMH 1V43A 1Q46A 3BU2A 5FJ8H 4PZ8A 1KAWA 5BR8L 4BBSH 3H0GH 1N9WA 2F4VL 4DR3L 2ATWA 2NVTH 1VQEA 1C0AA 4DV2Q 4A3FG 1VQ8A 4A3BH 1HR0Q 1WFQA 1NY4A 3HOYH 1I50H 3FKIH 2YTVA 5C3EG 3KJOA 1VQ9A 1SE8A 4JI4L 1EYGA 2CWPA 3HOZH 2PQAA 4OO1G 1GD7A 1XPRA 4HJAA 2UUBQ 2NN6G 2AKWB 2C35B 2B3GA 2I5LX 1Z47A 1K8GA 4WJ3M 1CKNB 1TWHH 1Y1VH 1FGUA 2ID0A 1E1TA 1PV4A 3AQQA 4BY7H 3E9HA 4APVA 1E1OA 3EN2A 1VQMA 1JT8A 3M4PA 3GDEA 3KDFA 4L5TA 3F2BA 2WP8J 1M1KC 3IRBA 4R4IA 1EUJA 1E3PA 5GQOA 4YWLA 2D62A 5JEAG 2JE6I 5IP7G 4OXPA 2CQOA 4JOIA 4LWCA 4P72A 2I0QA 3JAMc 2RCNA 2E2IH 4L5RC 3HOUG 1PH3A 5AJ3Q 3RNUA 3RZOH 2HIXA 1FJGL 1HR0W 4NXNL 3S14H 1LYLA 4MNOA 1D7QA 4HIKA 2Z0SA 4NB3A 3HOVH 1U0LA 2R7FA 4LUZA 4DR5L 1GM5A 4JI8Q 3CAMA 4IJHA 4OWXB 4JBKA 1FVIA 5GROA 1IBMQ 1XNQQ 2D0PA 3NEMA 5GAGC 1Y1WG 2NVQH 4DR4L 1SLJA 1LUZA 2K14A 4LUOA 4DV7L 3S17H 3CCUA 4P71A 2VS1A 1B70B 4IPGA 3KLWA 5IT9c 4B3RL 2Q2UA 1VQKA 1M90C 3CC7A 4JI8L 1VQAA 4DR7Q 4DR2L 4YHHQ 2CKZB 3FP9A 1EQQA 1N33Q 2Q2TA 1XPUA 3GTMH 3PGZA 3ZJYC 1HNXQ 2F4VQ 5C0XG 4DKAC 2IY5B 2N49A 3FKIG 1RL2A 3CW2C 4IPCA 1DGSA 3U58A 4O2DA 2L15A 3GTJH 4AIMA 1OXTA 3A74A 4DNIA 4JI6Q 2XGTA 2NZOA 4POGA 3TS2A 1H95A 1PYSB 1N34Q 5IY0A 3H0GG 4GN5A 1VQ6A 4BBSG 4GKKQ 1X54A 4A3EH 2BA1A 5FLMG 1XJVA 4A3KH 3VDYA 1PA6A 4QQBX 2KBNA 2HHHQ 2JJQA 5H1SE 1K83H 1HNZQ 2KHJA 2B63G 4GKKL 4AYBG 2QEXA 1A63A 3SGIA 4UPAA 3G6EA 4A3JH 1N8RC 3EIVA 3ULJA 4LFCQ 2EIFA 1PH8A 2MNAA 2UXDQ 5M3FG 1C7YA 1MKHA 1Q1BA 3K80C 2UUCL 1FL0A 3STBD 4A3CH 3GD7A 1CKOA 1A8VA 4JCVE 4L5QA 3AYHB 4JV5L 3JAMi 3PO3H 4A3GG 1JJCB 3AEVA 2QGQA 3OW2A 1VQPA 1L1OC 3I4NG 1WCMG 2MO0A 1LM0A 4P75A 2I5MX 1V9PA 3CC2A 4LF5L 4P74A 3J80c 1YJNA 3UDFA 3S15H 2R7ZH 2VUMH 1TWGH 5GADC 1W3SA 3CCSA 5HGQA 2OTLA 1JMCA 2I5HA 4JV5Q 1MJCA 1IBML 1XNQL 4LF8L 1HNWQ 4JBMA 4DV5Q 3ULPA 5C0XJ 1ASYA 4TVAB 3NBHB 2Y0SG 3I56A 3PF5A 1JB7A 3HOWH 2Q2IA 3CCJA 4DV7Q 4K0KQ 3KF8B 5C0XI 4EQ5A 1A62A 4NXNQ 2DGYA 4HIMA 4GNXA 2AWNA 3H15A 3F2CA 2Q2HA 1PHJA 1VQGA 3OYYA 4A3DH 4LFBL 1VCIA 3K0XA 1HNZL 4AH6A 1GO3E 5C4JH 3L7ZC 3CD6A 3S24A 4MZ9A 3M3YH 4BXXH 2HIVA 3NENA 5LMNW 1GKHA 4PZ7A 1S40A 3W5OA 1UEBA 3FHWA 1PH9A 1L2FA 1Q81C 2H5XA 1YJ9A 1N34L 1FJGQ 2VNUD 4JI1L 4JI6L 3J81c 4LF4Q 1X3FA 1NE3A 1S3OA 1E24A 3DM3A 3HOXH 1P16A 4YHHL 3RLOA 4DR2Q 4LFBQ 4FDBA 2B29A 2RF4A 2EXDA 2F3IA 2K4KA 4OWTB 3H3VI 2E5LQ 1I6HH 2A19A 2IHEA 1HZBA 4A93H 2OQ0A 1QZGA 3HKZE 4DAMA 2UUBL 4L5SA 1OXUA 1PH4A 3ER0A 1D8LA 4LW1A 4JI4Q 4A93G 1B8AA 5JJLA 4A3MH 1R9TH 3S1MH 3HKSA 2V1CC 1WJJA 1L1OB 2ZTCA 4C3JH 3CMAA 4DR5Q 4ME3A 3EBEA 1YJWA 4WJ4A 4IO9A 2OWOA 1WI5A 4BY1G 4DR4Q 2ZM6Q 2E5LL 3AFQA 4YWMA 4XTCS 2AMCB 5IP9H 4A3IH 4BXXG 2NN6I 4JI1Q 4A3DG 4DUZQ 1KQSA 2JA6H 4OO1I 2GN5A 1VS0A 4R4CA 1J6QA 2UUCQ 1K9MC 1VQBA 3PIPA 5C44G 3J7ZC 2HT1A 1G6PA 3BZCA 5IWAQ 5GAEC 2FXQA 4R4TA 4AYBE 4DAYB 4JI7L 3KF6A 2NZHA 3GO5A 1JJGA 1YITA 1UE1A 1PH5A 2BH8A 2JA9A 2K5HA 1XMQL 2IX0A 2K5VA 2Y0SE 3CF5A 4GKJQ 4K0KL 1X3GA 3D0FA 1N36Q 3I4MH 2ASBA 1JJ2A 3ERSX 1EFWA 5IYDH 4DV6Q 4PZ6A 1NMFA 1NMGA 2WFWA 4HIDA 3J81j 4DV1Q 4HJ8A 5C4XG 3HFZB 3CMEA 3CCMA 3PO2G 1HNWL 2JA5G 1VQJA 4J15A 3LGJA 2WB1E 4QJFA 4QGUA 2VZAA 2JA7H 4JI5L 3PO3G 4TQUS 4A3GH 4A76A 2D0OA 2JA5H 2PI2A 5M3MG 4QY7A 4BBRG 3GTLH 3CCEA 4LF9Q 1HZCA 1TXYA 4DK3C 2VQFL 1SFOH 1N33L 1QUQB 1Y14B 3M4QA 4LF6L 3I4MG 4DR7L 2ZJRA 2JQOA 1YI2A 2UXDL 4B3TL 4A3JG 1VQOA 5C4XH 4YY3Q 2JK8A 1K0RA 5K36G 1BBWA 3JC66 2VQEQ 3S1RH 2B63H 4DV4Q 2OCEA 2UXBQ 3I4OA 4LFCL 1B7YB 1KHIA 2CWAA 1VQHA 2AWOA 4IFDG 2KENA 1SROA 4JI2Q 3CPWA 1BBUA 2ALYB 4A4IA 1TWFH 2JA6G 4JYAL 1C9OA 3K7UC 3OTOL 4A3LG 2YU9H 3L2PA 3CC4A 2RHQB 3PUYA 3TEHB 1IXRA 3TS0A 4C2MH 1YIJA 1I5FA 4X65Q 4GOPB 1IBKL 1NBWA 3J81i 1LTLA 5AJ3L 4A3IG 4UP8A 1UWVA 5IP9G 4UY8C 1AH9A 3J7A5 3J80i 3RN5A 3D31A 2KHIA 1JE5A 4R4QA 1HNXL 4ALPA 3K8AA 5IE8A 2E8GA 3STBC 2A8VA 4MTNA 1QUQA 1E22A 4A75A 2KCMA 3F8TA 4LF7L 4AQYL 4A3MG 4OWWB 2YV5A 1KD1C 1X65A 3RLFA 2K50A 3H3VH 2GVBA 1VQIA 4B3RQ 3PUVA 1IBLQ 3HOXG 4R4OA 5EAYA 4X6AH 4X62L 1S72A 2OTJA 2WAQE 2LXJA 4GLAC 1GVPA 3T1HQ 3CCVA 4KHZA 2DUDA 1XNRQ 5FLXc 3S1NH 2ZJPA 4HJ5A 4JC0A 2N8NA 3BZKA 1I3QH 1VQCA 3CCQA 5LMNL 3CCLA 2Z6KC 5JJIA 4DV2L 1YZ6A 4UP9A 4DUYQ 3HOUH 4OX9Q 4HIOA 2K75A 3CQZH 4DR3Q 1X55A 3M4OH 1Q86C 1UE6A 2JEBI 2YYZA
chains in the Genus database with same CATH superfamily
1PH1A 4JG2A 1IZ6A 1CKMA 1HQRD 3NQIA 3O13A 2PMZB 5D3DA 1Y1VB 3QWNA 3SHLA 2IHFA 3K81C 3K6OA 4AQYQ 3G48A 3M7GA 5LHY1 2UUAQ 4LNQA 4BA1I 1U4RA 1EZ8A 4BA2I 3E9IA 4DNTB 3I72A 1RIPA 5A2QL 1JORA 3MXNB 2JEAI 1L0XB 3CHBD 1SFOB 3T1YQ 3GV6A 5J39A 5A35A 2NVYH 4X65L 2WB1G 4KI0A 3H0GB 3I4NH 1WYDA 4LUVA 4RG1A 4GKJL 3ZYYX 3KDFB 3OTOQ 3G7LA 1C8CA 3U4ZA 1X6OA 1NAPA 2UXCQ 4H44C 4YCWA 1BQQT 1IKLA 2JA8G 1MSGA 4JI0Q 2LSSA 4ME5A 4GN4B 4ZUJA 4JBWA 3UI2A 4HJ7A 1G51A 1PH2A 1IL2A 4FP5D 3GTPH 1RODA 2UXCL 4A3EG 1EWHA 3D4RA 3OMCA 4F88A 1KDAA 4HCSA 1I94L 4LFAL 1Y8NB 4P73A 4OX9L 3L3OC 1TWAH 2R93H 1WTWA 1UE5A 1CUKA 3A0JA 4EQPA 1YNND 3NTIA 4ZLTF 3IFTA 4CHTB 4DR1L 4NXMQ 1V1QA 3MC0B 1NJIC 2Z4IA 4WORA 1SE4A 5LL6X 4KLKA 2AUJD 1EIFA 2NB0A 4NP5A 4GOPA 4LF4L 1CA6A 2EY6A 4B3ML 1VMCA 4DR1Q 4NXML 2R92G 3K5OA 4A93B 3GTGH 1U9RA 2CFMA 2DY7A 1F9RA 2FHTA 3ITPA 5KEEA 1JR0D 1PFSA 2F0WA 1WTVA 2RVLA 4LFAQ 4DPGA 1I94Q 4KKTA 1RHPA 1BKBA 3PF4A 3BVZA 2Z4HA 3C46A 1PTOB 4IURA 4XQQA 3W1BA 2R92H 4BY7G 1B44D 2BA0A 3RN2A 4C3HH 1G8ZD 4YWKA 3TQYA 2BDNA 3I4LA 2MQHA 3UE1A 2X69A 4BBSB 1EWIA 3L0OA 1WCMB 2P5ZX 3KLRA 4N8FA 1VQ4A 2PW5A 3HKZB 2SNMA 4O0AA 3GTQB 2R93G 1EOVA 3HS0C 2R93B 3NSWA 1SN8A 4IOCA 2F1MA 1QCBD 3NELA 1IBKQ 2F3WA 5FJ8G 1KRTA 1J5EQ 3HOXB 3GTKH 2F0NA 4KHPL 1HQMC 1U4MA 3IL8A 5COYA 3X3NA 1TT2A 2EJGC 1Q7YC 2JA8H 2EYMA 1VQLA 2HHHL 3TREA 3FVQA 4C3IB 2PZTA 1PXUA 3EROA 3RR5A 4GNXC 1XPOA 1BVSA 1K83B 3F2DA 3BS1A 3LWUA 1TQOA 3K59A 2K1BA 3I91A 2EDGA 4DR3L 4BY1B 2ATWA 2NVTH 1Y8OB 2D9UA 4HAEA 4IUPA 2WIIB 4C3HB 5M5WB 1C0AA 1VQ8A 1HR0Q 4K8JA 2D2CC 1SE8A 3U9OA 4Q5VA 1AW7A 5EJWA 2PQAA 4OO1G 1DONA 4Z9CB 2UUBQ 2C35B 1FYCA 2EJFC 2EYFA 2E2JB 3FPUB 1Z47A 4KMUC 2XIWA 1CKNB 4G7HC 3WOFA 2ID0A 1PV4A 3E9HA 4ZYSA 1VQMA 5M5XB 1D5ZC 3GDEA 4XQJA 4L5TA 3F2BA 1DOMA 2EYOA 1M1KC 3VYUA 4YWLA 4BWGB 4OXPA 1PRTC 1D1IA 2F0TA 2M2LA 3D6CA 1PRTB 2Z8LA 1PH3A 2A74C 3S14B 1HR0W 1JOOA 2XVSA 2F0VA 3GP7A 1DM0B 4NB3A 3DWPA 4LUZA 4DR5L 3CAMA 1FVIA 1IBMQ 2NVQH 2VB2X 3QG1A 1LUZA 5G3LF 1RJTA 3PIP3 1B70B 1V8QA 4IPGA 1ILPA 1M90C 2L1BA 2G9HD 3HRZC 4AYBB 4JI8L 4E6IA 4DR2L 2CKZB 4J6HA 1EQQA 1A3UA 4CJ2C 2EOTA 5C5MA 3GTMH 3BVMA 3PGZA 1RDPD 3JAML 2B2UA 1HNXQ 4DKAC 1SYBA 1STNA 3H94A 1RL2A 4GZYC 3H09A 2L15A 3GTJH 2O5IC 1BCPD 4DNIA 2EZVA 2NZOA 1H95A 1K8OA 1GUSA 1EY7A 5CC4A 4GN5A 1VQ6A 3I4NB 4GKKQ 2BA1A 2EE1A 2AQ1B 5KNBA 1LABA 1PA6A 5H1SE 1HNZQ 2QEXA 1CFMA 4UPAA 3G6EA 1LT5D 1Z7TA 2A6HC 2PCFB 4FF4A 2Z9HA 4PQXA 2EIFA 1PTOH 3E5SA 3NQTA 5M3FG 1C7YA 1CKOA 1A8VA 4JCVE 3Q24A 4RA8A 4G7OC 5KNCA 1GUWA 2O4XA 1PTOD 1QILA 4PNYA 3NK9A 1PZKD 4OIKA 1LTGD 2CQAA 4KKSA 4P75A 1CZWA 3NBIA 3SVMA 1ZEQX 2VUMH 1TWGH 5GADC 2OTLA 1XNQL 4LF8L 1HNWQ 3WDNA 4TVAB 1JB7A 4NMZA 1V1PA 2CH4A 3KF8B 2H1EA 5IGFA 4NXNQ 4HIMA 2B63B 2AWNA 4LFBL 2K5WA 3K0XA 5C4JH 2OEOA 3S24A 3NTKA 4KY5A 2K04A 2DNCA 3QB3A 4PZ7A 1S40A 3FHWA 1PH9A 5C44B 2QEJC 1Q81C 4JI6L 3DM3A 3GQBA 2LS01 2B29A 4F8MA 2EXDA 4OWTB 5BN3A 3H3VI 2E5LQ 1LT3D 3KLSA 1STAA 2PPBC 4DAMA 1JWUD 2UUBL 4HSPA 3I8ZA 1D8LA 4LW1A 2X6GA 4RKBA 3K5NA 1B8AA 1M4VA 5JJLA 5HURA 4A3MH 1L1OB 3CMAA 4WJ4A 1WI5A 4K5XA 4DR4Q 1TR5A 2KECA 4OEMB 2E5LL 1CQFA 4YWMA 1SAPA 2PZWA 4A3IH 4BXXG 2R92B 2K32A 2J7ZA 1KQSA 4R8NA 5EKIA 2JA6H 1VS0A 3K5LA 1K9MC 5C4ZA 3T13A 2F0GA 1EFID 2FXQA 4R4TA 5E4WC 3J80E 2QKIC 5IODA 2K5VA 3HP3A 1N36Q 2NVXB 1H9SB 4M1UB 4DV1Q 1HNWL 3CMEA 2X6LA 3FMCA 1ILQA 3I73A 4K14A 4QGUA 4A3GH 1GUOA 4A76A 3GTLH 1HZCA 1CHPD 1XYIA 1IYVA 1YI2A 4A3JG 1GUNA 1GHKA 1MD2D 4KHVA 3N6RA 1KHIA 2KENA 1BBUA 2JA6G 1TWFH 3NUCA 1RTOA 3L2PA 1G91A 1UEAB 3CC4A 1FNWA 3WOEA 3E3XA 3OSOA 1H9SA 1YIJA 2IX3A 4X65Q 1Y8PB 3J81i 5AJ3L 1H9JA 2HQEA 4MTKA 1IHZA 1I4XA 3J80i 1BUVT 3T16A 4S3SA 1JE5A 1HNXL 1EYAA 4OELB 2A8VA 1SJHD 3LWEA 4B9XA 1KLGD 1A3TA 4A75A 5ELEA 5CV6A 1F9QA 4U68A 1HTPA 1Y69U 4R4OA 1S72A 2OTJA 2LXJA 4GLAC 4KHZA 1F9PA 4A3EB 2N8NA 1LTSD 1R9TB 3CCLA 2RDHA 2Z6KC 4DV2L 3RZOB 3HOUH 1A15A 3EFXD 2KEEA 1X55A 1D5MC 2F0FA 1Q86C 2L12A 1EEID 3W2DA 4HEDA 1PLFA 4C3IH 1I6HB 2Z6KA 2PQEA 1AE2A 2F03A 3KFUA 4KD4A 3NWSA 4NKLA 1JWSD 1RD9D 2F0UA 1YVCA 1JCKB 1SYDA 3HOWG 2VL6A 4CKCA 3HOZG 1X56A 3CXCA 2JSOA 4PMBA 2C9OA 4RGTA 2WAQB 2SOBA 2YTYA 3U50C 1UE7A 3G71A 1K3RA 1O80A 4B3SL 5FO7B 1MIUA 1E7ZA 4H02A 1XWEA 4DAVA 3KF6B 4ZCKA 5M3MH 2EYJA 1WCMH 3AU7A 4ZUIA 1HR0L 5M3FH 5ELNA 1H9MA 4A3MB 1ASZA 1F2ZA 5FO9B 1TWGB 1ENAA 3PO2H 3NPPA 4JI3L 1CSPA 1TWCH 1YNXA 1VQDA 3PV0A 1EEFD 2F0LA 1SYFA 4GLVB 1BDOA 4NDXA 1I4GA 1ICWA 2EVBA 1HFGA 3MHBA 3TP5A 2Y0SB 4ID6A 4V190 2MUYA 3S16H 1WOCA 1GUTA 2K52A 3KF8A 5CV4A 1HJPA 4GOPC 2MJ8A 4X3KA 2IW3A 2R6GA 2ZM6L 4ZKCB 4LF9L 1W6KA 3T1HL 2Q8IB 2JN4A 3MEFA 2A68D 4QUFA 5EQ0A 3HOYB 4KHPQ 5I9PA 4YCUA 1BO0A 4X62Q 2RQXA 1B50A 4HMJA 3RLNA 1KNAA 5ELOA 3EJIA 3V2TA 2R7ZB 2QDBA 2F52A 5DAUA 1L0WA 2ES2A 3SR1A 4CDEC 5E3FA 4GNXB 4BS9A 1QVGA 3BJUA 1PZID 2UU9Q 1D1KA 1FGBD 3B6YA 1Q8KA 3M7NA 3E6ZX 2G9DA 2KCTA 5GAHC 3NP8A 1A0IA 3T51B 1SMXA 5I4DA 4IOAA 1TS3A 2IT1A 5DEHA 3GTGB 4QL5A 4A3IB 1O7YA 2BE5C 4JYAQ 2ICEC 2L5TA 3I90A 3RD4A 2F3VA 4G4KA 4LF8Q 3S1QH 2G5DA 4X3TA 2B8GA 4X3UA 2QA4A 1PH6A 2WKCA 2HDMA 1SE3A 2MO1A 1F9SA 1X32A 2KCNA 4LF5Q 1KNEA 4R1JA 2ZJQA 3HEJA 1WTRA 2NVYB 4H0LC 2GVAA 3P75A 2R7ZG 1I4PA 4EVOA 3PUWA 2E2HB 1XXGA 3UDGA 5C3EB 3CRKC 3VA5A 1SYEA 4RFBA 2XRQD 5FKAC 5T1IA 3C1FA 3SK6A 4EX5A 3CCRA 4RMFA 3C3LA 1EQTA 4DGZA 4Y7NB 3MA2B 2K5NA 4PV1C 4IUVA 1SMYD 1KL9A 1VQFA 5IWAL 2UXBL 5C5LA 1K73C 5EGTA 4DUZL 1SYCA 3RUZA 2VW9A 1PRTF 4IJLA 1VQ7A 1PYWD 2XTIA 5FLMH 1WTXA 5FJ8H 4BBSH 3H0GH 2F4VL 2VUMB 4J1MA 3HZXA 1S5DD 4A3BH 1WFQA 2YTVA 5C3EG 3KJOA 2K5DA 4JI4L 1EYGA 3T4AC 3GTMB 3VR6A 1GD7A 5JVG3 4HJAA 4FXDA 2WV6D 1VF5C 5FLXL 3RZDB 2B3GA 1TWHH 1QNUA 1BBXC 4BY7H 3M4PA 2A6EC 3KDFA 1E3PA 1EUJA 2HUGA 1V1OA 2KCCA 2NUCA 3MVVA 5GQOA 3S2DB 2CQOA 4LWCA 1HXYD 2RCNA 3RZOH 2SNSA 3R8BA 1U0LA 4KY6A 2F0QA 5JEAH 4IJHA 4JBKA 2D0PA 4DR4L 1U4PA 2K14A 2VB3X 4BY7B 1F77A 2D5DA 2VS1A 5J1ZA 4FYDA 3KLWA 1HUMA 3VR5A 1TY2A 3SDZA 3GTLB 3VR4A 1XPUA 3FP9A 3GTOB 4O1NA 1A2UA 3C2PA 4RCNA 4IPCA 2I07B 1DGSA 2WACA 1DCZA 5IT9E 2B2VA 3TS2A 4KJNA 1I6VC 5I9OA 1HCZA 4RGMA 3MFYA 2E2DC 5JPMC 5KRUA 4A3KH 4QQBX 4K8IA 3R2IA 1K83H 4FF2A 4AYBG 4K2KA 1STGA 2JA6B 4LFCQ 2I46A 3BDLA 1FL0A 4A3CH 3JAMi 2EY1A 4J8QA 4IZ8A 3OW2A 2K33A 1K28A 1VQPA 4MIUA 1TS5A 1SNQA 3QJYA 3CC2A 5JAVA 1NUCA 3G6JB 1W3SA 5HGQA 2I5HA 4JBMA 1HUNA 3PIO3 2TMPA 1ZYRC 2Q2IA 4K0KQ 4L8JA 3TZDA 4EQ5A 1A62A 1I4HA 4H7BA 3MXUA 4GNXA 1VQGA 5JVH3 1HNZL 3CD6A 1GO3E 1DD2A 1STBA 2KA7A 3W5OA 1UEBA 1FJGQ 4QIWB 2PNRC 4JI1L 2KUMA 2LKVA 4V0BA 4LF4Q 2F0JA 3HOWB 4YHHL 4DR2Q 4LFBQ 2RF4A 2DN8A 1I6HH 2A19A 4FNFA 2QCPX 1QZGA 2RA4A 4CKEA 1KABA 2F0DA 1PH4A 1EZ6A 2MP1A 1JWMD 4A93G 2ZXOA 1QOHA 2RSOA 2ZTCA 5M3MB 3EBEA 4IO9A 4BY1G 1E2ZA 2K5QA 1C48A 4CDDC 3LNNA 1ESRA 2AMCB 4ODGA 4QMGA 1IL8A 2NN6I 4JI1Q 4A3DG 1AFPA 5C4JB 4OO1I 2GN5A 4R4CA 1VQBA 1CTMA 3PIPA 5C44G 1YNJC 1G6PA 3BZCA 3T53B 4AYBE 4JI7L 2NZHA 5KGUA 1PH5A 2JA9A 1XMQL 2K5HA 4CDCC 2IX0A 4L6TB 1GOZA 1SJED 3CF5A 4TKOB 4GKJQ 1X3GA 3FEWX 2ASBA 1JJ2A 1EFWA 1JC7A 5CORA 1NMGA 4HIDA 5C4XG 4WJWA 1BNZA 1FNVA 1SDFA 1VQJA 4J15A 4DAPA 1I3QB 2JA7H 3PO3G 4TQUS 2CH4W 2FINB 2D0OA 3I3CA 3K57A 2PI2A 2JA5H 4FXKC 4LF9Q 4CKBA 3KBXA 1TXYA 2VQFL 2AQ3B 5EPKA 5ISRA 3P1HA 5J22A 1EY5A 3NXWA 1C4QA 5C4XH 4YY3Q 4A3JB 3S1RH 2VQEQ 2B63H 4UHVA 4U673 4DV4Q 4LFCL 2CWAA 1VQHA 2AWOA 5DM73 1SROA 2JA7B 2ALYB 2ZT9C 2ZXPA 3K7UC 2XN9C 1IXRA 5CV5A 3TS0A 2K05A 4C2MH 1I5FA 4K6LA 2XWJB 5C0XH 1IBKL 5BN4A 2F0IA 5D14A 1QB5D 4I7AA 1E2WA 1SNDA 1MI2A 2H4OA 4C3JG 1UWVA 1PMRA 4UY8C 1H9RA 4EQNA 1K0SA 3D31A 4R4QA 4ALPA 1U4LA 2E8GA 3STBC 3PQIA 4O42A 1E22A 5C4XB 2KCMA 3F8TA 4RKLA 1KD1C 3DUZA 1VQIA 3PUVA 4K6DA 1TS2A 3T1HQ 3CCVA 1XNRQ 3S1NH 4A3GB 3BZKA 3DEOA 5JJIA 1YZ6A 3CQZH 3M4OH 2E75C 2R7DA 1O7LA 2J4XA 1XMOQ 1Z6HA 4B3MQ 3Q8DA 2KJXA 4A3LH 4DV3Q 4ZAIA 2VQEL 3H6MA 2N3SA 4X66L 2WAQG 1CT1D 5JEAJ 1L0YB 2YTXA 3VYSA 3UDXA 1LLRD 1WTOA 2FMCA 3PUXA 2FFKB 3OIQA 2O5JC 2OQKA 2WINB 2A1AA 2VQFQ 4MHEA 4RHRA 3PIOA 1K8AC 1QJOA 1NTGA 4OHJA 1MSHA 3I55A 1JOQA 1CM9A 2CCZA 3J7AV 4IALA 4UAIA 5M5WH 1EY0A 4C56C 1B2TA 3RMHA 1ONLA 4BBRH 2HD3A 4B3SQ 2B2TA 1EL0A 2RHSB 5I2YA 3DLLA 1TVXA 2PNHA 5E7NA 1SRUA 1IW7D 1DXMA 1S5FD 4A3CG 2ZTEA 5E1FA 4JI7Q 3TN2A 5IYDG 1VQ5A 4JOIC 1D2BA 4DR6L 4B08A 4DK0A 4UP7A 1EQRA 1F2LA 1SNMA 3KYHC 4JI0L 4DXGA 2TSSA 1YEZA 3Q6SA 2HCCA 1CA5A 4PMCA 4A3KG 3R3OA 1JB3A 1QVFA 4KN4C 3OHXC 5FOBB 1SYGA 2HQLA 4DNRB 4LMQD 2QW7A 3A5UA 5C3WA 2RCFA 1WVLA 1WTPA 1IBLL 1UNSA 1OTCA 3UE0A 1N32Q 3PCOB 4YIJA 2FJ2A 4IFDJ 5IYCH 1LTID 4DV1L 1EU3A 3EA6A 1SMYC 1TY0A 3TRZA 2B2YA 4RGOS 3T1YL 1G2TA 1Y1WH 1WD1A 3Q23A 3S2DH 4X66Q 1GUGA 3HKZG 3QOLA 3OIPA 3WWVA 4UDUC 2MFIA 5M5XH 2J0TD 1PYBA 1XMOL 1G291 3GTOH 5T1GA 2V4DA 4JK1C 4DV3L 1MGSA 2RDFA 3RZDH 1S5CD 1T9HA 1P8LA 4JI2L 2UXDQ 2ZXRA 3BVGA 3DHQA 1HH2P 3HOZB 3KJPA 1QZHA 1Z9FA 1ESFA 3D4WA 1O7IA 1Q1EA 1Y1VG 4HTHA 2EYPA 3PO2B 1OXSC 2BCOA 3P20A 4DR6Q 4JPBW 3S2HB 1QNKA 3DXJC 4RH6A 1A6XA 1VMPA 3M85A 1L1OA 4DA2A 3S2HH 2E76C 4BBRB 5IYCG 3HGBA 3A55A 5I6WA 1KIXA 3GTJB 1Q12A 4LF7Q 1VQNA 1FNUA 4YCVA 1PH7A 4IPDA 1TWHB 1N36L 4IQZA 5HY6A 1LO5D 4IN3A 2JP1A 1CKNA 1YHBA 4Y52H 3OPOA 3W1GA 3ICEA 1SXTA 1SR3A 2KHSA 2DNEA 3KOJA 4XQNA 2CW0C 1ML0D 2EYHA 5IYBH 2ZTDA 2LXKA 2EQSA 3TZUA 2AUKA 2F4IA 4JW0A 3I70A 1PTOC 4LF6Q 3AMUA 2DY8A 1KDCA 1V43A 2M00A 1KAWA 3FDTA 2NWGA 1N9WA 1AEXA 1VQEA 2O2LD 4ZQ3A 5IT9L 1EYCA 1BCPB 4A3FG 3HG9A 1BCPF 2MHVA 5HGTA 1NY4A 3HOYH 2F0EA 3FKIH 3W3AA 4DF7A 1JOKA 3SXHA 1VQ9A 2CWPA 1ICFB 2RBMA 2XWBB 1XPRA 2NN6G 2A73B 2IL8A 4I7ZC 5M5YB 2EXZA 2I5LX 1K8GA 2FMMA 3GTKB 4WJ3M 4XYQA 3EQLC 1E1TA 3AQQA 3S17B 2OT2A 1E1OA 3EN2A 4APVA 5DM63 1JT8A 1S4ZA 2WP8J 4KTAA 4CJ1B 5IP7G 2JE6I 1GXDC 4JOIA 4P72A 2I0QA 4A3KB 4L5RC 2EYLA 4K5WA 1Y1WB 2HIXA 4NXNL 4EQOA 4MNOA 1D7QA 2Z0SA 2LY7A 3HOVH 2IPKD 3S1QB 4N9PA 4JI8Q 3S1RB 4RHSA 2IWHA 1XNQQ 5GROA 3NEMA 1NSNS 3OMGA 1EIHA 1SLJA 3S17H 4P71A 2F0PA 4ZK9B 5C4HA 5IT9c 4B3RL 2Q2UA 1VQKA 3QIAA 1YNNC 5IGBA 3CC7A 1AN8A 3MWYW 4ILWA 4DR7Q 2CHBD 3D6WA 4YHHQ 1ET6A 1PRTD 4JVZA 3ZJYC 2F4VQ 2NVQB 1CK1A 2BOSA 5C0XG 4CJ0B 4NW2A 2N49A 3FKIG 4A3BB 2IY5B 3CW2C 2DJGC 2GA4B 4AIMA 3A74A 2EJMA 1PYSB 2IJ0A 1W6JA 5IY0A 2XNAC 1B9NA 4KV6A 1A2TA 3BYYB 1X54A 1XJVA 3VDYA 2KBNA 4GKKL 2KHJA 1SNPA 3FRPB 1QE6A 3A8KE 2B63G 1A63A 3SGIA 4FO2A 1N8RC 4QF4A 4KKUA 3ULJA 1RTNA 4C1NI 1J9OA 1PH8A 1WTHA 1H9KA 1MKHA 1Q1BA 3K80C 4X3SA 2UUCL 3STBD 3ONAB 3DM1A 3AYHB 4JV5L 3PO3H 3AEVA 1AZPA 2QGQA 1L1OC 5EPLA 1WCMG 1LM0A 1K8MA 5IOCA 4G7ZC 4LF5L 2R61A 5EBCA 1YJNA 4XXEA 3UDFA 3VR3A 3CCSA 2WKDA 1JMCA 1MJCA 1IBML 5CGKA 1TWFB 3H91A 3KUPA 5M3FB 5KIXA 5FLXE 3ULPA 1E2VA 3NBHB 2Y0SG 3I56A 3HOWH 2SDFA 4IUQA 3CCJA 3OOCA 5ELFA 5K5PA 5C0XI 2E74C 1BCPC 1SNCA 1SEBD 4P2CB 3H15A 2Q2HA 1PHJA 3OYYA 2VXWA 4A3DH 5M9OA 1VCIA 4AH6A 4FVMA 5LMNW 1SNOA 1L2FA 2H5XA 1N34L 1LACA 2VNUD 3OW7A 4WRDA 3J81c 3HOXH 3GV3A 1X3QA 3RLOA 4FDBA 4FXGC 1KLUD 1UAPA 3MXNA 2IHEA 4A93H 2OQ0A 2A6ED 3HKZE 1PFBA 2CW0D 4L5SA 1OXUA 4CGYB 1ENFA 3ER0A 1WTQA 1XX8A 3I4MB 3DEPA 5IGDA 1IKMA 3A8IE 3C1EA 1R9TH 1CZGA 3S1MH 3NBHA 1BF4A 1YJWA 2OWOA 3Q22A 3NTHA 2ZM6Q 3AFQA 4XTCS 2F0KA 1BOSA 2CVRA 4IFDH 3J7ZC 5GAEC 4DAYB 2B2WC 2JA5B 3KF6A 1ZKOA 3TSSA 2EY2A 2BH8A 1CI3M 3VYTA 3I4MH 3VA7A 5IYDH 1R4PB 1NMFA 1AZQA 4R9WA 3J81j 4HJ8A 4KK7A 5CBEE 3CCMA 1KDBA 2L4NA 2KEDA 4QJFA 3LGJA 4LK1C 2WB1E 4OL7A 2VZAA 2L11A 5CR3A 4QY7A 4BBRG 1SFOH 1T5EA 1N33L 1QUQB 3M4QA 3I4MG 2ZJRA 2JQOA 3F2UA 3SK5A 2L9HA 1VQOA 4ZKBB 1BBWA 3JC66 3NE5B 2OCEA 2UXBQ 3S16B 1B7YB 4IFDG 3A7LA 4JI2Q 3CPWA 1STYA 5IIFA 1C9OA 3OTOL 4A3LG 2E2IB 2YU9H 4F87A 3PUYA 1PFMA 2B2WA 4MN3A 3QR8A 1JQYD 1ZXTA 1STEA 4A3IG 1B4OA 4L63B 5LL6S 3R93A 5L37A 3J81L 1AH9A 3S1NB 1EIGA 2NTTA 2KHIA 1EY4A 2Z1CA 1QG7A 1QUQA 4H13C 1MHWC 1B53A 4AQYL 4A3MG 1X65A 2K50A 2GVBA 3D4DA 3MXGA 4HCEA 1IBLQ 4B3RQ 1XTCD 2XSCA 3HOXG 5EAYA 1FD7D 1LTBD 2EPBA 2K28A 4HSVA 2DUDA 4HJ5A 2KVMA 2R3ZA 4DN4M 2PO4A 3TDQA 3CCQA 4UP9A 3OWEB 1NR2A 4OX9Q 2K75A 1LTAD 1HFNA 4C2MB 1UE6A 3D3RA 2JEBI 2YYZA 5BR8Q 3I7FA 3R2TA 5LMUQ 4QIWE 4NPSA 1YHQA 3CQZB 4IUUA 4K2LA 2B2VC 3VR2A 4KY7A 2N78A 4DK1A 1EWCA 1BXTA 5FK9C 1HA6A 3CPFA 1VDZA 3KLSX 1ET9A 5C3EH 1OXVA 2Q8RE 3M3YB 2PQAB 3M9BA 2SEBD 3FKIB 4A3BG 2VUMG 5BN5A 3A5ZB 2E2HH 2AQ2B 1EQVA 5IGEA 3GTQH 3G4SA 4GLXA 1YNJD 5DNFA 4DAYA 3TP7A 3HOVB 1NNXA 2HCIA 2HDLA 2JA7G 2UUAL 2PZUA 3V05A 4DV0Q 4OGQC 1KRSA 1S5ED 1DZ1A 3S15B 3CKIB 5E4XA 2B2TC 2YU9B 2RKSA 4DV4L 4X64Q 4JI3Q 1HZ9A 2BH2A 4KN7C 2A69C 2JA8B 5CV9A 4DFAA 4GS3A 4XIGS 2BE5D 4JBJA 4DV0L 1E0BA 5EPJA 2E2JH 2MGSA 4DU9A 5C44H 2RSNA 1KC8C 1I4QA 3PMFA 1TU2B 5JJKA 1YHAA 4KJOA 1CQVA 4CDFC 4JI5Q 4DUYL 5TSSA 5LMNQ 1J5EL 1RF2D 5IGGA 4A3FB 4G57A 5I2XA 5CBAE 3AFPA 3PSIA 2UU9L 4BY1H 2EY5A 1U5KA 1XNRL 4PMWA 2KQ3A 4HR7B 5FO8B 2PYKA 4DV6L 3MXPA 4HJ9A 1OXXK 2PI2E 3SK4A 2QDLA 3TP6A 4POFA 1QVCA 2NVXH 4B9WA 3J7YW 1M8AA 1HZAA 1TWAB 4KD3A 3HOVG 1PDQA 2B2UC 2WB1B 3NHHA 4FF3A 1G6ZA 1X3EA 1IYJB 1HTLD 5EBDA 1S5BD 1K3BC 1EOTA 1TS4A 4Y7NH 1RKNA 2LMCB 3K7AH 3CP0A 4GN3B 3E0EA 1FR3A 3NWTA 5M5YH 3K7AB 5IP7H 5LMUL 2VY3A 2UXDL 1EU4A 4IPHA 3BZDB 2IX1A 3OWFA 3UDIA 3J81E 1X9NA 5DLQE 1D5XC 1KXLA 2F0MA 4PG3A 3U4VA 1II3A 4YY3L 2NBFA 1PVOA 4B3TQ 4QCLA 3ULLA 4X64L 2NN6H 4DK6C 4C3JB 5CYUA 3S1MB 2A68C 3ND9A 5J3BA 1MJEA 3SEBA 3BYTB 1TKWB 3MTSA 1O78A 3HOYG 3JAME 1YBYA 4A3FH 4IFDI 4OO1H 1XTDA 4Q0FA 1W2BA 1IW7C 1N32L 1SE2A 1Q82C 2K03A 1MBYA 3PUZA 4HN7A 1AE3A 1F2MA 3F1ZA 5C3XA 5IYBG 3I2ZA 1EIYB 2PMZE 1TWCB 4DV5L 1XMQQ 3A56A 1CSQA 1EY9A 4OONA 4ZRZA 1B9MA 2AHOB 5IGCA 3MEHA 3IAYA 1Q46A 5EKKA 3SK8A 3BU2A 5F2DA 2KOLA 4PZ8A 5BR8L 5KYLA 3T56B 4HMIA 3DWAA 2JXMB 5ELDA 5KYIA 5ELBA 2QILA 4DV2Q 1B1ZA 4QB4A 3LX0A 1I50H 4TSSA 2C5CA 2K6AA 3HOZH 1Q90A 5JPNC 3ND8A 4IUTA 2AKWB 1GHJA 4CBVA 3SE0A 1DJRD 1DOKA 4C1NK 1Y1VH 1FGUA 1STHA 1HRJA 1EYDA 3IRBA 4OIJA 4R4IA 4XYOA 4C3HG 2D62A 5JEAG 1PTOF 3HOUG 2K01A 3JAMc 2E2IH 5AJ3Q 3RNUA 1TIID 1FJGL 1LTTD 5KNDA 3S14H 1LYLA 3EVQA 1T5XD 4HIKA 2R7FA 2JYOA 1AP0A 4N9TA 1GM5A 2NTSA 1LTRD 4OWXB 4RWSC 3A8JE 5GAGC 1Y1WG 4LUOA 1X3PA 4DV7L 3N52A 3CCUA 3E0JA 5CV7A 1A3VA 3CU7A 2F0OA 3K5MA 1LT6D 1PZJD 3P7JA 1D6EC 3TMEA 1VQAA 1N33Q 2Q2TA 3URYA 1IYUA 1I50B 1R4QB 3J7AF 2N55A 3U58A 4O2DA 1OXTA 4JI6Q 2XGTA 4I65A 4POGA 3MFGA 1Q8IA 1N34Q 2A69D 3H0GG 3IKJA 4BBSG 4A3EH 5G3LD 5FLMG 2HHHQ 2JJQA 5JJZA 2Z6BA 4A3JH 3EIVA 4TRDA 2MNAA 4EGVA 3D8GA 1WD0A 2N88A 2BDOA 4LAAA 3GD7A 4L5QA 4A3GG 1JJCB 4F7XA 4XT3B 1I4RA 4QUCA 3I4NG 2MO0A 2I5MX 1V9PA 5I6YA 4P74A 3J80c 3S15H 1JE4A 3M4OB 1HPCA 2R7ZH 2NVTB 3S9WA 2OXPA 4JV5Q 3HOUB 3DWQA 1RCVD 4DV5Q 5C0XJ 1ASYA 1HHVA 5ELCA 1OO9B 5CMDA 3PF5A 4DV7Q 1Q3LA 3A54A 4XDXA 2DGYA 2Q8TA 1GJXA 3F2CA 2ENBA 2A5HA 4DXFA 3M3YH 4BXXH 3L7ZC 4MZ9A 2HIVA 1PFNA 3NENA 2L55A 1GKHA 4FF1A 2NZ1D 1YJ9A 2ICIA 1X3FA 1NE3A 1S3OA 1E24A 1P16A 4RCOA 2F3IA 2K4KA 2PW7A 2MPMA 3K0YA 2RDGA 1HZBA 3TP8A 2XRSD 2L0CA 1F2YA 2NYZD 5NUCA 4JI4Q 3M4YA 3J80L 1QWYA 3HKSA 2V1CC 1WJJA 4DR5Q 4C3JH 4ME3A 3BDCA 3PO3B 3QOJA 2B39A 2OF1A 3BG3A 5CV8A 3DMUA 3U9SA 5IP9H 4N8X1 1UUPA 2M9VA 4DUZQ 2F0HA 3KBGA 1G2SA 1J6QA 2UUCQ 1LV9A 3A7AB 5AFWA 2HT1A 1BR9A 5IWAQ 3GTPB 1B3AA 3GO5A 1JJGA 4XT1B 1UE1A 1YITA 2Y0SE 1EY8A 4K0KL 2B8FA 3D0FA 3ERSX 4DV6Q 4PZ6A 1LT4D 3H3VC 2WFWA 5K36H 1JICA 3HFZB 3PO2G 5D65A 2JA5G 1O7ZA 1CHQD 4JI5L 5M3MG 3CCEA 2DJFC 5JOBA 3FPPA 4DK3C 3MAQA 3MZ5A 1NR4A 1Y14B 3AB9A 4LF6L 4DR7L 4B3TL 2JK8A 1K0RA 5K36G 1ENCA 3I4OA 4RAUC 3CRLC 2LFNA 5A2QE 4K5VA 3Q0AA 4A4IA 5C6AA 4RGNA 4JYAL 1EY6A 1DOLA 1ZYRD 4C3IG 2RHQB 4M8AA 3TEHB 3BDOA 4GOPB 1NBWA 1LTLA 1HA5A 1SBBB 3L9AX 4UP8A 2K7VA 3QO2A 3VYRA 2A6HD 5IP9G 4ABNA 5D3IB 3J7A5 3RN5A 2QF7A 1KAAA 1J8IA 1B3QA 2F0SA 3K8AA 3V96A 5IE8A 4MTNA 2B2YC 1DYQA 4LF7L 3K58A 4OWWB 1KTKA 2YV5A 5EKLA 4IUNA 1NCVA 3RLFA 4A3DB 4LJZC 3H3VH 3KK7A 1SSOA 4X6AH 4X62L 4R8IA 2WAQE 1GVPA 1VF7A 5FLXc 2ZJPA 4JC0A 4WFN3 1I3QH 1VQCA 3X3MA 5LMNL 4DUYQ 4HIOA 4ULLA 1V1PB 4DR3Q 3ERQA 3IFDA 3TBIB
chains in the Genus database with same CATH topology
2R7DA 5BR8Q 1XMOQ 3I7FA 5LMUQ 1PH1A 4QIWE 4NPSA 1YHQA 4JG2A 1IZ6A 4B3MQ 4C3IH 3Q8DA 1CKMA 2Z6KA 4A3LH 4DV3Q 2VQEL 2N78A 1AE2A 2N3SA 4X66L 3KFUA 2WAQG 5JEAJ 2IHFA 1YVCA 2YTXA 3K81C 3UDXA 4AQYQ 3PUXA 3G48A 3CPFA 2UUAQ 4LNQA 2OQKA 4BA1I 3HOWG 2VL6A 4BA2I 3E9IA 2A1AA 2VQFQ 3HOZG 1X56A 3CXCA 3PIOA 1RIPA 1K8AC 5C3EH 1NTGA 1OXVA 3I55A 2PQAB 3M9BA 3MXNB 4A3BG 2CCZA 2JEAI 2VUMG 3U50C 2YTYA 3A5ZB 3T1YQ 1UE7A 2E2HH 3G71A 5M5WH 1K3RA 3GTQH 3G4SA 4GLXA 4B3SL 1MIUA 1E7ZA 2NVYH 4H02A 3KF6B 4X65L 4BBRH 2WB1G 4KI0A 5M3MH 4B3SQ 1WCMH 2RHSB 1WYDA 4LUVA 1HR0L 5M3FH 3I4NH 4RG1A 5ELNA 2PNHA 5E7NA 3DLLA 2UUAL 2JA7G 1SRUA 1ASZA 4GKJL 3KDFB 3OTOQ 4DV0Q 3U4ZA 1KRSA 3PO2H 4A3CG 2ZTEA 1X6OA 4JI3L 1CSPA 1TWCH 1YNXA 4JI7Q 1VQDA 2UXCQ 5IYDG 3PV0A 4JOIC 1VQ5A 4DV4L 4X64Q 4YCWA 4DR6L 4GLVB 4UP7A 1EQRA 4JI3Q 1HZ9A 2JA8G 4JI0Q 2BH2A 4IFDJ 2LSSA 4GN4B 3KYHC 4GS3A 4XIGS 4JBWA 4JBJA 4HJ7A 1G51A 1PH2A 4DV0L 4JI0L 1IL2A 1YEZA 3GTPH 1WOCA 2K52A 3S16H 2E2JH 1HJPA 4GOPC 4A3KG 5C44H 2UXCL 2R6GA 4A3EG 1QVFA 1KC8C 2ZM6L 4LF9L 2HQLA 3T1HL 3MEFA 1I94L 1YHAA 4LFAL 3A5UA 5JJKA 4P73A 4OX9L 4JI5Q 1TWAH 4DUYL 4KHPQ 2R93H 1IBLL 5LMNQ 1J5EL 1OTCA 3UE0A 1N32Q 1UE5A 1CUKA 3A0JA 3PCOB 4YCUA 3AFPA 5IYCH 3PSIA 2UU9L 4BY1H 1XNRL 1U5KA 4DV1L 4DR1L 4PMWA 4NXMQ 1V1QA 1NJIC 4X62Q 4DV6L 3TRZA 4HJ9A 3T1YL 1OXXK 2PI2E 3RLNA 5ELOA 4KLKA 4POFA 1Y1WH 1QVCA 3S2DH 2F52A 1L0WA 2ES2A 4X66Q 2NVXH 3HKZG 1EIFA 4GNXB 1HZAA 3WWVA 4GOPA 1QVGA 2MFIA 4LF4L 4B3ML 3HOVG 4DR1Q 3BJUA 5M5XH 4NXML 2R92G 2UU9Q 1PYBA 1X3EA 1XMOL 1IYJB 1G291 3GTGH 3GTOH 2CFMA 3B6YA 4Y7NH 3K7AH 1Q8KA 3CP0A 4DV3L 1PFSA 4GN3B 3M7NA 3E0EA 5M5YH 3RZDH 4LFAQ 4DPGA 2KCTA 5GAHC 5IP7H 1T9HA 1I94Q 1A0IA 5LMUL 1BKBA 1P8LA 1SMXA 2VY3A 4JI2L 3PF4A 4IOAA 2IT1A 1HH2P 4IPHA 2IX1A 4QL5A 3W1BA 3UDIA 3KJPA 1QZHA 2R92H 1X9NA 1Z9FA 5DLQE 4BY7G 1KXLA 4JYAQ 1O7IA 1Q1EA 1Y1VG 2BA0A 4PG3A 3U4VA 3RN2A 4YY3L 1PVOA 4C3HH 4LF8Q 4YWKA 4B3TQ 3TQYA 3S1QH 1OXSC 2QA4A 3UE1A 2MQHA 3ULLA 1PH6A 4X64L 4DR6Q 4DK6C 2MO1A 1EWIA 3M85A 5J3BA 3L0OA 4LF5Q 1L1OA 4R1JA 2ZJQA 3S2HH 1MJEA 5IYCG 1VQ4A 3HOYG 2GVAA 1YBYA 4O0AA 1KIXA 2R7ZG 1Q12A 4A3FH 3PUWA 4LF7Q 2R93G 1EOVA 4IFDI 3UDGA 1VQNA 1SN8A 1XTDA 4IOCA 3NELA 4YCVA 1IBKQ 1W2BA 5FJ8G 1PH7A 4IPDA 1KRTA 1N32L 1J5EQ 1N36L 3GTKH 1Q82C 4EX5A 5HY6A 3CCRA 4KHPL 4RMFA 1CKNA 1YHBA 3PUZA 1Q7YC 2K5NA 4Y52H 3W1GA 2JA8H 1AE3A 5IYBG 3F1ZA 3ICEA 1VQLA 1KL9A 2HHHL 1SR3A 3TREA 1VQFA 5IWAL 3KOJA 2UXBL 3I2ZA 5IYBH 1EIYB 2PMZE 3RR5A 2ZTDA 2LXKA 2EQSA 4DV5L 4GNXC 1XPOA 1XMQQ 1BVSA 1K73C 3F2DA 4DUZL 1CSQA 4OONA 2VW9A 4IJLA 1VQ7A 2XTIA 2AHOB 4LF6Q 5FLMH 1V43A 1Q46A 3BU2A 5FJ8H 4PZ8A 1KAWA 5BR8L 4BBSH 3H0GH 1N9WA 2F4VL 4DR3L 2ATWA 2NVTH 1VQEA 1C0AA 4DV2Q 4A3FG 1VQ8A 4A3BH 1HR0Q 1WFQA 1NY4A 3HOYH 1I50H 3FKIH 2YTVA 5C3EG 3KJOA 1VQ9A 1SE8A 4JI4L 1EYGA 2CWPA 3HOZH 2PQAA 4OO1G 1GD7A 1XPRA 4HJAA 2UUBQ 2NN6G 2AKWB 2C35B 2B3GA 2I5LX 1Z47A 1K8GA 4WJ3M 1CKNB 1TWHH 1Y1VH 1FGUA 2ID0A 1E1TA 1PV4A 3AQQA 4BY7H 3E9HA 4APVA 1E1OA 3EN2A 1VQMA 1JT8A 3M4PA 3GDEA 3KDFA 4L5TA 3F2BA 2WP8J 1M1KC 3IRBA 4R4IA 1EUJA 1E3PA 5GQOA 4YWLA 2D62A 5JEAG 2JE6I 5IP7G 4OXPA 2CQOA 4JOIA 4LWCA 4P72A 2I0QA 3JAMc 2RCNA 2E2IH 4L5RC 3HOUG 1PH3A 5AJ3Q 3RNUA 3RZOH 2HIXA 1FJGL 1HR0W 4NXNL 3S14H 1LYLA 4MNOA 1D7QA 4HIKA 2Z0SA 4NB3A 3HOVH 1U0LA 2R7FA 4LUZA 4DR5L 1GM5A 4JI8Q 3CAMA 4IJHA 4OWXB 4JBKA 1FVIA 5GROA 1IBMQ 1XNQQ 2D0PA 3NEMA 5GAGC 1Y1WG 2NVQH 4DR4L 1SLJA 1LUZA 2K14A 4LUOA 4DV7L 3S17H 3CCUA 4P71A 2VS1A 1B70B 4IPGA 3KLWA 5IT9c 4B3RL 2Q2UA 1VQKA 1M90C 3CC7A 4JI8L 1VQAA 4DR7Q 4DR2L 4YHHQ 2CKZB 3FP9A 1EQQA 1N33Q 2Q2TA 1XPUA 3GTMH 3PGZA 3ZJYC 1HNXQ 2F4VQ 5C0XG 4DKAC 2IY5B 2N49A 3FKIG 1RL2A 3CW2C 4IPCA 1DGSA 3U58A 4O2DA 2L15A 3GTJH 4AIMA 1OXTA 3A74A 4DNIA 4JI6Q 2XGTA 2NZOA 4POGA 3TS2A 1H95A 1PYSB 1N34Q 5IY0A 3H0GG 4GN5A 1VQ6A 4BBSG 4GKKQ 1X54A 4A3EH 2BA1A 5FLMG 1XJVA 4A3KH 3VDYA 1PA6A 4QQBX 2KBNA 2HHHQ 2JJQA 5H1SE 1K83H 1HNZQ 2KHJA 2B63G 4GKKL 4AYBG 2QEXA 1A63A 3SGIA 4UPAA 3G6EA 4A3JH 1N8RC 3EIVA 3ULJA 4LFCQ 2EIFA 1PH8A 2MNAA 2UXDQ 5M3FG 1C7YA 1MKHA 1Q1BA 3K80C 2UUCL 1FL0A 3STBD 4A3CH 3GD7A 1CKOA 1A8VA 4JCVE 4L5QA 3AYHB 4JV5L 3JAMi 3PO3H 4A3GG 1JJCB 3AEVA 2QGQA 3OW2A 1VQPA 1L1OC 3I4NG 1WCMG 2MO0A 1LM0A 4P75A 2I5MX 1V9PA 3CC2A 4LF5L 4P74A 3J80c 1YJNA 3UDFA 3S15H 2R7ZH 2VUMH 1TWGH 5GADC 1W3SA 3CCSA 5HGQA 2OTLA 1JMCA 2I5HA 4JV5Q 1MJCA 1IBML 1XNQL 4LF8L 1HNWQ 4JBMA 4DV5Q 3ULPA 5C0XJ 1ASYA 4TVAB 3NBHB 2Y0SG 3I56A 3PF5A 1JB7A 3HOWH 2Q2IA 3CCJA 4DV7Q 4K0KQ 3KF8B 5C0XI 4EQ5A 1A62A 4NXNQ 2DGYA 4HIMA 4GNXA 2AWNA 3H15A 3F2CA 2Q2HA 1PHJA 1VQGA 3OYYA 4A3DH 4LFBL 1VCIA 3K0XA 1HNZL 4AH6A 1GO3E 5C4JH 3L7ZC 3CD6A 3S24A 4MZ9A 3M3YH 4BXXH 2HIVA 3NENA 5LMNW 1GKHA 4PZ7A 1S40A 3W5OA 1UEBA 3FHWA 1PH9A 1L2FA 1Q81C 2H5XA 1YJ9A 1N34L 1FJGQ 2VNUD 4JI1L 4JI6L 3J81c 4LF4Q 1X3FA 1NE3A 1S3OA 1E24A 3DM3A 3HOXH 1P16A 4YHHL 3RLOA 4DR2Q 4LFBQ 4FDBA 2B29A 2RF4A 2EXDA 2F3IA 2K4KA 4OWTB 3H3VI 2E5LQ 1I6HH 2A19A 2IHEA 1HZBA 4A93H 2OQ0A 1QZGA 3HKZE 4DAMA 2UUBL 4L5SA 1OXUA 1PH4A 3ER0A 1D8LA 4LW1A 4JI4Q 4A93G 1B8AA 5JJLA 4A3MH 1R9TH 3S1MH 3HKSA 2V1CC 1WJJA 1L1OB 2ZTCA 4C3JH 3CMAA 4DR5Q 4ME3A 3EBEA 1YJWA 4WJ4A 4IO9A 2OWOA 1WI5A 4BY1G 4DR4Q 2ZM6Q 2E5LL 3AFQA 4YWMA 4XTCS 2AMCB 5IP9H 4A3IH 4BXXG 2NN6I 4JI1Q 4A3DG 4DUZQ 1KQSA 2JA6H 4OO1I 2GN5A 1VS0A 4R4CA 1J6QA 2UUCQ 1K9MC 1VQBA 3PIPA 5C44G 3J7ZC 2HT1A 1G6PA 3BZCA 5IWAQ 5GAEC 2FXQA 4R4TA 4AYBE 4DAYB 4JI7L 3KF6A 2NZHA 3GO5A 1JJGA 1YITA 1UE1A 1PH5A 2BH8A 2JA9A 2K5HA 1XMQL 2IX0A 2K5VA 2Y0SE 3CF5A 4GKJQ 4K0KL 1X3GA 3D0FA 1N36Q 3I4MH 2ASBA 1JJ2A 3ERSX 1EFWA 5IYDH 4DV6Q 4PZ6A 1NMFA 1NMGA 2WFWA 4HIDA 3J81j 4DV1Q 4HJ8A 5C4XG 3HFZB 3CMEA 3CCMA 3PO2G 1HNWL 2JA5G 1VQJA 4J15A 3LGJA 2WB1E 4QJFA 4QGUA 2VZAA 2JA7H 4JI5L 3PO3G 4TQUS 4A3GH 4A76A 2D0OA 2JA5H 2PI2A 5M3MG 4QY7A 4BBRG 3GTLH 3CCEA 4LF9Q 1HZCA 1TXYA 4DK3C 2VQFL 1SFOH 1N33L 1QUQB 1Y14B 3M4QA 4LF6L 3I4MG 4DR7L 2ZJRA 2JQOA 1YI2A 2UXDL 4B3TL 4A3JG 1VQOA 5C4XH 4YY3Q 2JK8A 1K0RA 5K36G 1BBWA 3JC66 2VQEQ 3S1RH 2B63H 4DV4Q 2OCEA 2UXBQ 3I4OA 4LFCL 1B7YB 1KHIA 2CWAA 1VQHA 2AWOA 4IFDG 2KENA 1SROA 4JI2Q 3CPWA 1BBUA 2ALYB 4A4IA 1TWFH 2JA6G 4JYAL 1C9OA 3K7UC 3OTOL 4A3LG 2YU9H 3L2PA 3CC4A 2RHQB 3PUYA 3TEHB 1IXRA 3TS0A 4C2MH 1YIJA 1I5FA 4X65Q 4GOPB 1IBKL 1NBWA 3J81i 1LTLA 5AJ3L 4A3IG 4UP8A 1UWVA 5IP9G 4UY8C 1AH9A 3J7A5 3J80i 3RN5A 3D31A 2KHIA 1JE5A 4R4QA 1HNXL 4ALPA 3K8AA 5IE8A 2E8GA 3STBC 2A8VA 4MTNA 1QUQA 1E22A 4A75A 2KCMA 3F8TA 4LF7L 4AQYL 4A3MG 4OWWB 2YV5A 1KD1C 1X65A 3RLFA 2K50A 3H3VH 2GVBA 1VQIA 4B3RQ 3PUVA 1IBLQ 3HOXG 4R4OA 5EAYA 4X6AH 4X62L 1S72A 2OTJA 2WAQE 2LXJA 4GLAC 1GVPA 3T1HQ 3CCVA 4KHZA 2DUDA 1XNRQ 5FLXc 3S1NH 2ZJPA 4HJ5A 4JC0A 2N8NA 3BZKA 1I3QH 1VQCA 3CCQA 5LMNL 3CCLA 2Z6KC 5JJIA 4DV2L 1YZ6A 4UP9A 4DUYQ 3HOUH 4OX9Q 4HIOA 2K75A 3CQZH 4DR3Q 1X55A 3M4OH 1Q86C 1UE6A 2JEBI 2YYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7D A;  5BR8 Q;  1XMO Q;  3I7F A;  5LMU Q;  1PH1 A;  4QIW E;  4NPS A;  1YHQ A;  4JG2 A;  1IZ6 A;  4B3M Q;  4C3I H;  3Q8D A;  1CKM A;  2Z6K A;  4A3L H;  4DV3 Q;  2VQE L;  2N78 A;  1AE2 A;  2N3S A;  4X66 L;  3KFU A;  2WAQ G;  5JEA J;  2IHF A;  1YVC A;  2YTX A;  3K81 C;  3UDX A;  4AQY Q;  3PUX A;  3G48 A;  3CPF A;  2UUA Q;  4LNQ A;  2OQK A;  4BA1 I;  3HOW G;  2VL6 A;  4BA2 I;  3E9I A;  2A1A A;  2VQF Q;  3HOZ G;  1X56 A;  3CXC A;  3PIO A;  1RIP A;  1K8A C;  5C3E H;  1NTG A;  1OXV A;  3I55 A;  2PQA B;  3M9B A;  3MXN B;  4A3B G;  2CCZ A;  2JEA I;  2VUM G;  3U50 C;  2YTY A;  3A5Z B;  3T1Y Q;  1UE7 A;  2E2H H;  3G71 A;  5M5W H;  1K3R A;  3GTQ H;  3G4S A;  4GLX A;  4B3S L;  1MIU A;  1E7Z A;  2NVY H;  4H02 A;  3KF6 B;  4X65 L;  4BBR H;  2WB1 G;  4KI0 A;  5M3M H;  4B3S Q;  1WCM H;  2RHS B;  1WYD A;  4LUV A;  1HR0 L;  5M3F H;  3I4N H;  4RG1 A;  5ELN A;  2PNH A;  5E7N A;  3DLL A;  2UUA L;  2JA7 G;  1SRU A;  1ASZ A;  4GKJ L;  3KDF B;  3OTO Q;  4DV0 Q;  3U4Z A;  1KRS A;  3PO2 H;  4A3C G;  2ZTE A;  1X6O A;  4JI3 L;  1CSP A;  1TWC H;  1YNX A;  4JI7 Q;  1VQD A;  2UXC Q;  5IYD G;  3PV0 A;  4JOI C;  1VQ5 A;  4DV4 L;  4X64 Q;  4YCW A;  4DR6 L;  4GLV B;  4UP7 A;  1EQR A;  4JI3 Q;  1HZ9 A;  2JA8 G;  4JI0 Q;  2BH2 A;  4IFD J;  2LSS A;  4GN4 B;  3KYH C;  4GS3 A;  4XIG S;  4JBW A;  4JBJ A;  4HJ7 A;  1G51 A;  1PH2 A;  4DV0 L;  4JI0 L;  1IL2 A;  1YEZ A;  3GTP H;  1WOC A;  2K52 A;  3S16 H;  2E2J H;  1HJP A;  4GOP C;  4A3K G;  5C44 H;  2UXC L;  2R6G A;  4A3E G;  1QVF A;  1KC8 C;  2ZM6 L;  4LF9 L;  2HQL A;  3T1H L;  3MEF A;  1I94 L;  1YHA A;  4LFA L;  3A5U A;  5JJK A;  4P73 A;  4OX9 L;  4JI5 Q;  1TWA H;  4DUY L;  4KHP Q;  2R93 H;  1IBL L;  5LMN Q;  1J5E L;  1OTC A;  3UE0 A;  1N32 Q;  1UE5 A;  1CUK A;  3A0J A;  3PCO B;  4YCU A;  3AFP A;  5IYC H;  3PSI A;  2UU9 L;  4BY1 H;  1XNR L;  1U5K A;  4DV1 L;  4DR1 L;  4PMW A;  4NXM Q;  1V1Q A;  1NJI C;  4X62 Q;  4DV6 L;  3TRZ A;  4HJ9 A;  3T1Y L;  1OXX K;  2PI2 E;  3RLN A;  5ELO A;  4KLK A;  4POF A;  1Y1W H;  1QVC A;  3S2D H;  2F52 A;  1L0W A;  2ES2 A;  4X66 Q;  2NVX H;  3HKZ G;  1EIF A;  4GNX B;  1HZA A;  3WWV A;  4GOP A;  1QVG A;  2MFI A;  4LF4 L;  4B3M L;  3HOV G;  4DR1 Q;  3BJU A;  5M5X H;  4NXM L;  2R92 G;  2UU9 Q;  1PYB A;  1X3E A;  1XMO L;  1IYJ B;  1G29 1;  3GTG H;  3GTO H;  2CFM A;  3B6Y A;  4Y7N H;  3K7A H;  1Q8K A;  3CP0 A;  4DV3 L;  1PFS A;  4GN3 B;  3M7N A;  3E0E A;  5M5Y H;  3RZD H;  4LFA Q;  4DPG A;  2KCT A;  5GAH C;  5IP7 H;  1T9H A;  1I94 Q;  1A0I A;  5LMU L;  1BKB A;  1P8L A;  1SMX A;  2VY3 A;  4JI2 L;  3PF4 A;  4IOA A;  2IT1 A;  1HH2 P;  4IPH A;  2IX1 A;  4QL5 A;  3W1B A;  3UDI A;  3KJP A;  1QZH A;  2R92 H;  1X9N A;  1Z9F A;  5DLQ E;  4BY7 G;  1KXL A;  4JYA Q;  1O7I A;  1Q1E A;  1Y1V G;  2BA0 A;  4PG3 A;  3U4V A;  3RN2 A;  4YY3 L;  1PVO A;  4C3H H;  4LF8 Q;  4YWK A;  4B3T Q;  3TQY A;  3S1Q H;  1OXS C;  2QA4 A;  3UE1 A;  2MQH A;  3ULL A;  1PH6 A;  4X64 L;  4DR6 Q;  4DK6 C;  2MO1 A;  1EWI A;  3M85 A;  5J3B A;  3L0O A;  4LF5 Q;  1L1O A;  4R1J A;  2ZJQ A;  3S2H H;  1MJE A;  5IYC G;  1VQ4 A;  3HOY G;  2GVA A;  1YBY A;  4O0A A;  1KIX A;  2R7Z G;  1Q12 A;  4A3F H;  3PUW A;  4LF7 Q;  2R93 G;  1EOV A;  4IFD I;  3UDG A;  1VQN A;  1SN8 A;  1XTD A;  4IOC A;  3NEL A;  4YCV A;  1IBK Q;  1W2B A;  5FJ8 G;  1PH7 A;  4IPD A;  1KRT A;  1N32 L;  1J5E Q;  1N36 L;  3GTK H;  1Q82 C;  4EX5 A;  5HY6 A;  3CCR A;  4KHP L;  4RMF A;  1CKN A;  1YHB A;  3PUZ A;  1Q7Y C;  2K5N A;  4Y52 H;  3W1G A;  2JA8 H;  1AE3 A;  5IYB G;  3F1Z A;  3ICE A;  1VQL A;  1KL9 A;  2HHH L;  1SR3 A;  3TRE A;  1VQF A;  5IWA L;  3KOJ A;  2UXB L;  3I2Z A;  5IYB H;  1EIY B;  2PMZ E;  3RR5 A;  2ZTD A;  2LXK A;  2EQS A;  4DV5 L;  4GNX C;  1XPO A;  1XMQ Q;  1BVS A;  1K73 C;  3F2D A;  4DUZ L;  1CSQ A;  4OON A;  2VW9 A;  4IJL A;  1VQ7 A;  2XTI A;  2AHO B;  4LF6 Q;  5FLM H;  1V43 A;  1Q46 A;  3BU2 A;  5FJ8 H;  4PZ8 A;  1KAW A;  5BR8 L;  4BBS H;  3H0G H;  1N9W A;  2F4V L;  4DR3 L;  2ATW A;  2NVT H;  1VQE A;  1C0A A;  4DV2 Q;  4A3F G;  1VQ8 A;  4A3B H;  1HR0 Q;  1WFQ A;  1NY4 A;  3HOY H;  1I50 H;  3FKI H;  2YTV A;  5C3E G;  3KJO A;  1VQ9 A;  1SE8 A;  4JI4 L;  1EYG A;  2CWP A;  3HOZ H;  2PQA A;  4OO1 G;  1GD7 A;  1XPR A;  4HJA A;  2UUB Q;  2NN6 G;  2AKW B;  2C35 B;  2B3G A;  2I5L X;  1Z47 A;  1K8G A;  4WJ3 M;  1CKN B;  1TWH H;  1Y1V H;  1FGU A;  2ID0 A;  1E1T A;  1PV4 A;  3AQQ A;  4BY7 H;  3E9H A;  4APV A;  1E1O A;  3EN2 A;  1VQM A;  1JT8 A;  3M4P A;  3GDE A;  3KDF A;  4L5T A;  3F2B A;  2WP8 J;  1M1K C;  3IRB A;  4R4I A;  1EUJ A;  1E3P A;  5GQO A;  4YWL A;  2D62 A;  5JEA G;  2JE6 I;  5IP7 G;  4OXP A;  2CQO A;  4JOI A;  4LWC A;  4P72 A;  2I0Q A;  3JAM c;  2RCN A;  2E2I H;  4L5R C;  3HOU G;  1PH3 A;  5AJ3 Q;  3RNU A;  3RZO H;  2HIX A;  1FJG L;  1HR0 W;  4NXN L;  3S14 H;  1LYL A;  4MNO A;  1D7Q A;  4HIK A;  2Z0S A;  4NB3 A;  3HOV H;  1U0L A;  2R7F A;  4LUZ A;  4DR5 L;  1GM5 A;  4JI8 Q;  3CAM A;  4IJH A;  4OWX B;  4JBK A;  1FVI A;  5GRO A;  1IBM Q;  1XNQ Q;  2D0P A;  3NEM A;  5GAG C;  1Y1W G;  2NVQ H;  4DR4 L;  1SLJ A;  1LUZ A;  2K14 A;  4LUO A;  4DV7 L;  3S17 H;  3CCU A;  4P71 A;  2VS1 A;  1B70 B;  4IPG A;  3KLW A;  5IT9 c;  4B3R L;  2Q2U A;  1VQK A;  1M90 C;  3CC7 A;  4JI8 L;  1VQA A;  4DR7 Q;  4DR2 L;  4YHH Q;  2CKZ B;  3FP9 A;  1EQQ A;  1N33 Q;  2Q2T A;  1XPU A;  3GTM H;  3PGZ A;  3ZJY C;  1HNX Q;  2F4V Q;  5C0X G;  4DKA C;  2IY5 B;  2N49 A;  3FKI G;  1RL2 A;  3CW2 C;  4IPC A;  1DGS A;  3U58 A;  4O2D A;  2L15 A;  3GTJ H;  4AIM A;  1OXT A;  3A74 A;  4DNI A;  4JI6 Q;  2XGT A;  2NZO A;  4POG A;  3TS2 A;  1H95 A;  1PYS B;  1N34 Q;  5IY0 A;  3H0G G;  4GN5 A;  1VQ6 A;  4BBS G;  4GKK Q;  1X54 A;  4A3E H;  2BA1 A;  5FLM G;  1XJV A;  4A3K H;  3VDY A;  1PA6 A;  4QQB X;  2KBN A;  2HHH Q;  2JJQ A;  5H1S E;  1K83 H;  1HNZ Q;  2KHJ A;  2B63 G;  4GKK L;  4AYB G;  2QEX A;  1A63 A;  3SGI A;  4UPA A;  3G6E A;  4A3J H;  1N8R C;  3EIV A;  3ULJ A;  4LFC Q;  2EIF A;  1PH8 A;  2MNA A;  2UXD Q;  5M3F G;  1C7Y A;  1MKH A;  1Q1B A;  3K80 C;  2UUC L;  1FL0 A;  3STB D;  4A3C H;  3GD7 A;  1CKO A;  1A8V A;  4JCV E;  4L5Q A;  3AYH B;  4JV5 L;  3JAM i;  3PO3 H;  4A3G G;  1JJC B;  3AEV A;  2QGQ A;  3OW2 A;  1VQP A;  1L1O C;  3I4N G;  1WCM G;  2MO0 A;  1LM0 A;  4P75 A;  2I5M X;  1V9P A;  3CC2 A;  4LF5 L;  4P74 A;  3J80 c;  1YJN A;  3UDF A;  3S15 H;  2R7Z H;  2VUM H;  1TWG H;  5GAD C;  1W3S A;  3CCS A;  5HGQ A;  2OTL A;  1JMC A;  2I5H A;  4JV5 Q;  1MJC A;  1IBM L;  1XNQ L;  4LF8 L;  1HNW Q;  4JBM A;  4DV5 Q;  3ULP A;  5C0X J;  1ASY A;  4TVA B;  3NBH B;  2Y0S G;  3I56 A;  3PF5 A;  1JB7 A;  3HOW H;  2Q2I A;  3CCJ A;  4DV7 Q;  4K0K Q;  3KF8 B;  5C0X I;  4EQ5 A;  1A62 A;  4NXN Q;  2DGY A;  4HIM A;  4GNX A;  2AWN A;  3H15 A;  3F2C A;  2Q2H A;  1PHJ A;  1VQG A;  3OYY A;  4A3D H;  4LFB L;  1VCI A;  3K0X A;  1HNZ L;  4AH6 A;  1GO3 E;  5C4J H;  3L7Z C;  3CD6 A;  3S24 A;  4MZ9 A;  3M3Y H;  4BXX H;  2HIV A;  3NEN A;  5LMN W;  1GKH A;  4PZ7 A;  1S40 A;  3W5O A;  1UEB A;  3FHW A;  1PH9 A;  1L2F A;  1Q81 C;  2H5X A;  1YJ9 A;  1N34 L;  1FJG Q;  2VNU D;  4JI1 L;  4JI6 L;  3J81 c;  4LF4 Q;  1X3F A;  1NE3 A;  1S3O A;  1E24 A;  3DM3 A;  3HOX H;  1P16 A;  4YHH L;  3RLO A;  4DR2 Q;  4LFB Q;  4FDB A;  2B29 A;  2RF4 A;  2EXD A;  2F3I A;  2K4K A;  4OWT B;  3H3V I;  2E5L Q;  1I6H H;  2A19 A;  2IHE A;  1HZB A;  4A93 H;  2OQ0 A;  1QZG A;  3HKZ E;  4DAM A;  2UUB L;  4L5S A;  1OXU A;  1PH4 A;  3ER0 A;  1D8L A;  4LW1 A;  4JI4 Q;  4A93 G;  1B8A A;  5JJL A;  4A3M H;  1R9T H;  3S1M H;  3HKS A;  2V1C C;  1WJJ A;  1L1O B;  2ZTC A;  4C3J H;  3CMA A;  4DR5 Q;  4ME3 A;  3EBE A;  1YJW A;  4WJ4 A;  4IO9 A;  2OWO A;  1WI5 A;  4BY1 G;  4DR4 Q;  2ZM6 Q;  2E5L L;  3AFQ A;  4YWM A;  4XTC S;  2AMC B;  5IP9 H;  4A3I H;  4BXX G;  2NN6 I;  4JI1 Q;  4A3D G;  4DUZ Q;  1KQS A;  2JA6 H;  4OO1 I;  2GN5 A;  1VS0 A;  4R4C A;  1J6Q A;  2UUC Q;  1K9M C;  1VQB A;  3PIP A;  5C44 G;  3J7Z C;  2HT1 A;  1G6P A;  3BZC A;  5IWA Q;  5GAE C;  2FXQ A;  4R4T A;  4AYB E;  4DAY B;  4JI7 L;  3KF6 A;  2NZH A;  3GO5 A;  1JJG A;  1YIT A;  1UE1 A;  1PH5 A;  2BH8 A;  2JA9 A;  2K5H A;  1XMQ L;  2IX0 A;  2K5V A;  2Y0S E;  3CF5 A;  4GKJ Q;  4K0K L;  1X3G A;  3D0F A;  1N36 Q;  3I4M H;  2ASB A;  1JJ2 A;  3ERS X;  1EFW A;  5IYD H;  4DV6 Q;  4PZ6 A;  1NMF A;  1NMG A;  2WFW A;  4HID A;  3J81 j;  4DV1 Q;  4HJ8 A;  5C4X G;  3HFZ B;  3CME A;  3CCM A;  3PO2 G;  1HNW L;  2JA5 G;  1VQJ A;  4J15 A;  3LGJ A;  2WB1 E;  4QJF A;  4QGU A;  2VZA A;  2JA7 H;  4JI5 L;  3PO3 G;  4TQU S;  4A3G H;  4A76 A;  2D0O A;  2JA5 H;  2PI2 A;  5M3M G;  4QY7 A;  4BBR G;  3GTL H;  3CCE A;  4LF9 Q;  1HZC A;  1TXY A;  4DK3 C;  2VQF L;  1SFO H;  1N33 L;  1QUQ B;  1Y14 B;  3M4Q A;  4LF6 L;  3I4M G;  4DR7 L;  2ZJR A;  2JQO A;  1YI2 A;  2UXD L;  4B3T L;  4A3J G;  1VQO A;  5C4X H;  4YY3 Q;  2JK8 A;  1K0R A;  5K36 G;  1BBW A;  3JC6 6;  2VQE Q;  3S1R H;  2B63 H;  4DV4 Q;  2OCE A;  2UXB Q;  3I4O A;  4LFC L;  1B7Y B;  1KHI A;  2CWA A;  1VQH A;  2AWO A;  4IFD G;  2KEN A;  1SRO A;  4JI2 Q;  3CPW A;  1BBU A;  2ALY B;  4A4I A;  1TWF H;  2JA6 G;  4JYA L;  1C9O A;  3K7U C;  3OTO L;  4A3L G;  2YU9 H;  3L2P A;  3CC4 A;  2RHQ B;  3PUY A;  3TEH B;  1IXR A;  3TS0 A;  4C2M H;  1YIJ A;  1I5F A;  4X65 Q;  4GOP B;  1IBK L;  1NBW A;  3J81 i;  1LTL A;  5AJ3 L;  4A3I G;  4UP8 A;  1UWV A;  5IP9 G;  4UY8 C;  1AH9 A;  3J7A 5;  3J80 i;  3RN5 A;  3D31 A;  2KHI A;  1JE5 A;  4R4Q A;  1HNX L;  4ALP A;  3K8A A;  5IE8 A;  2E8G A;  3STB C;  2A8V A;  4MTN A;  1QUQ A;  1E22 A;  4A75 A;  2KCM A;  3F8T A;  4LF7 L;  4AQY L;  4A3M G;  4OWW B;  2YV5 A;  1KD1 C;  1X65 A;  3RLF A;  2K50 A;  3H3V H;  2GVB A;  1VQI A;  4B3R Q;  3PUV A;  1IBL Q;  3HOX G;  4R4O A;  5EAY A;  4X6A H;  4X62 L;  1S72 A;  2OTJ A;  2WAQ E;  2LXJ A;  4GLA C;  1GVP A;  3T1H Q;  3CCV A;  4KHZ A;  2DUD A;  1XNR Q;  5FLX c;  3S1N H;  2ZJP A;  4HJ5 A;  4JC0 A;  2N8N A;  3BZK A;  1I3Q H;  1VQC A;  3CCQ A;  5LMN L;  3CCL A;  2Z6K C;  5JJI A;  4DV2 L;  1YZ6 A;  4UP9 A;  4DUY Q;  3HOU H;  4OX9 Q;  4HIO A;  2K75 A;  3CQZ H;  4DR3 Q;  1X55 A;  3M4O H;  1Q86 C;  1UE6 A;  2JEB I;  2YYZ A; 
#chains in the Genus database with same CATH topology
 1PH1 A;  4JG2 A;  1IZ6 A;  1CKM A;  1HQR D;  3NQI A;  3O13 A;  2PMZ B;  5D3D A;  1Y1V B;  3QWN A;  3SHL A;  2IHF A;  3K81 C;  3K6O A;  4AQY Q;  3G48 A;  3M7G A;  5LHY 1;  2UUA Q;  4LNQ A;  4BA1 I;  1U4R A;  1EZ8 A;  4BA2 I;  3E9I A;  4DNT B;  3I72 A;  1RIP A;  5A2Q L;  1JOR A;  3MXN B;  2JEA I;  1L0X B;  3CHB D;  1SFO B;  3T1Y Q;  3GV6 A;  5J39 A;  5A35 A;  2NVY H;  4X65 L;  2WB1 G;  4KI0 A;  3H0G B;  3I4N H;  1WYD A;  4LUV A;  4RG1 A;  4GKJ L;  3ZYY X;  3KDF B;  3OTO Q;  3G7L A;  1C8C A;  3U4Z A;  1X6O A;  1NAP A;  2UXC Q;  4H44 C;  4YCW A;  1BQQ T;  1IKL A;  2JA8 G;  1MSG A;  4JI0 Q;  2LSS A;  4ME5 A;  4GN4 B;  4ZUJ A;  4JBW A;  3UI2 A;  4HJ7 A;  1G51 A;  1PH2 A;  1IL2 A;  4FP5 D;  3GTP H;  1ROD A;  2UXC L;  4A3E G;  1EWH A;  3D4R A;  3OMC A;  4F88 A;  1KDA A;  4HCS A;  1I94 L;  4LFA L;  1Y8N B;  4P73 A;  4OX9 L;  3L3O C;  1TWA H;  2R93 H;  1WTW A;  1UE5 A;  1CUK A;  3A0J A;  4EQP A;  1YNN D;  3NTI A;  4ZLT F;  3IFT A;  4CHT B;  4DR1 L;  4NXM Q;  1V1Q A;  3MC0 B;  1NJI C;  2Z4I A;  4WOR A;  1SE4 A;  5LL6 X;  4KLK A;  2AUJ D;  1EIF A;  2NB0 A;  4NP5 A;  4GOP A;  4LF4 L;  1CA6 A;  2EY6 A;  4B3M L;  1VMC A;  4DR1 Q;  4NXM L;  2R92 G;  3K5O A;  4A93 B;  3GTG H;  1U9R A;  2CFM A;  2DY7 A;  1F9R A;  2FHT A;  3ITP A;  5KEE A;  1JR0 D;  1PFS A;  2F0W A;  1WTV A;  2RVL A;  4LFA Q;  4DPG A;  1I94 Q;  4KKT A;  1RHP A;  1BKB A;  3PF4 A;  3BVZ A;  2Z4H A;  3C46 A;  1PTO B;  4IUR A;  4XQQ A;  3W1B A;  2R92 H;  4BY7 G;  1B44 D;  2BA0 A;  3RN2 A;  4C3H H;  1G8Z D;  4YWK A;  3TQY A;  2BDN A;  3I4L A;  2MQH A;  3UE1 A;  2X69 A;  4BBS B;  1EWI A;  3L0O A;  1WCM B;  2P5Z X;  3KLR A;  4N8F A;  1VQ4 A;  2PW5 A;  3HKZ B;  2SNM A;  4O0A A;  3GTQ B;  2R93 G;  1EOV A;  3HS0 C;  2R93 B;  3NSW A;  1SN8 A;  4IOC A;  2F1M A;  1QCB D;  3NEL A;  1IBK Q;  2F3W A;  5FJ8 G;  1KRT A;  1J5E Q;  3HOX B;  3GTK H;  2F0N A;  4KHP L;  1HQM C;  1U4M A;  3IL8 A;  5COY A;  3X3N A;  1TT2 A;  2EJG C;  1Q7Y C;  2JA8 H;  2EYM A;  1VQL A;  2HHH L;  3TRE A;  3FVQ A;  4C3I B;  2PZT A;  1PXU A;  3ERO A;  3RR5 A;  4GNX C;  1XPO A;  1BVS A;  1K83 B;  3F2D A;  3BS1 A;  3LWU A;  1TQO A;  3K59 A;  2K1B A;  3I91 A;  2EDG A;  4DR3 L;  4BY1 B;  2ATW A;  2NVT H;  1Y8O B;  2D9U A;  4HAE A;  4IUP A;  2WII B;  4C3H B;  5M5W B;  1C0A A;  1VQ8 A;  1HR0 Q;  4K8J A;  2D2C C;  1SE8 A;  3U9O A;  4Q5V A;  1AW7 A;  5EJW A;  2PQA A;  4OO1 G;  1DON A;  4Z9C B;  2UUB Q;  2C35 B;  1FYC A;  2EJF C;  2EYF A;  2E2J B;  3FPU B;  1Z47 A;  4KMU C;  2XIW A;  1CKN B;  4G7H C;  3WOF A;  2ID0 A;  1PV4 A;  3E9H A;  4ZYS A;  1VQM A;  5M5X B;  1D5Z C;  3GDE A;  4XQJ A;  4L5T A;  3F2B A;  1DOM A;  2EYO A;  1M1K C;  3VYU A;  4YWL A;  4BWG B;  4OXP A;  1PRT C;  1D1I A;  2F0T A;  2M2L A;  3D6C A;  1PRT B;  2Z8L A;  1PH3 A;  2A74 C;  3S14 B;  1HR0 W;  1JOO A;  2XVS A;  2F0V A;  3GP7 A;  1DM0 B;  4NB3 A;  3DWP A;  4LUZ A;  4DR5 L;  3CAM A;  1FVI A;  1IBM Q;  2NVQ H;  2VB2 X;  3QG1 A;  1LUZ A;  5G3L F;  1RJT A;  3PIP 3;  1B70 B;  1V8Q A;  4IPG A;  1ILP A;  1M90 C;  2L1B A;  2G9H D;  3HRZ C;  4AYB B;  4JI8 L;  4E6I A;  4DR2 L;  2CKZ B;  4J6H A;  1EQQ A;  1A3U A;  4CJ2 C;  2EOT A;  5C5M A;  3GTM H;  3BVM A;  3PGZ A;  1RDP D;  3JAM L;  2B2U A;  1HNX Q;  4DKA C;  1SYB A;  1STN A;  3H94 A;  1RL2 A;  4GZY C;  3H09 A;  2L15 A;  3GTJ H;  2O5I C;  1BCP D;  4DNI A;  2EZV A;  2NZO A;  1H95 A;  1K8O A;  1GUS A;  1EY7 A;  5CC4 A;  4GN5 A;  1VQ6 A;  3I4N B;  4GKK Q;  2BA1 A;  2EE1 A;  2AQ1 B;  5KNB A;  1LAB A;  1PA6 A;  5H1S E;  1HNZ Q;  2QEX A;  1CFM A;  4UPA A;  3G6E A;  1LT5 D;  1Z7T A;  2A6H C;  2PCF B;  4FF4 A;  2Z9H A;  4PQX A;  2EIF A;  1PTO H;  3E5S A;  3NQT A;  5M3F G;  1C7Y A;  1CKO A;  1A8V A;  4JCV E;  3Q24 A;  4RA8 A;  4G7O C;  5KNC A;  1GUW A;  2O4X A;  1PTO D;  1QIL A;  4PNY A;  3NK9 A;  1PZK D;  4OIK A;  1LTG D;  2CQA A;  4KKS A;  4P75 A;  1CZW A;  3NBI A;  3SVM A;  1ZEQ X;  2VUM H;  1TWG H;  5GAD C;  2OTL A;  1XNQ L;  4LF8 L;  1HNW Q;  3WDN A;  4TVA B;  1JB7 A;  4NMZ A;  1V1P A;  2CH4 A;  3KF8 B;  2H1E A;  5IGF A;  4NXN Q;  4HIM A;  2B63 B;  2AWN A;  4LFB L;  2K5W A;  3K0X A;  5C4J H;  2OEO A;  3S24 A;  3NTK A;  4KY5 A;  2K04 A;  2DNC A;  3QB3 A;  4PZ7 A;  1S40 A;  3FHW A;  1PH9 A;  5C44 B;  2QEJ C;  1Q81 C;  4JI6 L;  3DM3 A;  3GQB A;  2LS0 1;  2B29 A;  4F8M A;  2EXD A;  4OWT B;  5BN3 A;  3H3V I;  2E5L Q;  1LT3 D;  3KLS A;  1STA A;  2PPB C;  4DAM A;  1JWU D;  2UUB L;  4HSP A;  3I8Z A;  1D8L A;  4LW1 A;  2X6G A;  4RKB A;  3K5N A;  1B8A A;  1M4V A;  5JJL A;  5HUR A;  4A3M H;  1L1O B;  3CMA A;  4WJ4 A;  1WI5 A;  4K5X A;  4DR4 Q;  1TR5 A;  2KEC A;  4OEM B;  2E5L L;  1CQF A;  4YWM A;  1SAP A;  2PZW A;  4A3I H;  4BXX G;  2R92 B;  2K32 A;  2J7Z A;  1KQS A;  4R8N A;  5EKI A;  2JA6 H;  1VS0 A;  3K5L A;  1K9M C;  5C4Z A;  3T13 A;  2F0G A;  1EFI D;  2FXQ A;  4R4T A;  5E4W C;  3J80 E;  2QKI C;  5IOD A;  2K5V A;  3HP3 A;  1N36 Q;  2NVX B;  1H9S B;  4M1U B;  4DV1 Q;  1HNW L;  3CME A;  2X6L A;  3FMC A;  1ILQ A;  3I73 A;  4K14 A;  4QGU A;  4A3G H;  1GUO A;  4A76 A;  3GTL H;  1HZC A;  1CHP D;  1XYI A;  1IYV A;  1YI2 A;  4A3J G;  1GUN A;  1GHK A;  1MD2 D;  4KHV A;  3N6R A;  1KHI A;  2KEN A;  1BBU A;  2JA6 G;  1TWF H;  3NUC A;  1RTO A;  3L2P A;  1G91 A;  1UEA B;  3CC4 A;  1FNW A;  3WOE A;  3E3X A;  3OSO A;  1H9S A;  1YIJ A;  2IX3 A;  4X65 Q;  1Y8P B;  3J81 i;  5AJ3 L;  1H9J A;  2HQE A;  4MTK A;  1IHZ A;  1I4X A;  3J80 i;  1BUV T;  3T16 A;  4S3S A;  1JE5 A;  1HNX L;  1EYA A;  4OEL B;  2A8V A;  1SJH D;  3LWE A;  4B9X A;  1KLG D;  1A3T A;  4A75 A;  5ELE A;  5CV6 A;  1F9Q A;  4U68 A;  1HTP A;  1Y69 U;  4R4O A;  1S72 A;  2OTJ A;  2LXJ A;  4GLA C;  4KHZ A;  1F9P A;  4A3E B;  2N8N A;  1LTS D;  1R9T B;  3CCL A;  2RDH A;  2Z6K C;  4DV2 L;  3RZO B;  3HOU H;  1A15 A;  3EFX D;  2KEE A;  1X55 A;  1D5M C;  2F0F A;  1Q86 C;  2L12 A;  1EEI D;  3W2D A;  4HED A;  1PLF A;  4C3I H;  1I6H B;  2Z6K A;  2PQE A;  1AE2 A;  2F03 A;  3KFU A;  4KD4 A;  3NWS A;  4NKL A;  1JWS D;  1RD9 D;  2F0U A;  1YVC A;  1JCK B;  1SYD A;  3HOW G;  2VL6 A;  4CKC A;  3HOZ G;  1X56 A;  3CXC A;  2JSO A;  4PMB A;  2C9O A;  4RGT A;  2WAQ B;  2SOB A;  2YTY A;  3U50 C;  1UE7 A;  3G71 A;  1K3R A;  1O80 A;  4B3S L;  5FO7 B;  1MIU A;  1E7Z A;  4H02 A;  1XWE A;  4DAV A;  3KF6 B;  4ZCK A;  5M3M H;  2EYJ A;  1WCM H;  3AU7 A;  4ZUI A;  1HR0 L;  5M3F H;  5ELN A;  1H9M A;  4A3M B;  1ASZ A;  1F2Z A;  5FO9 B;  1TWG B;  1ENA A;  3PO2 H;  3NPP A;  4JI3 L;  1CSP A;  1TWC H;  1YNX A;  1VQD A;  3PV0 A;  1EEF D;  2F0L A;  1SYF A;  4GLV B;  1BDO A;  4NDX A;  1I4G A;  1ICW A;  2EVB A;  1HFG A;  3MHB A;  3TP5 A;  2Y0S B;  4ID6 A;  4V19 0;  2MUY A;  3S16 H;  1WOC A;  1GUT A;  2K52 A;  3KF8 A;  5CV4 A;  1HJP A;  4GOP C;  2MJ8 A;  4X3K A;  2IW3 A;  2R6G A;  2ZM6 L;  4ZKC B;  4LF9 L;  1W6K A;  3T1H L;  2Q8I B;  2JN4 A;  3MEF A;  2A68 D;  4QUF A;  5EQ0 A;  3HOY B;  4KHP Q;  5I9P A;  4YCU A;  1BO0 A;  4X62 Q;  2RQX A;  1B50 A;  4HMJ A;  3RLN A;  1KNA A;  5ELO A;  3EJI A;  3V2T A;  2R7Z B;  2QDB A;  2F52 A;  5DAU A;  1L0W A;  2ES2 A;  3SR1 A;  4CDE C;  5E3F A;  4GNX B;  4BS9 A;  1QVG A;  3BJU A;  1PZI D;  2UU9 Q;  1D1K A;  1FGB D;  3B6Y A;  1Q8K A;  3M7N A;  3E6Z X;  2G9D A;  2KCT A;  5GAH C;  3NP8 A;  1A0I A;  3T51 B;  1SMX A;  5I4D A;  4IOA A;  1TS3 A;  2IT1 A;  5DEH A;  3GTG B;  4QL5 A;  4A3I B;  1O7Y A;  2BE5 C;  4JYA Q;  2ICE C;  2L5T A;  3I90 A;  3RD4 A;  2F3V A;  4G4K A;  4LF8 Q;  3S1Q H;  2G5D A;  4X3T A;  2B8G A;  4X3U A;  2QA4 A;  1PH6 A;  2WKC A;  2HDM A;  1SE3 A;  2MO1 A;  1F9S A;  1X32 A;  2KCN A;  4LF5 Q;  1KNE A;  4R1J A;  2ZJQ A;  3HEJ A;  1WTR A;  2NVY B;  4H0L C;  2GVA A;  3P75 A;  2R7Z G;  1I4P A;  4EVO A;  3PUW A;  2E2H B;  1XXG A;  3UDG A;  5C3E B;  3CRK C;  3VA5 A;  1SYE A;  4RFB A;  2XRQ D;  5FKA C;  5T1I A;  3C1F A;  3SK6 A;  4EX5 A;  3CCR A;  4RMF A;  3C3L A;  1EQT A;  4DGZ A;  4Y7N B;  3MA2 B;  2K5N A;  4PV1 C;  4IUV A;  1SMY D;  1KL9 A;  1VQF A;  5IWA L;  2UXB L;  5C5L A;  1K73 C;  5EGT A;  4DUZ L;  1SYC A;  3RUZ A;  2VW9 A;  1PRT F;  4IJL A;  1VQ7 A;  1PYW D;  2XTI A;  5FLM H;  1WTX A;  5FJ8 H;  4BBS H;  3H0G H;  2F4V L;  2VUM B;  4J1M A;  3HZX A;  1S5D D;  4A3B H;  1WFQ A;  2YTV A;  5C3E G;  3KJO A;  2K5D A;  4JI4 L;  1EYG A;  3T4A C;  3GTM B;  3VR6 A;  1GD7 A;  5JVG 3;  4HJA A;  4FXD A;  2WV6 D;  1VF5 C;  5FLX L;  3RZD B;  2B3G A;  1TWH H;  1QNU A;  1BBX C;  4BY7 H;  3M4P A;  2A6E C;  3KDF A;  1E3P A;  1EUJ A;  2HUG A;  1V1O A;  2KCC A;  2NUC A;  3MVV A;  5GQO A;  3S2D B;  2CQO A;  4LWC A;  1HXY D;  2RCN A;  3RZO H;  2SNS A;  3R8B A;  1U0L A;  4KY6 A;  2F0Q A;  5JEA H;  4IJH A;  4JBK A;  2D0P A;  4DR4 L;  1U4P A;  2K14 A;  2VB3 X;  4BY7 B;  1F77 A;  2D5D A;  2VS1 A;  5J1Z A;  4FYD A;  3KLW A;  1HUM A;  3VR5 A;  1TY2 A;  3SDZ A;  3GTL B;  3VR4 A;  1XPU A;  3FP9 A;  3GTO B;  4O1N A;  1A2U A;  3C2P A;  4RCN A;  4IPC A;  2I07 B;  1DGS A;  2WAC A;  1DCZ A;  5IT9 E;  2B2V A;  3TS2 A;  4KJN A;  1I6V C;  5I9O A;  1HCZ A;  4RGM A;  3MFY A;  2E2D C;  5JPM C;  5KRU A;  4A3K H;  4QQB X;  4K8I A;  3R2I A;  1K83 H;  4FF2 A;  4AYB G;  4K2K A;  1STG A;  2JA6 B;  4LFC Q;  2I46 A;  3BDL A;  1FL0 A;  4A3C H;  3JAM i;  2EY1 A;  4J8Q A;  4IZ8 A;  3OW2 A;  2K33 A;  1K28 A;  1VQP A;  4MIU A;  1TS5 A;  1SNQ A;  3QJY A;  3CC2 A;  5JAV A;  1NUC A;  3G6J B;  1W3S A;  5HGQ A;  2I5H A;  4JBM A;  1HUN A;  3PIO 3;  2TMP A;  1ZYR C;  2Q2I A;  4K0K Q;  4L8J A;  3TZD A;  4EQ5 A;  1A62 A;  1I4H A;  4H7B A;  3MXU A;  4GNX A;  1VQG A;  5JVH 3;  1HNZ L;  3CD6 A;  1GO3 E;  1DD2 A;  1STB A;  2KA7 A;  3W5O A;  1UEB A;  1FJG Q;  4QIW B;  2PNR C;  4JI1 L;  2KUM A;  2LKV A;  4V0B A;  4LF4 Q;  2F0J A;  3HOW B;  4YHH L;  4DR2 Q;  4LFB Q;  2RF4 A;  2DN8 A;  1I6H H;  2A19 A;  4FNF A;  2QCP X;  1QZG A;  2RA4 A;  4CKE A;  1KAB A;  2F0D A;  1PH4 A;  1EZ6 A;  2MP1 A;  1JWM D;  4A93 G;  2ZXO A;  1QOH A;  2RSO A;  2ZTC A;  5M3M B;  3EBE A;  4IO9 A;  4BY1 G;  1E2Z A;  2K5Q A;  1C48 A;  4CDD C;  3LNN A;  1ESR A;  2AMC B;  4ODG A;  4QMG A;  1IL8 A;  2NN6 I;  4JI1 Q;  4A3D G;  1AFP A;  5C4J B;  4OO1 I;  2GN5 A;  4R4C A;  1VQB A;  1CTM A;  3PIP A;  5C44 G;  1YNJ C;  1G6P A;  3BZC A;  3T53 B;  4AYB E;  4JI7 L;  2NZH A;  5KGU A;  1PH5 A;  2JA9 A;  1XMQ L;  2K5H A;  4CDC C;  2IX0 A;  4L6T B;  1GOZ A;  1SJE D;  3CF5 A;  4TKO B;  4GKJ Q;  1X3G A;  3FEW X;  2ASB A;  1JJ2 A;  1EFW A;  1JC7 A;  5COR A;  1NMG A;  4HID A;  5C4X G;  4WJW A;  1BNZ A;  1FNV A;  1SDF A;  1VQJ A;  4J15 A;  4DAP A;  1I3Q B;  2JA7 H;  3PO3 G;  4TQU S;  2CH4 W;  2FIN B;  2D0O A;  3I3C A;  3K57 A;  2PI2 A;  2JA5 H;  4FXK C;  4LF9 Q;  4CKB A;  3KBX A;  1TXY A;  2VQF L;  2AQ3 B;  5EPK A;  5ISR A;  3P1H A;  5J22 A;  1EY5 A;  3NXW A;  1C4Q A;  5C4X H;  4YY3 Q;  4A3J B;  3S1R H;  2VQE Q;  2B63 H;  4UHV A;  4U67 3;  4DV4 Q;  4LFC L;  2CWA A;  1VQH A;  2AWO A;  5DM7 3;  1SRO A;  2JA7 B;  2ALY B;  2ZT9 C;  2ZXP A;  3K7U C;  2XN9 C;  1IXR A;  5CV5 A;  3TS0 A;  2K05 A;  4C2M H;  1I5F A;  4K6L A;  2XWJ B;  5C0X H;  1IBK L;  5BN4 A;  2F0I A;  5D14 A;  1QB5 D;  4I7A A;  1E2W A;  1SND A;  1MI2 A;  2H4O A;  4C3J G;  1UWV A;  1PMR A;  4UY8 C;  1H9R A;  4EQN A;  1K0S A;  3D31 A;  4R4Q A;  4ALP A;  1U4L A;  2E8G A;  3STB C;  3PQI A;  4O42 A;  1E22 A;  5C4X B;  2KCM A;  3F8T A;  4RKL A;  1KD1 C;  3DUZ A;  1VQI A;  3PUV A;  4K6D A;  1TS2 A;  3T1H Q;  3CCV A;  1XNR Q;  3S1N H;  4A3G B;  3BZK A;  3DEO A;  5JJI A;  1YZ6 A;  3CQZ H;  3M4O H;  2E75 C;  2R7D A;  1O7L A;  2J4X A;  1XMO Q;  1Z6H A;  4B3M Q;  3Q8D A;  2KJX A;  4A3L H;  4DV3 Q;  4ZAI A;  2VQE L;  3H6M A;  2N3S A;  4X66 L;  2WAQ G;  1CT1 D;  5JEA J;  1L0Y B;  2YTX A;  3VYS A;  3UDX A;  1LLR D;  1WTO A;  2FMC A;  3PUX A;  2FFK B;  3OIQ A;  2O5J C;  2OQK A;  2WIN B;  2A1A A;  2VQF Q;  4MHE A;  4RHR A;  3PIO A;  1K8A C;  1QJO A;  1NTG A;  4OHJ A;  1MSH A;  3I55 A;  1JOQ A;  1CM9 A;  2CCZ A;  3J7A V;  4IAL A;  4UAI A;  5M5W H;  1EY0 A;  4C56 C;  1B2T A;  3RMH A;  1ONL A;  4BBR H;  2HD3 A;  4B3S Q;  2B2T A;  1EL0 A;  2RHS B;  5I2Y A;  3DLL A;  1TVX A;  2PNH A;  5E7N A;  1SRU A;  1IW7 D;  1DXM A;  1S5F D;  4A3C G;  2ZTE A;  5E1F A;  4JI7 Q;  3TN2 A;  5IYD G;  1VQ5 A;  4JOI C;  1D2B A;  4DR6 L;  4B08 A;  4DK0 A;  4UP7 A;  1EQR A;  1F2L A;  1SNM A;  3KYH C;  4JI0 L;  4DXG A;  2TSS A;  1YEZ A;  3Q6S A;  2HCC A;  1CA5 A;  4PMC A;  4A3K G;  3R3O A;  1JB3 A;  1QVF A;  4KN4 C;  3OHX C;  5FOB B;  1SYG A;  2HQL A;  4DNR B;  4LMQ D;  2QW7 A;  3A5U A;  5C3W A;  2RCF A;  1WVL A;  1WTP A;  1IBL L;  1UNS A;  1OTC A;  3UE0 A;  1N32 Q;  3PCO B;  4YIJ A;  2FJ2 A;  4IFD J;  5IYC H;  1LTI D;  4DV1 L;  1EU3 A;  3EA6 A;  1SMY C;  1TY0 A;  3TRZ A;  2B2Y A;  4RGO S;  3T1Y L;  1G2T A;  1Y1W H;  1WD1 A;  3Q23 A;  3S2D H;  4X66 Q;  1GUG A;  3HKZ G;  3QOL A;  3OIP A;  3WWV A;  4UDU C;  2MFI A;  5M5X H;  2J0T D;  1PYB A;  1XMO L;  1G29 1;  3GTO H;  5T1G A;  2V4D A;  4JK1 C;  4DV3 L;  1MGS A;  2RDF A;  3RZD H;  1S5C D;  1T9H A;  1P8L A;  4JI2 L;  2UXD Q;  2ZXR A;  3BVG A;  3DHQ A;  1HH2 P;  3HOZ B;  3KJP A;  1QZH A;  1Z9F A;  1ESF A;  3D4W A;  1O7I A;  1Q1E A;  1Y1V G;  4HTH A;  2EYP A;  3PO2 B;  1OXS C;  2BCO A;  3P20 A;  4DR6 Q;  4JPB W;  3S2H B;  1QNK A;  3DXJ C;  4RH6 A;  1A6X A;  1VMP A;  3M85 A;  1L1O A;  4DA2 A;  3S2H H;  2E76 C;  4BBR B;  5IYC G;  3HGB A;  3A55 A;  5I6W A;  1KIX A;  3GTJ B;  1Q12 A;  4LF7 Q;  1VQN A;  1FNU A;  4YCV A;  1PH7 A;  4IPD A;  1TWH B;  1N36 L;  4IQZ A;  5HY6 A;  1LO5 D;  4IN3 A;  2JP1 A;  1CKN A;  1YHB A;  4Y52 H;  3OPO A;  3W1G A;  3ICE A;  1SXT A;  1SR3 A;  2KHS A;  2DNE A;  3KOJ A;  4XQN A;  2CW0 C;  1ML0 D;  2EYH A;  5IYB H;  2ZTD A;  2LXK A;  2EQS A;  3TZU A;  2AUK A;  2F4I A;  4JW0 A;  3I70 A;  1PTO C;  4LF6 Q;  3AMU A;  2DY8 A;  1KDC A;  1V43 A;  2M00 A;  1KAW A;  3FDT A;  2NWG A;  1N9W A;  1AEX A;  1VQE A;  2O2L D;  4ZQ3 A;  5IT9 L;  1EYC A;  1BCP B;  4A3F G;  3HG9 A;  1BCP F;  2MHV A;  5HGT A;  1NY4 A;  3HOY H;  2F0E A;  3FKI H;  3W3A A;  4DF7 A;  1JOK A;  3SXH A;  1VQ9 A;  2CWP A;  1ICF B;  2RBM A;  2XWB B;  1XPR A;  2NN6 G;  2A73 B;  2IL8 A;  4I7Z C;  5M5Y B;  2EXZ A;  2I5L X;  1K8G A;  2FMM A;  3GTK B;  4WJ3 M;  4XYQ A;  3EQL C;  1E1T A;  3AQQ A;  3S17 B;  2OT2 A;  1E1O A;  3EN2 A;  4APV A;  5DM6 3;  1JT8 A;  1S4Z A;  2WP8 J;  4KTA A;  4CJ1 B;  5IP7 G;  2JE6 I;  1GXD C;  4JOI A;  4P72 A;  2I0Q A;  4A3K B;  4L5R C;  2EYL A;  4K5W A;  1Y1W B;  2HIX A;  4NXN L;  4EQO A;  4MNO A;  1D7Q A;  2Z0S A;  2LY7 A;  3HOV H;  2IPK D;  3S1Q B;  4N9P A;  4JI8 Q;  3S1R B;  4RHS A;  2IWH A;  1XNQ Q;  5GRO A;  3NEM A;  1NSN S;  3OMG A;  1EIH A;  1SLJ A;  3S17 H;  4P71 A;  2F0P A;  4ZK9 B;  5C4H A;  5IT9 c;  4B3R L;  2Q2U A;  1VQK A;  3QIA A;  1YNN C;  5IGB A;  3CC7 A;  1AN8 A;  3MWY W;  4ILW A;  4DR7 Q;  2CHB D;  3D6W A;  4YHH Q;  1ET6 A;  1PRT D;  4JVZ A;  3ZJY C;  2F4V Q;  2NVQ B;  1CK1 A;  2BOS A;  5C0X G;  4CJ0 B;  4NW2 A;  2N49 A;  3FKI G;  4A3B B;  2IY5 B;  3CW2 C;  2DJG C;  2GA4 B;  4AIM A;  3A74 A;  2EJM A;  1PYS B;  2IJ0 A;  1W6J A;  5IY0 A;  2XNA C;  1B9N A;  4KV6 A;  1A2T A;  3BYY B;  1X54 A;  1XJV A;  3VDY A;  2KBN A;  4GKK L;  2KHJ A;  1SNP A;  3FRP B;  1QE6 A;  3A8K E;  2B63 G;  1A63 A;  3SGI A;  4FO2 A;  1N8R C;  4QF4 A;  4KKU A;  3ULJ A;  1RTN A;  4C1N I;  1J9O A;  1PH8 A;  1WTH A;  1H9K A;  1MKH A;  1Q1B A;  3K80 C;  4X3S A;  2UUC L;  3STB D;  3ONA B;  3DM1 A;  3AYH B;  4JV5 L;  3PO3 H;  3AEV A;  1AZP A;  2QGQ A;  1L1O C;  5EPL A;  1WCM G;  1LM0 A;  1K8M A;  5IOC A;  4G7Z C;  4LF5 L;  2R61 A;  5EBC A;  1YJN A;  4XXE A;  3UDF A;  3VR3 A;  3CCS A;  2WKD A;  1JMC A;  1MJC A;  1IBM L;  5CGK A;  1TWF B;  3H91 A;  3KUP A;  5M3F B;  5KIX A;  5FLX E;  3ULP A;  1E2V A;  3NBH B;  2Y0S G;  3I56 A;  3HOW H;  2SDF A;  4IUQ A;  3CCJ A;  3OOC A;  5ELF A;  5K5P A;  5C0X I;  2E74 C;  1BCP C;  1SNC A;  1SEB D;  4P2C B;  3H15 A;  2Q2H A;  1PHJ A;  3OYY A;  2VXW A;  4A3D H;  5M9O A;  1VCI A;  4AH6 A;  4FVM A;  5LMN W;  1SNO A;  1L2F A;  2H5X A;  1N34 L;  1LAC A;  2VNU D;  3OW7 A;  4WRD A;  3J81 c;  3HOX H;  3GV3 A;  1X3Q A;  3RLO A;  4FDB A;  4FXG C;  1KLU D;  1UAP A;  3MXN A;  2IHE A;  4A93 H;  2OQ0 A;  2A6E D;  3HKZ E;  1PFB A;  2CW0 D;  4L5S A;  1OXU A;  4CGY B;  1ENF A;  3ER0 A;  1WTQ A;  1XX8 A;  3I4M B;  3DEP A;  5IGD A;  1IKM A;  3A8I E;  3C1E A;  1R9T H;  1CZG A;  3S1M H;  3NBH A;  1BF4 A;  1YJW A;  2OWO A;  3Q22 A;  3NTH A;  2ZM6 Q;  3AFQ A;  4XTC S;  2F0K A;  1BOS A;  2CVR A;  4IFD H;  3J7Z C;  5GAE C;  4DAY B;  2B2W C;  2JA5 B;  3KF6 A;  1ZKO A;  3TSS A;  2EY2 A;  2BH8 A;  1CI3 M;  3VYT A;  3I4M H;  3VA7 A;  5IYD H;  1R4P B;  1NMF A;  1AZQ A;  4R9W A;  3J81 j;  4HJ8 A;  4KK7 A;  5CBE E;  3CCM A;  1KDB A;  2L4N A;  2KED A;  4QJF A;  3LGJ A;  4LK1 C;  2WB1 E;  4OL7 A;  2VZA A;  2L11 A;  5CR3 A;  4QY7 A;  4BBR G;  1SFO H;  1T5E A;  1N33 L;  1QUQ B;  3M4Q A;  3I4M G;  2ZJR A;  2JQO A;  3F2U A;  3SK5 A;  2L9H A;  1VQO A;  4ZKB B;  1BBW A;  3JC6 6;  3NE5 B;  2OCE A;  2UXB Q;  3S16 B;  1B7Y B;  4IFD G;  3A7L A;  4JI2 Q;  3CPW A;  1STY A;  5IIF A;  1C9O A;  3OTO L;  4A3L G;  2E2I B;  2YU9 H;  4F87 A;  3PUY A;  1PFM A;  2B2W A;  4MN3 A;  3QR8 A;  1JQY D;  1ZXT A;  1STE A;  4A3I G;  1B4O A;  4L63 B;  5LL6 S;  3R93 A;  5L37 A;  3J81 L;  1AH9 A;  3S1N B;  1EIG A;  2NTT A;  2KHI A;  1EY4 A;  2Z1C A;  1QG7 A;  1QUQ A;  4H13 C;  1MHW C;  1B53 A;  4AQY L;  4A3M G;  1X65 A;  2K50 A;  2GVB A;  3D4D A;  3MXG A;  4HCE A;  1IBL Q;  4B3R Q;  1XTC D;  2XSC A;  3HOX G;  5EAY A;  1FD7 D;  1LTB D;  2EPB A;  2K28 A;  4HSV A;  2DUD A;  4HJ5 A;  2KVM A;  2R3Z A;  4DN4 M;  2PO4 A;  3TDQ A;  3CCQ A;  4UP9 A;  3OWE B;  1NR2 A;  4OX9 Q;  2K75 A;  1LTA D;  1HFN A;  4C2M B;  1UE6 A;  3D3R A;  2JEB I;  2YYZ A;  5BR8 Q;  3I7F A;  3R2T A;  5LMU Q;  4QIW E;  4NPS A;  1YHQ A;  3CQZ B;  4IUU A;  4K2L A;  2B2V C;  3VR2 A;  4KY7 A;  2N78 A;  4DK1 A;  1EWC A;  1BXT A;  5FK9 C;  1HA6 A;  3CPF A;  1VDZ A;  3KLS X;  1ET9 A;  5C3E H;  1OXV A;  2Q8R E;  3M3Y B;  2PQA B;  3M9B A;  2SEB D;  3FKI B;  4A3B G;  2VUM G;  5BN5 A;  3A5Z B;  2E2H H;  2AQ2 B;  1EQV A;  5IGE A;  3GTQ H;  3G4S A;  4GLX A;  1YNJ D;  5DNF A;  4DAY A;  3TP7 A;  3HOV B;  1NNX A;  2HCI A;  2HDL A;  2JA7 G;  2UUA L;  2PZU A;  3V05 A;  4DV0 Q;  4OGQ C;  1KRS A;  1S5E D;  1DZ1 A;  3S15 B;  3CKI B;  5E4X A;  2B2T C;  2YU9 B;  2RKS A;  4DV4 L;  4X64 Q;  4JI3 Q;  1HZ9 A;  2BH2 A;  4KN7 C;  2A69 C;  2JA8 B;  5CV9 A;  4DFA A;  4GS3 A;  4XIG S;  2BE5 D;  4JBJ A;  4DV0 L;  1E0B A;  5EPJ A;  2E2J H;  2MGS A;  4DU9 A;  5C44 H;  2RSN A;  1KC8 C;  1I4Q A;  3PMF A;  1TU2 B;  5JJK A;  1YHA A;  4KJO A;  1CQV A;  4CDF C;  4JI5 Q;  4DUY L;  5TSS A;  5LMN Q;  1J5E L;  1RF2 D;  5IGG A;  4A3F B;  4G57 A;  5I2X A;  5CBA E;  3AFP A;  3PSI A;  2UU9 L;  4BY1 H;  2EY5 A;  1U5K A;  1XNR L;  4PMW A;  2KQ3 A;  4HR7 B;  5FO8 B;  2PYK A;  4DV6 L;  3MXP A;  4HJ9 A;  1OXX K;  2PI2 E;  3SK4 A;  2QDL A;  3TP6 A;  4POF A;  1QVC A;  2NVX H;  4B9W A;  3J7Y W;  1M8A A;  1HZA A;  1TWA B;  4KD3 A;  3HOV G;  1PDQ A;  2B2U C;  2WB1 B;  3NHH A;  4FF3 A;  1G6Z A;  1X3E A;  1IYJ B;  1HTL D;  5EBD A;  1S5B D;  1K3B C;  1EOT A;  1TS4 A;  4Y7N H;  1RKN A;  2LMC B;  3K7A H;  3CP0 A;  4GN3 B;  3E0E A;  1FR3 A;  3NWT A;  5M5Y H;  3K7A B;  5IP7 H;  5LMU L;  2VY3 A;  2UXD L;  1EU4 A;  4IPH A;  3BZD B;  2IX1 A;  3OWF A;  3UDI A;  3J81 E;  1X9N A;  5DLQ E;  1D5X C;  1KXL A;  2F0M A;  4PG3 A;  3U4V A;  1II3 A;  4YY3 L;  2NBF A;  1PVO A;  4B3T Q;  4QCL A;  3ULL A;  4X64 L;  2NN6 H;  4DK6 C;  4C3J B;  5CYU A;  3S1M B;  2A68 C;  3ND9 A;  5J3B A;  1MJE A;  3SEB A;  3BYT B;  1TKW B;  3MTS A;  1O78 A;  3HOY G;  3JAM E;  1YBY A;  4A3F H;  4IFD I;  4OO1 H;  1XTD A;  4Q0F A;  1W2B A;  1IW7 C;  1N32 L;  1SE2 A;  1Q82 C;  2K03 A;  1MBY A;  3PUZ A;  4HN7 A;  1AE3 A;  1F2M A;  3F1Z A;  5C3X A;  5IYB G;  3I2Z A;  1EIY B;  2PMZ E;  1TWC B;  4DV5 L;  1XMQ Q;  3A56 A;  1CSQ A;  1EY9 A;  4OON A;  4ZRZ A;  1B9M A;  2AHO B;  5IGC A;  3MEH A;  3IAY A;  1Q46 A;  5EKK A;  3SK8 A;  3BU2 A;  5F2D A;  2KOL A;  4PZ8 A;  5BR8 L;  5KYL A;  3T56 B;  4HMI A;  3DWA A;  2JXM B;  5ELD A;  5KYI A;  5ELB A;  2QIL A;  4DV2 Q;  1B1Z A;  4QB4 A;  3LX0 A;  1I50 H;  4TSS A;  2C5C A;  2K6A A;  3HOZ H;  1Q90 A;  5JPN C;  3ND8 A;  4IUT A;  2AKW B;  1GHJ A;  4CBV A;  3SE0 A;  1DJR D;  1DOK A;  4C1N K;  1Y1V H;  1FGU A;  1STH A;  1HRJ A;  1EYD A;  3IRB A;  4OIJ A;  4R4I A;  4XYO A;  4C3H G;  2D62 A;  5JEA G;  1PTO F;  3HOU G;  2K01 A;  3JAM c;  2E2I H;  5AJ3 Q;  3RNU A;  1TII D;  1FJG L;  1LTT D;  5KND A;  3S14 H;  1LYL A;  3EVQ A;  1T5X D;  4HIK A;  2R7F A;  2JYO A;  1AP0 A;  4N9T A;  1GM5 A;  2NTS A;  1LTR D;  4OWX B;  4RWS C;  3A8J E;  5GAG C;  1Y1W G;  4LUO A;  1X3P A;  4DV7 L;  3N52 A;  3CCU A;  3E0J A;  5CV7 A;  1A3V A;  3CU7 A;  2F0O A;  3K5M A;  1LT6 D;  1PZJ D;  3P7J A;  1D6E C;  3TME A;  1VQA A;  1N33 Q;  2Q2T A;  3URY A;  1IYU A;  1I50 B;  1R4Q B;  3J7A F;  2N55 A;  3U58 A;  4O2D A;  1OXT A;  4JI6 Q;  2XGT A;  4I65 A;  4POG A;  3MFG A;  1Q8I A;  1N34 Q;  2A69 D;  3H0G G;  3IKJ A;  4BBS G;  4A3E H;  5G3L D;  5FLM G;  2HHH Q;  2JJQ A;  5JJZ A;  2Z6B A;  4A3J H;  3EIV A;  4TRD A;  2MNA A;  4EGV A;  3D8G A;  1WD0 A;  2N88 A;  2BDO A;  4LAA A;  3GD7 A;  4L5Q A;  4A3G G;  1JJC B;  4F7X A;  4XT3 B;  1I4R A;  4QUC A;  3I4N G;  2MO0 A;  2I5M X;  1V9P A;  5I6Y A;  4P74 A;  3J80 c;  3S15 H;  1JE4 A;  3M4O B;  1HPC A;  2R7Z H;  2NVT B;  3S9W A;  2OXP A;  4JV5 Q;  3HOU B;  3DWQ A;  1RCV D;  4DV5 Q;  5C0X J;  1ASY A;  1HHV A;  5ELC A;  1OO9 B;  5CMD A;  3PF5 A;  4DV7 Q;  1Q3L A;  3A54 A;  4XDX A;  2DGY A;  2Q8T A;  1GJX A;  3F2C A;  2ENB A;  2A5H A;  4DXF A;  3M3Y H;  4BXX H;  3L7Z C;  4MZ9 A;  2HIV A;  1PFN A;  3NEN A;  2L55 A;  1GKH A;  4FF1 A;  2NZ1 D;  1YJ9 A;  2ICI A;  1X3F A;  1NE3 A;  1S3O A;  1E24 A;  1P16 A;  4RCO A;  2F3I A;  2K4K A;  2PW7 A;  2MPM A;  3K0Y A;  2RDG A;  1HZB A;  3TP8 A;  2XRS D;  2L0C A;  1F2Y A;  2NYZ D;  5NUC A;  4JI4 Q;  3M4Y A;  3J80 L;  1QWY A;  3HKS A;  2V1C C;  1WJJ A;  4DR5 Q;  4C3J H;  4ME3 A;  3BDC A;  3PO3 B;  3QOJ A;  2B39 A;  2OF1 A;  3BG3 A;  5CV8 A;  3DMU A;  3U9S A;  5IP9 H;  4N8X 1;  1UUP A;  2M9V A;  4DUZ Q;  2F0H A;  3KBG A;  1G2S A;  1J6Q A;  2UUC Q;  1LV9 A;  3A7A B;  5AFW A;  2HT1 A;  1BR9 A;  5IWA Q;  3GTP B;  1B3A A;  3GO5 A;  1JJG A;  4XT1 B;  1UE1 A;  1YIT A;  2Y0S E;  1EY8 A;  4K0K L;  2B8F A;  3D0F A;  3ERS X;  4DV6 Q;  4PZ6 A;  1LT4 D;  3H3V C;  2WFW A;  5K36 H;  1JIC A;  3HFZ B;  3PO2 G;  5D65 A;  2JA5 G;  1O7Z A;  1CHQ D;  4JI5 L;  5M3M G;  3CCE A;  2DJF C;  5JOB A;  3FPP A;  4DK3 C;  3MAQ A;  3MZ5 A;  1NR4 A;  1Y14 B;  3AB9 A;  4LF6 L;  4DR7 L;  4B3T L;  2JK8 A;  1K0R A;  5K36 G;  1ENC A;  3I4O A;  4RAU C;  3CRL C;  2LFN A;  5A2Q E;  4K5V A;  3Q0A A;  4A4I A;  5C6A A;  4RGN A;  4JYA L;  1EY6 A;  1DOL A;  1ZYR D;  4C3I G;  2RHQ B;  4M8A A;  3TEH B;  3BDO A;  4GOP B;  1NBW A;  1LTL A;  1HA5 A;  1SBB B;  3L9A X;  4UP8 A;  2K7V A;  3QO2 A;  3VYR A;  2A6H D;  5IP9 G;  4ABN A;  5D3I B;  3J7A 5;  3RN5 A;  2QF7 A;  1KAA A;  1J8I A;  1B3Q A;  2F0S A;  3K8A A;  3V96 A;  5IE8 A;  4MTN A;  2B2Y C;  1DYQ A;  4LF7 L;  3K58 A;  4OWW B;  1KTK A;  2YV5 A;  5EKL A;  4IUN A;  1NCV A;  3RLF A;  4A3D B;  4LJZ C;  3H3V H;  3KK7 A;  1SSO A;  4X6A H;  4X62 L;  4R8I A;  2WAQ E;  1GVP A;  1VF7 A;  5FLX c;  2ZJP A;  4JC0 A;  4WFN 3;  1I3Q H;  1VQC A;  3X3M A;  5LMN L;  4DUY Q;  4HIO A;  4ULL A;  1V1P B;  4DR3 Q;  3ERQ A;  3IFD A;  3TBI B; 
#chains in the Genus database with same CATH homology
 2R7D A;  5BR8 Q;  1XMO Q;  3I7F A;  5LMU Q;  1PH1 A;  4QIW E;  4NPS A;  1YHQ A;  4JG2 A;  1IZ6 A;  4B3M Q;  4C3I H;  3Q8D A;  1CKM A;  2Z6K A;  4A3L H;  4DV3 Q;  2VQE L;  2N78 A;  1AE2 A;  2N3S A;  4X66 L;  3KFU A;  2WAQ G;  5JEA J;  2IHF A;  1YVC A;  2YTX A;  3K81 C;  3UDX A;  4AQY Q;  3PUX A;  3G48 A;  3CPF A;  2UUA Q;  4LNQ A;  2OQK A;  4BA1 I;  3HOW G;  2VL6 A;  4BA2 I;  3E9I A;  2A1A A;  2VQF Q;  3HOZ G;  1X56 A;  3CXC A;  3PIO A;  1RIP A;  1K8A C;  5C3E H;  1NTG A;  1OXV A;  3I55 A;  2PQA B;  3M9B A;  3MXN B;  4A3B G;  2CCZ A;  2JEA I;  2VUM G;  3U50 C;  2YTY A;  3A5Z B;  3T1Y Q;  1UE7 A;  2E2H H;  3G71 A;  5M5W H;  1K3R A;  3GTQ H;  3G4S A;  4GLX A;  4B3S L;  1MIU A;  1E7Z A;  2NVY H;  4H02 A;  3KF6 B;  4X65 L;  4BBR H;  2WB1 G;  4KI0 A;  5M3M H;  4B3S Q;  1WCM H;  2RHS B;  1WYD A;  4LUV A;  1HR0 L;  5M3F H;  3I4N H;  4RG1 A;  5ELN A;  2PNH A;  5E7N A;  3DLL A;  2UUA L;  2JA7 G;  1SRU A;  1ASZ A;  4GKJ L;  3KDF B;  3OTO Q;  4DV0 Q;  3U4Z A;  1KRS A;  3PO2 H;  4A3C G;  2ZTE A;  1X6O A;  4JI3 L;  1CSP A;  1TWC H;  1YNX A;  4JI7 Q;  1VQD A;  2UXC Q;  5IYD G;  3PV0 A;  4JOI C;  1VQ5 A;  4DV4 L;  4X64 Q;  4YCW A;  4DR6 L;  4GLV B;  4UP7 A;  1EQR A;  4JI3 Q;  1HZ9 A;  2JA8 G;  4JI0 Q;  2BH2 A;  4IFD J;  2LSS A;  4GN4 B;  3KYH C;  4GS3 A;  4XIG S;  4JBW A;  4JBJ A;  4HJ7 A;  1G51 A;  1PH2 A;  4DV0 L;  4JI0 L;  1IL2 A;  1YEZ A;  3GTP H;  1WOC A;  2K52 A;  3S16 H;  2E2J H;  1HJP A;  4GOP C;  4A3K G;  5C44 H;  2UXC L;  2R6G A;  4A3E G;  1QVF A;  1KC8 C;  2ZM6 L;  4LF9 L;  2HQL A;  3T1H L;  3MEF A;  1I94 L;  1YHA A;  4LFA L;  3A5U A;  5JJK A;  4P73 A;  4OX9 L;  4JI5 Q;  1TWA H;  4DUY L;  4KHP Q;  2R93 H;  1IBL L;  5LMN Q;  1J5E L;  1OTC A;  3UE0 A;  1N32 Q;  1UE5 A;  1CUK A;  3A0J A;  3PCO B;  4YCU A;  3AFP A;  5IYC H;  3PSI A;  2UU9 L;  4BY1 H;  1XNR L;  1U5K A;  4DV1 L;  4DR1 L;  4PMW A;  4NXM Q;  1V1Q A;  1NJI C;  4X62 Q;  4DV6 L;  3TRZ A;  4HJ9 A;  3T1Y L;  1OXX K;  2PI2 E;  3RLN A;  5ELO A;  4KLK A;  4POF A;  1Y1W H;  1QVC A;  3S2D H;  2F52 A;  1L0W A;  2ES2 A;  4X66 Q;  2NVX H;  3HKZ G;  1EIF A;  4GNX B;  1HZA A;  3WWV A;  4GOP A;  1QVG A;  2MFI A;  4LF4 L;  4B3M L;  3HOV G;  4DR1 Q;  3BJU A;  5M5X H;  4NXM L;  2R92 G;  2UU9 Q;  1PYB A;  1X3E A;  1XMO L;  1IYJ B;  1G29 1;  3GTG H;  3GTO H;  2CFM A;  3B6Y A;  4Y7N H;  3K7A H;  1Q8K A;  3CP0 A;  4DV3 L;  1PFS A;  4GN3 B;  3M7N A;  3E0E A;  5M5Y H;  3RZD H;  4LFA Q;  4DPG A;  2KCT A;  5GAH C;  5IP7 H;  1T9H A;  1I94 Q;  1A0I A;  5LMU L;  1BKB A;  1P8L A;  1SMX A;  2VY3 A;  4JI2 L;  3PF4 A;  4IOA A;  2IT1 A;  1HH2 P;  4IPH A;  2IX1 A;  4QL5 A;  3W1B A;  3UDI A;  3KJP A;  1QZH A;  2R92 H;  1X9N A;  1Z9F A;  5DLQ E;  4BY7 G;  1KXL A;  4JYA Q;  1O7I A;  1Q1E A;  1Y1V G;  2BA0 A;  4PG3 A;  3U4V A;  3RN2 A;  4YY3 L;  1PVO A;  4C3H H;  4LF8 Q;  4YWK A;  4B3T Q;  3TQY A;  3S1Q H;  1OXS C;  2QA4 A;  3UE1 A;  2MQH A;  3ULL A;  1PH6 A;  4X64 L;  4DR6 Q;  4DK6 C;  2MO1 A;  1EWI A;  3M85 A;  5J3B A;  3L0O A;  4LF5 Q;  1L1O A;  4R1J A;  2ZJQ A;  3S2H H;  1MJE A;  5IYC G;  1VQ4 A;  3HOY G;  2GVA A;  1YBY A;  4O0A A;  1KIX A;  2R7Z G;  1Q12 A;  4A3F H;  3PUW A;  4LF7 Q;  2R93 G;  1EOV A;  4IFD I;  3UDG A;  1VQN A;  1SN8 A;  1XTD A;  4IOC A;  3NEL A;  4YCV A;  1IBK Q;  1W2B A;  5FJ8 G;  1PH7 A;  4IPD A;  1KRT A;  1N32 L;  1J5E Q;  1N36 L;  3GTK H;  1Q82 C;  4EX5 A;  5HY6 A;  3CCR A;  4KHP L;  4RMF A;  1CKN A;  1YHB A;  3PUZ A;  1Q7Y C;  2K5N A;  4Y52 H;  3W1G A;  2JA8 H;  1AE3 A;  5IYB G;  3F1Z A;  3ICE A;  1VQL A;  1KL9 A;  2HHH L;  1SR3 A;  3TRE A;  1VQF A;  5IWA L;  3KOJ A;  2UXB L;  3I2Z A;  5IYB H;  1EIY B;  2PMZ E;  3RR5 A;  2ZTD A;  2LXK A;  2EQS A;  4DV5 L;  4GNX C;  1XPO A;  1XMQ Q;  1BVS A;  1K73 C;  3F2D A;  4DUZ L;  1CSQ A;  4OON A;  2VW9 A;  4IJL A;  1VQ7 A;  2XTI A;  2AHO B;  4LF6 Q;  5FLM H;  1V43 A;  1Q46 A;  3BU2 A;  5FJ8 H;  4PZ8 A;  1KAW A;  5BR8 L;  4BBS H;  3H0G H;  1N9W A;  2F4V L;  4DR3 L;  2ATW A;  2NVT H;  1VQE A;  1C0A A;  4DV2 Q;  4A3F G;  1VQ8 A;  4A3B H;  1HR0 Q;  1WFQ A;  1NY4 A;  3HOY H;  1I50 H;  3FKI H;  2YTV A;  5C3E G;  3KJO A;  1VQ9 A;  1SE8 A;  4JI4 L;  1EYG A;  2CWP A;  3HOZ H;  2PQA A;  4OO1 G;  1GD7 A;  1XPR A;  4HJA A;  2UUB Q;  2NN6 G;  2AKW B;  2C35 B;  2B3G A;  2I5L X;  1Z47 A;  1K8G A;  4WJ3 M;  1CKN B;  1TWH H;  1Y1V H;  1FGU A;  2ID0 A;  1E1T A;  1PV4 A;  3AQQ A;  4BY7 H;  3E9H A;  4APV A;  1E1O A;  3EN2 A;  1VQM A;  1JT8 A;  3M4P A;  3GDE A;  3KDF A;  4L5T A;  3F2B A;  2WP8 J;  1M1K C;  3IRB A;  4R4I A;  1EUJ A;  1E3P A;  5GQO A;  4YWL A;  2D62 A;  5JEA G;  2JE6 I;  5IP7 G;  4OXP A;  2CQO A;  4JOI A;  4LWC A;  4P72 A;  2I0Q A;  3JAM c;  2RCN A;  2E2I H;  4L5R C;  3HOU G;  1PH3 A;  5AJ3 Q;  3RNU A;  3RZO H;  2HIX A;  1FJG L;  1HR0 W;  4NXN L;  3S14 H;  1LYL A;  4MNO A;  1D7Q A;  4HIK A;  2Z0S A;  4NB3 A;  3HOV H;  1U0L A;  2R7F A;  4LUZ A;  4DR5 L;  1GM5 A;  4JI8 Q;  3CAM A;  4IJH A;  4OWX B;  4JBK A;  1FVI A;  5GRO A;  1IBM Q;  1XNQ Q;  2D0P A;  3NEM A;  5GAG C;  1Y1W G;  2NVQ H;  4DR4 L;  1SLJ A;  1LUZ A;  2K14 A;  4LUO A;  4DV7 L;  3S17 H;  3CCU A;  4P71 A;  2VS1 A;  1B70 B;  4IPG A;  3KLW A;  5IT9 c;  4B3R L;  2Q2U A;  1VQK A;  1M90 C;  3CC7 A;  4JI8 L;  1VQA A;  4DR7 Q;  4DR2 L;  4YHH Q;  2CKZ B;  3FP9 A;  1EQQ A;  1N33 Q;  2Q2T A;  1XPU A;  3GTM H;  3PGZ A;  3ZJY C;  1HNX Q;  2F4V Q;  5C0X G;  4DKA C;  2IY5 B;  2N49 A;  3FKI G;  1RL2 A;  3CW2 C;  4IPC A;  1DGS A;  3U58 A;  4O2D A;  2L15 A;  3GTJ H;  4AIM A;  1OXT A;  3A74 A;  4DNI A;  4JI6 Q;  2XGT A;  2NZO A;  4POG A;  3TS2 A;  1H95 A;  1PYS B;  1N34 Q;  5IY0 A;  3H0G G;  4GN5 A;  1VQ6 A;  4BBS G;  4GKK Q;  1X54 A;  4A3E H;  2BA1 A;  5FLM G;  1XJV A;  4A3K H;  3VDY A;  1PA6 A;  4QQB X;  2KBN A;  2HHH Q;  2JJQ A;  5H1S E;  1K83 H;  1HNZ Q;  2KHJ A;  2B63 G;  4GKK L;  4AYB G;  2QEX A;  1A63 A;  3SGI A;  4UPA A;  3G6E A;  4A3J H;  1N8R C;  3EIV A;  3ULJ A;  4LFC Q;  2EIF A;  1PH8 A;  2MNA A;  2UXD Q;  5M3F G;  1C7Y A;  1MKH A;  1Q1B A;  3K80 C;  2UUC L;  1FL0 A;  3STB D;  4A3C H;  3GD7 A;  1CKO A;  1A8V A;  4JCV E;  4L5Q A;  3AYH B;  4JV5 L;  3JAM i;  3PO3 H;  4A3G G;  1JJC B;  3AEV A;  2QGQ A;  3OW2 A;  1VQP A;  1L1O C;  3I4N G;  1WCM G;  2MO0 A;  1LM0 A;  4P75 A;  2I5M X;  1V9P A;  3CC2 A;  4LF5 L;  4P74 A;  3J80 c;  1YJN A;  3UDF A;  3S15 H;  2R7Z H;  2VUM H;  1TWG H;  5GAD C;  1W3S A;  3CCS A;  5HGQ A;  2OTL A;  1JMC A;  2I5H A;  4JV5 Q;  1MJC A;  1IBM L;  1XNQ L;  4LF8 L;  1HNW Q;  4JBM A;  4DV5 Q;  3ULP A;  5C0X J;  1ASY A;  4TVA B;  3NBH B;  2Y0S G;  3I56 A;  3PF5 A;  1JB7 A;  3HOW H;  2Q2I A;  3CCJ A;  4DV7 Q;  4K0K Q;  3KF8 B;  5C0X I;  4EQ5 A;  1A62 A;  4NXN Q;  2DGY A;  4HIM A;  4GNX A;  2AWN A;  3H15 A;  3F2C A;  2Q2H A;  1PHJ A;  1VQG A;  3OYY A;  4A3D H;  4LFB L;  1VCI A;  3K0X A;  1HNZ L;  4AH6 A;  1GO3 E;  5C4J H;  3L7Z C;  3CD6 A;  3S24 A;  4MZ9 A;  3M3Y H;  4BXX H;  2HIV A;  3NEN A;  5LMN W;  1GKH A;  4PZ7 A;  1S40 A;  3W5O A;  1UEB A;  3FHW A;  1PH9 A;  1L2F A;  1Q81 C;  2H5X A;  1YJ9 A;  1N34 L;  1FJG Q;  2VNU D;  4JI1 L;  4JI6 L;  3J81 c;  4LF4 Q;  1X3F A;  1NE3 A;  1S3O A;  1E24 A;  3DM3 A;  3HOX H;  1P16 A;  4YHH L;  3RLO A;  4DR2 Q;  4LFB Q;  4FDB A;  2B29 A;  2RF4 A;  2EXD A;  2F3I A;  2K4K A;  4OWT B;  3H3V I;  2E5L Q;  1I6H H;  2A19 A;  2IHE A;  1HZB A;  4A93 H;  2OQ0 A;  1QZG A;  3HKZ E;  4DAM A;  2UUB L;  4L5S A;  1OXU A;  1PH4 A;  3ER0 A;  1D8L A;  4LW1 A;  4JI4 Q;  4A93 G;  1B8A A;  5JJL A;  4A3M H;  1R9T H;  3S1M H;  3HKS A;  2V1C C;  1WJJ A;  1L1O B;  2ZTC A;  4C3J H;  3CMA A;  4DR5 Q;  4ME3 A;  3EBE A;  1YJW A;  4WJ4 A;  4IO9 A;  2OWO A;  1WI5 A;  4BY1 G;  4DR4 Q;  2ZM6 Q;  2E5L L;  3AFQ A;  4YWM A;  4XTC S;  2AMC B;  5IP9 H;  4A3I H;  4BXX G;  2NN6 I;  4JI1 Q;  4A3D G;  4DUZ Q;  1KQS A;  2JA6 H;  4OO1 I;  2GN5 A;  1VS0 A;  4R4C A;  1J6Q A;  2UUC Q;  1K9M C;  1VQB A;  3PIP A;  5C44 G;  3J7Z C;  2HT1 A;  1G6P A;  3BZC A;  5IWA Q;  5GAE C;  2FXQ A;  4R4T A;  4AYB E;  4DAY B;  4JI7 L;  3KF6 A;  2NZH A;  3GO5 A;  1JJG A;  1YIT A;  1UE1 A;  1PH5 A;  2BH8 A;  2JA9 A;  2K5H A;  1XMQ L;  2IX0 A;  2K5V A;  2Y0S E;  3CF5 A;  4GKJ Q;  4K0K L;  1X3G A;  3D0F A;  1N36 Q;  3I4M H;  2ASB A;  1JJ2 A;  3ERS X;  1EFW A;  5IYD H;  4DV6 Q;  4PZ6 A;  1NMF A;  1NMG A;  2WFW A;  4HID A;  3J81 j;  4DV1 Q;  4HJ8 A;  5C4X G;  3HFZ B;  3CME A;  3CCM A;  3PO2 G;  1HNW L;  2JA5 G;  1VQJ A;  4J15 A;  3LGJ A;  2WB1 E;  4QJF A;  4QGU A;  2VZA A;  2JA7 H;  4JI5 L;  3PO3 G;  4TQU S;  4A3G H;  4A76 A;  2D0O A;  2JA5 H;  2PI2 A;  5M3M G;  4QY7 A;  4BBR G;  3GTL H;  3CCE A;  4LF9 Q;  1HZC A;  1TXY A;  4DK3 C;  2VQF L;  1SFO H;  1N33 L;  1QUQ B;  1Y14 B;  3M4Q A;  4LF6 L;  3I4M G;  4DR7 L;  2ZJR A;  2JQO A;  1YI2 A;  2UXD L;  4B3T L;  4A3J G;  1VQO A;  5C4X H;  4YY3 Q;  2JK8 A;  1K0R A;  5K36 G;  1BBW A;  3JC6 6;  2VQE Q;  3S1R H;  2B63 H;  4DV4 Q;  2OCE A;  2UXB Q;  3I4O A;  4LFC L;  1B7Y B;  1KHI A;  2CWA A;  1VQH A;  2AWO A;  4IFD G;  2KEN A;  1SRO A;  4JI2 Q;  3CPW A;  1BBU A;  2ALY B;  4A4I A;  1TWF H;  2JA6 G;  4JYA L;  1C9O A;  3K7U C;  3OTO L;  4A3L G;  2YU9 H;  3L2P A;  3CC4 A;  2RHQ B;  3PUY A;  3TEH B;  1IXR A;  3TS0 A;  4C2M H;  1YIJ A;  1I5F A;  4X65 Q;  4GOP B;  1IBK L;  1NBW A;  3J81 i;  1LTL A;  5AJ3 L;  4A3I G;  4UP8 A;  1UWV A;  5IP9 G;  4UY8 C;  1AH9 A;  3J7A 5;  3J80 i;  3RN5 A;  3D31 A;  2KHI A;  1JE5 A;  4R4Q A;  1HNX L;  4ALP A;  3K8A A;  5IE8 A;  2E8G A;  3STB C;  2A8V A;  4MTN A;  1QUQ A;  1E22 A;  4A75 A;  2KCM A;  3F8T A;  4LF7 L;  4AQY L;  4A3M G;  4OWW B;  2YV5 A;  1KD1 C;  1X65 A;  3RLF A;  2K50 A;  3H3V H;  2GVB A;  1VQI A;  4B3R Q;  3PUV A;  1IBL Q;  3HOX G;  4R4O A;  5EAY A;  4X6A H;  4X62 L;  1S72 A;  2OTJ A;  2WAQ E;  2LXJ A;  4GLA C;  1GVP A;  3T1H Q;  3CCV A;  4KHZ A;  2DUD A;  1XNR Q;  5FLX c;  3S1N H;  2ZJP A;  4HJ5 A;  4JC0 A;  2N8N A;  3BZK A;  1I3Q H;  1VQC A;  3CCQ A;  5LMN L;  3CCL A;  2Z6K C;  5JJI A;  4DV2 L;  1YZ6 A;  4UP9 A;  4DUY Q;  3HOU H;  4OX9 Q;  4HIO A;  2K75 A;  3CQZ H;  4DR3 Q;  1X55 A;  3M4O H;  1Q86 C;  1UE6 A;  2JEB I;  2YYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...