2KHIA

Nmr structure of the domain 4 of the e. coli ribosomal protein s1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
WVAIAKRYPEGTKLTGRVTNLTDYGCFVEIEEGVEGLVHVSEMDWTNKNIHPSKVVNVGDVVEVMVLDIDEERRRISLGLKQCKANPWQQFAETH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the relationship between Gram-negative and Gram-positive S1 proteins by sequence analysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S1
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2khiA00
1VQCA 1YJNA 4B3SQ 3L2PA 4JI3L 1PH5A 4JBJA 2RHSB 3HKZG 4QIWE 5BR8Q 4JG2A 2R6GA 4GKKQ 3B6YA 3GTQH 2QA4A 3RZOH 1L1OC 1V1QA 3SGIA 1PH6A 4JI0L 1WCMH 3RZDH 2BH2A 3H0GG 1AH9A 3TS0A 4YY3Q 4JI1L 4JI7Q 2OCEA 4JV5Q 3CPFA 2HIVA 3W1BA 3PF5A 4H02A 3S15H 3I7FA 4AYBG 4NXMQ 1E22A 4NXNQ 4A3CG 1Z9FA 1SN8A 3CF5A 1QZGA 2JA5H 5GADC 4JBWA 1PH8A 1IBLL 4A3DH 3A5UA 1FJGL 2F3IA 5M5WH 1WFQA 4LFAL 3J80c 1A8VA 1B7YB 1HZAA 3PV0A 3J81j 2VQFL 1GM5A 4UP7A 2JK8A 3OTOQ 4DV1L 2EXDA 1N34Q 5J3BA 3M4PA 3TREA 5IE8A 4A3IH 1EIYB 4JI5Q 3HOZH 2OQ0A 4OONA 2YTXA 4LUVA 3RN2A 1YIJA 1PA6A 1X56A 3GTLH 1V9PA 1MKHA 3UE1A 1S40A 4LF8Q 1OXVA 1XNRL 5ELNA 4WJ4A 1JJGA 1EOVA 2K52A 1PYBA 2ALYB 2Q2UA 4A3KH 5E7NA 4LF5Q 4LFCL 1MIUA 4R4OA 3UDFA 3S1QH 3T1YQ 3EBEA 5IYCH 1OXTA 3HKSA 1HZBA 5M5XH 4GNXA 3RN5A 3AEVA 1N32L 1VQ4A 4DR1Q 4KI0A 2MO0A 3HKZE 1OXUA 1PH7A 5JJLA 2NVQH 2R92H 1Y14B 2HHHQ 4YCUA 3RLFA 5C3EG 4YWLA 4BA1I 1X3FA 4LF8L 1N8RC 3FP9A 1IBKQ 4DKAC 1HR0L 4DV6L 4DV5L 3I4NH 2EQSA 4LFBL 3PO2H 4KLKA 4WJ3M 5IP7G 2EIFA 4JOIC 4J15A 1LYLA 1K9MC 1I94L 1P8LA 4P73A 4DR7L 1MJCA 1RIPA 2HQLA 3RLOA 3MXNB 4DR5Q 2JA8G 2ZJQA 3ULJA 4X62L 3CXCA 1XMQQ 4DV0L 4A3FH 1K8AC 4DR3L 1HNZL 4A76A 2K5HA 3KDFB 1L1OA 3PUVA 1Q7YC 3CCEA 2B63G 3JAMi 2VQEL 3S1MH 1HR0Q 4IPGA 2ZTDA 2K50A 1SFOH 1M90C 1GVPA 2PNHA 1VCIA 4K0KL 3KLWA 1N36L 3PF4A 4DV3L 4X66L 5HY6A 4DV2Q 3CC4A 1HR0W 2R7FA 4YCVA 3ER0A 4X65L 2JA7G 4P72A 3JC66 3A0JA 2IX1A 2MO1A 4HIMA 4IJLA 3OW2A 2Y0SE 2I5MX 1LM0A 2RHQB 3UE0A 1VQKA 3GTOH 2HHHL 4HJAA 4LUZA 2VNUD 2FXQA 5M5YH 5GAHC 3PO3G 2F52A 4PMWA 4DR6Q 1OXXK 1A62A 1QVCA 4NPSA 1VQPA 4DPGA 4LF5L 3PGZA 3HFZB 3TEHB 2K4KA 4FDBA 3HOYH 2WFWA 2JA5G 1JJCB 3PUXA 4POGA 5M3MH 2WB1G 1PVOA 2KHJA 4DNIA 3S17H 2B3GA 3PUZA 5C44H 1FGUA 4B3ML 1KRTA 1VQ7A 4X65Q 1KHIA 1PH4A 2H5XA 4DR4Q 5IP9G 4KHPL 1U0LA 3LGJA 5M3MG 1A0IA 4L5RC 3W5OA 4JI2Q 3FKIG 1K8GA 4JI1Q 4L5QA 2VQEQ 1BKBA 4PZ7A 3PUYA 5M3FH 1UWVA 4YWKA 3K7UC 4A3BG 2E2HH 2CWPA 4JI8L 2RF4A 3CMAA 1PH9A 1JT8A 4AIMA 4IPDA 4X62Q 1CKNB 3J81i 5BR8L 3HOXG 1XMQL 1N36Q 2JA6H 2JQOA 2Z6KA 4MNOA 1IBLQ 2HT1A 3ULLA 5ELOA 1J5EL 1FVIA 3K81C 4O0AA 3F2DA 4HIOA 1C0AA 3HOXH 3GD7A 4OX9L 1PHJA 4A3LH 4JI7L 2IHFA 4OXPA 3GTJH 3KOJA 3EIVA 1XNQL 1PV4A 4B3RL 2NVYH 4UPAA 4LNQA 1X9NA 1Z47A 5LMNL 4DUYL 4GLXA 5GROA 4BXXH 4C3JH 2PI2A 2E5LL 3NENA 1KIXA 4LF9Q 3BZCA 1VQAA 2KCTA 1I6HH 2R7ZH 2NVTH 1SE8A 1WI5A 4LF4L 5JJIA 4DR2L 2R92G 4YWMA 3A5ZB 4LFCQ 4GLVB 2Q2IA 4YHHL 1QVGA 2Q2TA 3UDXA 1SRUA 1Q46A 1YBYA 2Z6KC 3G6EA 1VQ5A 4A4IA 4AH6A 4BY7G 2D0PA 4GKJL 1XNQQ 4B3RQ 1RL2A 2JJQA 3W1GA 2YYZA 3U50C 4GLAC 2R93G 2Z0SA 4QJFA 4LF7L 3L7ZC 1OTCA 1WJJA 2DGYA 2N49A 4IPHA 2K5VA 4UY8C 1X6OA 2OQKA 4QGUA 2LSSA 2WAQG 4IPCA 1V43A 3PCOB 4JI4L 3GTGH 4UP8A 1B70B 1UE1A 2C35B 3CCLA 2VY3A 5LMNW 5IWAL 5IYCG 2UU9Q 2GVAA 4EQ5A 1Y1WG 2V1CC 3ICEA 1VQ9A 4QQBX 2YTYA 3H3VI 3I56A 1YHQA 2KCMA 4A3JG 1O7IA 3AQQA 5LMUQ 3ERSX 1SROA 3CC7A 4A3GH 4JV5L 4B3SL 1TWFH 4X6AH 3BU2A 1X3GA 3GTKH 3CCJA 1TWHH 1IBMQ 1J5EQ 3TRZA 1A63A 1JB7A 4DR5L 1NMFA 3CW2C 2OTJA 4XTCS 2KHIA 2LXJA 5FJ8H 1E1TA 3UDGA 1YHAA 4DV0Q 4JBKA 2R7ZG 1HNWQ 4X64L 5M3FG 1Y1VG 4GKKL 2UXCL 2UXBL 2R93H 5GAEC 3K80C 1I5FA 1IL2A 2VUMG 1YEZA 1HNXL 4BXXG 2AKWB 3CCQA 5IWAQ 3I55A 2UU9L 2CCZA 1VQHA 1CKNA 1VQFA 2VW9A 1HJPA 3GDEA 2B29A 2HIXA 4GKJQ 2AMCB 1L2FA 3S24A 4L5TA 1Q8KA 4DR6L 3Q8DA 1EQRA 3J7ZC 3ULPA 2GN5A 2WB1E 4KHZA 4K0KQ 3PSIA 1YJ9A 3F2CA 2PMZE 1GKHA 5IYBG 1UE7A 2N78A 3M4QA 1UE5A 1IBML 5DLQE 1NBWA 3I4MH 2NN6I 4ALPA 4YCWA 1GO3E 2A1AA 3JAMc 4P75A 1NY4A 3U4ZA 2NN6G 3HOVG 3FHWA 5C0XI 1YZ6A 2QEXA 3D31A 4AQYQ 1VQOA 1EYGA 1U5KA 1XPUA 1WOCA 2BH8A 4GN3B 4JOIA 4P71A 4PZ8A 4R4QA 2NZHA 5C4JH 1XMOQ 1EFWA 4R4CA 1SR3A 4DV4Q 2ATWA 1XNRQ 1KRSA 4O2DA 1Q82C 2E2IH 1D8LA 2JA6G 5LMUL 2CFMA 2L15A 2UXDQ 4R4TA 3CCUA 1Q86C 4OWTB 4C3IH 5GQOA 1VQMA 4IFDI 3G48A 3F2BA 2ES2A 2BA1A 1N9WA 2MFIA 4HJ7A 3HOYG 4JI8Q 1BVSA 3CAMA 4GNXB 3S16H 2CWAA 2PI2E 2K75A 4JYAL 4LFBQ 2DUDA 2XTIA 4HJ9A 1IYJB 3F1ZA 4Y7NH 3CD6A 3TS2A 1HZ9A 1Y1VH 2K14A 4DAMA 4EX5A 1Q81C 3HOUG 1E3PA 1TXYA 5JJKA 1JE5A 3WWVA 1CSPA 3RLNA 5IYBH 4A75A 1M1KC 1D7QA 1XJVA 4IOCA 1J6QA 1VQBA 1VQGA 1IBKL 4A3GG 4DUZQ 4OWXB 4DV7L 1G6PA 5C44G 5EAYA 3BZKA 1C9OA 2RCNA 2UXDL 5AJ3Q 3H0GH 4ME3A 1I94Q 2CQOA 1HNXQ 1SLJA 4HIDA 1S3OA 2UUBQ 1VQ6A 3I4NG 3PIPA 4QY7A 1PH3A 1ASZA 4JI0Q 1KC8C 3CQZH 3I2ZA 1VQ8A 5FJ8G 2ZM6Q 5IT9c 1JMCA 1UE6A 3J81c 1CSQA 3M3YH 4JI6Q 4JI5L 1L0WA 5JEAG 1LUZA 2E5LQ 4NB3A 1EWIA 3J80i 3S1RH 4JBMA 1B8AA 3PIOA 4PG3A 1ASYA 3H15A 1BBUA 2LXKA 1E7ZA 5H1SE 2IT1A 4DV7Q 2JA9A 4TVAB 3CCSA 4A3IG 1EQQA 1MJEA 2JA8H 1HZCA 3L0OA 5FLMG 2A8VA 3GTPH 4A3KG 2AHOB 5FLMH 1S72A 3M7NA 5JEAJ 3A74A 5FLXc 2E2JH 1VS0A 4A3CH 1XMOL 3H3VH 4B3TL 4DAYB 1W2BA 2UUAQ 2XGTA 3RNUA 4DR4L 1VQNA 3NBHB 1G51A 2Y0SG 2VL6A 3GO5A 1W3SA 4KHPQ 3IRBA 3RR5A 3T1HL 4A3BH 3S1NH 1K83H 1FL0A 3AFQA 4JI2L 1YNXA 1X3EA 2D0OA 4JYAQ 3CCRA 4JI4Q 4JC0A 4LUOA 3KJPA 4DV6Q 3PO2G 3G4SA 4MZ9A 1YITA 1WYDA 4B3MQ 4XIGS 4A3LG 1TWCH 1N33L 1NE3A 4DR1L 4DR7Q 4UP9A 2ZTEA 2GVBA 1K73C 2PQAA 2ZM6L 1Q1EA 1Q1BA 3GTMH 2MQHA 3KF6B 1I3QH 1WCMG 2OWOA 1EUJA 1L1OB 3K7AH 4IFDJ 1CKMA 5C4XH 4GN4B 4HJ5A 4IO9A 4BBSG 3E9HA 1UEBA 3HOVH 1I50H 2IHEA 4DV5Q 2UUBL 3FKIH 1EIFA 3U4VA 4DUYQ 2UXBQ 2KENA 2R7DA 5IYDG 3CMEA 1Q12A 3E0EA 1P16A 1G291 4LF4Q 4LF9L 3F8TA 5IP9H 2YU9H 4BBRH 1N33Q 2VS1A 2ZJPA 1IXRA 1AE2A 1YHBA 2I5HA 4DV3Q 1QZHA 4JI6L 1IZ6A 1YVCA 2JA7H 4DR2Q 2OTLA 4IFDG 2VQFQ 3M85A 1CUKA 2ZJRA 3CCVA 2MNAA 4A93G 4PZ6A 4C2MH 4LW1A 2PQAB 4DV1Q 3HOZG 1LTLA 3HOUH 3CPWA 4RMFA 2K5NA 1E1OA 1VQDA 4IOAA 4NXML 4QL5A 2VZAA 2VUMH 3J7A5 4BBSH 5C4XG 3DLLA 2UUCL 2WAQE 1PYSB 2F4VL 2B63H 3S14H 3HOWG 1VQLA 4LF7Q 4A3MG 1DGSA 2UUAL 5K36G 4LWCA 3OTOL 1N34L 1KD1C 4AQYL 4BY1H 1QUQB 4A3FG 4BBRG 4A3MH 3HOWH 3UDIA 4GN5A 1VQJA 2YTVA 3AFPA 2N8NA 4MTNA 4L5SA 2WP8J 2AWOA 3PO3H 5C0XG 3KDFA 3EN2A 3I4MG 5C0XJ 4GOPA 3D0FA 3BJUA 1N32Q 2IX0A 3M4OH 4R4IA 1KL9A 3MEFA 1HNWL 2IY5B 2AWNA 1OXSC 2CKZB 2E8GA 3G71A 4A3JH 1TWGH 2JEAI 1HH2P 3KYHC 3NEMA 1XPRA 1CKOA 2UXCQ 4JCVE 4HIKA 2I5LX 1YJWA 1SMXA 1TWAH 4BY7H 1Y1WH 4OO1G 2BA0A 1X55A 2QGQA 5AJ3L 1PH2A 1AE3A 5GAGC 3CCMA 4A3EH 2NVXH 1KQSA 3NELA 5LMNQ 3DM3A 4GOPC 5HGQA 3M9BA 4BY1G 1X65A 1T9HA 4OWWB 4C3HH 3KFUA 4Y52H 3KF6A 2UUCQ 4RG1A 4X64Q 2JEBI 3KF8B 4LF6L 1H95A 4GS3A 1QVFA 3I4OA 4GOPB 4OX9Q 3TQYA 1KXLA 4DR3Q 1HNZQ 1KAWA 2KBNA 1NTGA 4X66Q 4DV2L 2Q2HA 4LFAQ 5IP7H 4B3TQ 4GNXC 1NJIC 1X54A 3STBC 4BA2I 4AYBE 1JJ2A 3U58A 2JE6I 4TQUS 3ZJYC 2F4VQ 4DV4L 3T1HQ 1PH1A 3K0XA 4NXNL 4DK3C 2A19A 3AYHB 4P74A 3K8AA 3CP0A 3STBD 3VDYA 4HJ8A 3PUWA 5IY0A 1C7YA 1FJGQ 4APVA 4YHHQ 1VQEA 1K0RA 3E9IA 4DK6C 4LF6Q 4JI3Q 5IYDH 3KJOA 4A3EG 4R1JA 1GD7A 2YV5A 2ID0A 2ASBA 1E24A 3T1YL 2I0QA 3OYYA 1PFSA 4A3DG 1VQIA 3S2HH 1XTDA 4OO1I 4YY3L 1K3RA 1BBWA 2D62A 2N3SA 4POFA 1QUQA 4IJHA 1R9TH 4A93H 2ZTCA 1YI2A 5C3EH 1XPOA 3CC2A 3S2DH 2NZOA 4DUZL 1NMGA
chains in the Genus database with same CATH superfamily
3X3NA 2PZUA 4O42A 3L2PA 3BG3A 3OW7A 1A3TA 4JBJA 2RHSB 2K33A 3HKZG 5IGGA 4JG2A 1EOTA 3GP7A 3CRKC 1SE2A 1II3A 3VYTA 5M9OA 1L1OC 1RD9D 1AH9A 1B53A 4JI1L 4JI7Q 1PTOD 3CPFA 2HIVA 3EQLC 1WD0A 4H02A 3S15H 4ULLA 4A3CG 1EQTA 2JA5H 4PMBA 1ET6A 5M5WH 1B7YB 3DEOA 3PV0A 4NW2A 5J3BA 5EQ0A 1EIYB 1GUSA 2K5QA 2RKSA 2YTXA 2EXZA 1CI3M 1X56A 1C8CA 3UE1A 1BCPC 3MFYA 1WD1A 1EOVA 1LTAD 5JPNC 4R4OA 3T1YQ 5IYCH 1OXTA 3HKSA 1HZBA 5M5XH 4GNXA 3AEVA 4MHEA 1N32L 1VQ4A 1ILPA 2CHBD 2MO0A 1OXUA 3K5OA 2PQEA 5I2YA 1LT6D 5C3EG 1YNND 3H6MA 4NKLA 1SSOA 1IBKQ 4DKAC 4G7HC 4A3MB 4LFBL 3PO2H 3S1MB 1I94L 4H0LC 2F4IA 2JA8G 4DU9A 4C3IG 3MXNB 3I72A 1XMQQ 3CXCA 1K8AC 4DV0L 1SFOB 4S3SA 2HUGA 1O78A 3BYYB 1L1OA 2X69A 3E3XA 2K28A 4N8X1 1TWAB 4BY7B 1ZYRC 1HA6A 4X3TA 1NNXA 1M90C 1STBA 4K8JA 1T5EA 5EBCA 4K5WA 3BDOA 3BVGA 1I4XA 4DV3L 5DM73 3A7LA 5C5MA 3ER0A 2JA7G 4P72A 2IX1A 4K6DA 2MO1A 1EYCA 1LM0A 1RTNA 3GTOH 1BR9A 1IW7C 5GAHC 3PO3G 2F52A 1AEXA 3T53B 2BDOA 2V4DA 1DYQA 2A74C 3BZDB 4POGA 4DNIA 3S17H 1D5MC 1JC7A 2K03A 5C44H 1SBBB 3I4NB 3SR1A 5M3FB 1L0YB 4KHPL 1U0LA 3LGJA 5M3MG 2PNRC 4JI2Q 1TWCB 1VF5C 2RDGA 1JOKA 3ZYYX 4BS9A 4CDEC 5FLXL 3K6OA 3Q6SA 2PZWA 1BKBA 1PTOF 1UWVA 2E2HH 1PH9A 4JI8L 3S2DB 1JT8A 4KV6A 2ZXOA 2JQOA 1C0AA 3ULLA 5CBEE 1FVIA 3K81C 1HQMC 1PHJA 4JI7L 3CU7A 3EIVA 3KOJA 4B3RL 2ZT9C 2K1BA 4UPAA 2F0SA 3E6ZX 5LMNL 4BXXH 2PI2A 1QNKA 1WTOA 1VQAA 5CMDA 2R7ZH 3TN2A 2B2TC 2NVYB 1PDQA 2RCFA 4ME5A 2Z6KC 1YBYA 4KY7A 4AH6A 1RL2A 2F3WA 2JJQA 1PZKD 4V0BA 4AYBB 1WCMB 3EROA 1TWHB 4QJFA 3L7ZC 2J0TD 2N49A 1X6OA 3MXPA 1GUWA 4IPCA 3PCOB 4F88A 4UP8A 3GTLB 4X3KA 1Y8PB 4F7XA 2VY3A 4C3JG 2GVAA 1Y1WG 2V1CC 1VQ9A 1STAA 4QQBX 1SYDA 2KCMA 4DK0A 4A3JG 1YNNC 5LMUQ 3ERSX 3CCJA 1J5EQ 3SK4A 4XTCS 3V2TA 2LXJA 1YHAA 1EIGA 5C3XA 1Y1VG 2A68C 5GAEC 1IL2A 1YEZA 2B63B 2DY8A 2L55A 5HGTA 1VQFA 3GDEA 3TMEA 4GKJQ 4NMZA 5K5PA 2AMCB 3KUPA 4KHVA 3Q8DA 1RCVD 3VYRA 3ULPA 2GN5A 1KLGD 2EPBA 5FO8B 1KDBA 4XYQA 5IYBG 1Y69U 1IBML 2JA7B 1NBWA 3KBXA 3SVMA 3TP5A 2A69D 4P75A 2B2UA 4CKCA 5C0XI 3H09A 2EYPA 2QEXA 4AQYQ 3JAME 1XPUA 4A3EB 2BH8A 4P71A 1EFWA 2ATWA 2E2JB 3Q23A 1LABA 4BBRB 1XNRQ 1T5XD 3F2UA 2UXDQ 3CCUA 1Q86C 1JB3A 1MGSA 5GQOA 4IFDI 1JE4A 2ES2A 1N9WA 4HJ7A 3I4LA 4HSPA 4GNXB 4F8MA 3J81L 2K75A 2DNCA 5M5YB 2XTIA 4HJ9A 4IQZA 3HOUG 3KBGA 3O13A 4LK1C 2EYOA 1X3QA 3PMFA 4A75A 1M1KC 3TP6A 1F9PA 4RKBA 4IOCA 4IZ8A 4OWXB 3MFGA 5C44G 1JWSD 3A54A 2RCNA 4HMIA 1SDFA 5D3DA 1VQ6A 4QY7A 4CDCC 3I8ZA 2KJXA 4J8QA 1EY7A 1JMCA 1UE6A 3OWEB 4JI6Q 2F0MA 4NB3A 3J80i 1ASYA 4PG3A 5H1SE 2JA9A 4KKUA 1MJEA 1HZCA 2EY5A 3GTPH 4A3KG 1S72A 5FLXc 4I7AA 2J4XA 1I4GA 4G4KA 1W2BA 4DAVA 1O7YA 1DM0B 5JJZA 2EJMA 4ZUIA 4DR4L 1H9SB 1EIHA 4Q0FA 4KHPQ 3RR5A 4A3BH 4RGNA 1AZQA 4JI2L 4QUFA 4JI4Q 1LACA 1OO9B 4TKOB 4MZ9A 1YITA 4B3MQ 2B2YC 5KNCA 4A3LG 1H9JA 3DWPA 4RHRA 3FKIB 1Q1EA 1Q1BA 4R8IA 3GTMH 3MEHA 4CBVA 4EGVA 3K7AH 1CKMA 4IO9A 4GN4B 1FR3A 4BBSG 3E9HA 1LTID 4LJZC 2NN6H 1Y1VB 2UUBL 1EIFA 2XWBB 4DUYQ 2WAQB 3NTKA 4H44C 3E0EA 5AFWA 1H9MA 2VS1A 2ZJPA 1IXRA 4DV3Q 1QZHA 3WDNA 2HDMA 1IZ6A 2OTLA 1A3UA 4EQPA 1B3AA 4C2MH 5J22A 2CW0C 1FD7D 3HOUH 4M8AA 2K5NA 1E1OA 4K6LA 1J8IA 5E3FA 5C4XG 2R92B 1PYSB 3LWUA 3M7GA 4ID6A 1DGSA 4KMUC 4OGQC 1KD1C 3A8IE 4AQYL 3RZDB 4BY1H 4A3FG 4BBRG 4A3MH 5IT9E 3HOWH 5CGKA 1KDCA 4GN5A 1X3PA 3K0YA 1B9MA 1JORA 4MTNA 2H4OA 5C4JB 2WP8J 1Q3LA 2B39A 3PO3H 3GTQB 3EN2A 2F0IA 5C0XJ 5JEAH 1XYIA 3D0FA 2M2LA 2H1EA 1CT1D 2IX0A 1N32Q 1EL0A 2A69C 1OXSC 2E8GA 3C3LA 4IUPA 4A3GB 3NEMA 1UUPA 5G3LD 1SNOA 1YJWA 1DCZA 1SMXA 1TWAH 2XNAC 4BY7H 4OO1G 4DXGA 2JA6B 2QGQA 2DY7A 3GTGB 3CCMA 2NTSA 5LMNQ 3D6CA 1X65A 3R2IA 2KHSA 1DOKA 3EA6A 2JEBI 1H95A 1QVFA 1KXLA 1HNZQ 1NTGA 1WVLA 1SE3A 5COYA 2EE1A 4UAIA 3V05A 3STBC 4BA2I 4DK1A 1JJ2A 1JWMD 2JE6I 3ZJYC 4DV4L 4NXNL 4P74A 1IL8A 4HJ8A 3PUWA 1FJGQ 4I7ZC 4XXEA 3KJOA 2PW5A 2Y0SB 1E2ZA 1EQVA 5ELFA 1E24A 1O7LA 3OYYA 1PFSA 4ABNA 4A3DG 1R9TH 4POFA 3QG1A 2XSCA 1S5FD 3MC0B 4OIKA 3MZ5A 1TY0A 4DGZA 1VQCA 3HRZC 2K5WA 5A2QE 1GUOA 1IKMA 1VMPA 3EVQA 4CHTB 4GKKQ 3GTQH 1MSGA 3RZOH 1LTSD 3RZDH 3H0GG 2O2LD 1STGA 4G57A 2OCEA 3W1BA 3L3OC 1XWEA 1HPCA 5I4DA 1Z9FA 4Z9CB 2K04A 3CF5A 1V1PA 2N88A 4JBWA 1PH8A 2Q8TA 4B9XA 3A5UA 4UDUC 1FJGL 2E2DC 2K5DA 1A8VA 1HZAA 3QJYA 4IUTA 3J81j 4FXKC 1EEFD 2VQFL 4UP7A 1GM5A 3TREA 4A3IH 3VA7A 3V96A 2F1MA 3I90A 4OONA 4FNFA 3VR5A 1YIJA 3RN2A 1PA6A 3GTLH 3FMCA 3S1QB 4QMGA 1W6KA 4LF8Q 1XNRL 1JJGA 1LTGD 1PYBA 2ALYB 2Q2UA 4G7OC 4A3KH 3J7AV 1AP0A 1ESFA 2EYMA 3IFDA 1W6JA 4DR1Q 5C3WA 4PNYA 4C1NI 3J7YW 1PH7A 5JJLA 2R92H 3FPUB 3A55A 1F2YA 1HFNA 2EYJA 2QCPX 3FP9A 5E4XA 4DV6L 3HS0C 4OIJA 2EQSA 3DWQA 5IP7G 3A8JE 4P73A 3H94A 2F0GA 1RIPA 2XRSD 4DR5Q 3WOFA 1SNPA 3ULJA 4X62L 2E2HB 1BCPB 2R7ZB 4A76A 3KDFB 1CA6A 1O7ZA 3PUVA 1Q7YC 1YNJD 2VQEL 2C5CA 4IPGA 4KK7A 1SYEA 1K0SA 4K0KL 3PF4A 4ZCKA 4DV2Q 2SOBA 5HY6A 4A93B 2CW0D 1HR0W 4DA2A 3A0JA 5EKIA 5K36H 3OW2A 4IJLA 2Y0SE 3UE0A 1SXTA 2HHHL 2VNUD 4LUZA 5M5YH 4DNRB 1SYBA 4PMWA 2F0DA 1F2ZA 1A62A 4NPSA 1U4MA 3TEHB 1DOMA 4FDBA 2FINB 3DM1A 3NP8A 3HOYH 3OMCA 4QUCA 2JA5G 2NVXB 3CQZB 3PUXA 2WB1G 1SE4A 3PUZA 4TSSA 2JYOA 1G2TA 1FGUA 1EY9A 4N8FA 1PH4A 4KD4A 4DR4Q 1SMYD 5IP9G 2VUMB 2AQ1B 3S17B 1MD2D 1K8GA 3BYTB 2VQEQ 3X3MA 4A3BG 3CMAA 1WTWA 3QO2A 1TY2A 5KYLA 1IYVA 5I6YA 3GTOB 5ELOA 4O0AA 3F2DA 4RH6A 3HOXH 2B2WA 3GD7A 2CVRA 1GHKA 4A3LH 2WINB 4DXFA 1XNQL 1PRTC 1EYAA 2B2YA 1X9NA 3P75A 2FMCA 2E5LL 2KCTA 5D65A 3LWEA 4QB4A 1SE8A 1WI5A 4FXDA 4E6IA 1TS4A 3NHHA 5IOCA 2VB2X 5EJWA 5JJIA 4YWMA 4LFCQ 4GLVB 2EZVA 2Q2TA 3UDXA 3W2DA 5FLXE 2JN4A 1Q90A 2RSOA 3RMHA 4A4IA 1VQ5A 4BY7G 3D6WA 5LHY1 2RDFA 3TP8A 4RFBA 2YYZA 1SYGA 4GLAC 4RA8A 1CHPD 3MXUA 5ISRA 3C46A 4LF7L 4FF1A 1SYFA 4FYDA 1OTCA 1WJJA 3M3YB 4IPHA 5E4WC 2OQKA 2HDLA 2WAQG 4NP5A 1V43A 1ZKOA 1B70B 4C3HB 4PV1C 3PO3B 4EQ5A 1A6XA 3ICEA 3J7AF 4HCSA 1ENCA 1ICWA 1O7IA 4GZYC 4DN4M 1B9NA 4A3GH 1TWFH 3GTKH 1IBMQ 2QDBA 3TRZA 1EU4A 3CW2C 2OTJA 2R7ZG 1E1TA 4H7BA 1A3VA 1HNWQ 1BUVT 1I5FA 5CV4A 2Z6BA 5IWAQ 2UU9L 4A3FB 4EQOA 3S24A 1L2FA 2PZTA 2F0OA 3QIAA 4KHZA 1YJ9A 4ZYSA 3F2CA 1KAAA 3I4MH 2N78A 4LAAA 1FYCA 2NN6I 1GO3E 3JAMc 2MHVA 3PIO3 1NY4A 3HOVG 1YZ6A 2R3ZA 3D31A 1VQOA 5FKAC 1U5KA 3LX0A 1WOCA 4GN3B 4R4QA 1B2TA 5C4JH 1PFMA 1SR3A 2KA7A 4DV4Q 1KRSA 2NWGA 4O2DA 1D1IA 1D8LA 2JA6G 2L15A 1K8OA 4R9WA 4G7ZC 3F2BA 2KCCA 4JI8Q 1BVSA 3CAMA 3S16H 2CWAA 2PI2E 5M3MB 2O5IC 1Z6HA 2OEOA 2NUCA 1QOHA 1Y1VH 2K14A 1Q81C 5CV8A 3QR8A 1E3PA 1TXYA 2A6HC 3DHQA 3NPPA 1NAPA 2WV6D 1CSPA 5IYBH 1XJVA 2F0NA 2R61A 1ESRA 2HQEA 2ZXRA 1IBKL 4DUZQ 2OT2A 1F9QA 1G6PA 3OIQA 1JR0D 4O1NA 3HG9A 5AJ3Q 3H0GH 1HXYD 4U68A 3SK5A 4LMQD 1HNXQ 4HIDA 1TVXA 1S3OA 2UUBQ 2O5JC 1ICFB 1ASZA 2DNEA 2ZM6Q 3GTKB 4QCLA 1L0WA 1LUZA 1EWIA 3S1RH 4NDXA 4JBMA 3PIOA 2LXKA 5IGDA 2PW7A 4DV7Q 4TVAB 4A3IG 1WTQA 5NUCA 2JA8H 3L0OA 1S5CD 2BE5D 3HOXB 2JSOA 2K32A 2A8VA 2Z1CA 2AHOB 4L63B 5JEAJ 3A74A 4A3CH 1ZEQX 1DD2A 1AZPA 3H3VH 1JWUD 3HKZB 3VYUA 4DAYB 4B3TL 3RNUA 1TKWB 3NBHB 1B44D 1CHQD 1G51A 4BWGB 3TZDA 1K83H 1FL0A 3VR3A 3AFQA 1YNJC 3CCRA 4JPBW 1EZ6A 1A15A 3KJPA 4C3JB 4DV6Q 1D6EC 3AU7A 1KLUD 1WYDA 4XIGS 5T1IA 5KNDA 1FNWA 3Q24A 4L6TB 1PXUA 3GTJB 1I4HA 4KY5A 3D4RA 2PQAA 3MHBA 5KGUA 3KF6B 1I3QH 2R93B 4IFDJ 2YU9B 1XXGA 5C4XH 4HJ5A 1I50H 1O80A 2Z4HA 2UXBQ 1Q12A 5M5WB 3F8TA 4BBRH 4P2CB 4JI6L 3OIPA 2ZXPA 2MPMA 1FNVA 4DV1Q 1PZJD 1LTLA 3CPWA 2OXPA 4NXML 1I4PA 5ELDA 2WAQE 2F4VL 3A56A 1VQLA 1K83B 4A3MG 5K36G 3UI2A 3SEBA 1CK1A 3UDIA 5C4ZA 1VQJA 1JCKB 3OOCA 2YTVA 1HTLD 4L5SA 4IN3A 2BE5C 4JVZA 1LO5D 2G9HD 1UEAB 1KABA 3SK6A 5JVG3 1KDAA 5EKKA 4GOPA 3NQIA 4WRDA 2RSNA 1HQRD 3M4OH 4R4IA 3MEFA 4RGOS 2AWNA 2B8GA 2UXCQ 3KYHC 1XPRA 4JCVE 3K59A 1LTBD 4RHSA 2KCNA 1X55A 4J1MA 1AE3A 4X3SA 3GV3A 4BY1G 4RCOA 5I9OA 1QE6A 3KF6A 2CH4W 2DN8A 4RG1A 4X64Q 4GS3A 3TDQA 3I4OA 1KAWA 4X66Q 2TSSA 3Q0AA 4GNXC 3U58A 2Z9HA 2E74C 1U9RA 2A73B 3K0XA 1CFMA 1KTKA 3AYHB 3STBD 3VDYA 2L4NA 1C7YA 2PPBC 3S1NB 4YHHQ 1K0RA 4DK6C 3T51B 4JI3Q 5CR3A 5CORA 4R1JA 2YV5A 5KNBA 4C3IB 1VQIA 5KRUA 1EY4A 2JXMB 3OMGA 1B50A 3M4OB 4YY3L 4KN4C 2BCOA 1JQYD 5C3EH 1ENAA 2A5HA 2Q8IB 4XDXA 1XPOA 3S2DH 2NZOA 4A3JB 4IUVA 3MXGA 1WTPA 1STEA 1PH5A 2K6AA 2F0EA 5BR8Q 2R6GA 5DEHA 2HD3A 4BBSB 1TWFB 1M4VA 2QA4A 3SGIA 1PH6A 4RKLA 3R2TA 2JP1A 1EY6A 3OSOA 3PIP3 1EFID 3I7FA 4AYBG 2MUYA 3RZOB 3MA2B 1SN8A 4JW0A 2ICEC 4A3DH 4K5VA 1HHVA 3J80c 3OTOQ 2JK8A 1N34Q 4DV1L 2EXDA 5FO9B 5KYIA 4JI5Q 2OQ0A 3BDCA 1NUCA 1V9PA 3FVQA 1S40A 4WJ4A 1OXVA 1TS3A 1PRTF 5ELNA 2WKDA 2K52A 3NXWA 2RVLA 2XWJB 1NCVA 2FMMA 5E7NA 4LFCL 3H91A 3UDFA 1V8QA 3K5LA 2K01A 4DAYA 3RN5A 4ZKCB 5ELEA 3I73A 3HKZE 2F0FA 2E75C 2F0JA 3RLFA 1HFGA 4YWLA 5CV7A 2B2UC 4HCEA 4LF8L 4DV5L 4CDFC 4KLKA 3NK9A 4WJ3M 2EIFA 1K9MC 1P8LA 1VF7A 2E76C 1DJRD 4DR7L 5EPJA 1HNZL 2QKIC 1E2WA 2SNMA 2K5HA 4HEDA 4KJOA 4L8JA 5JPMC 4C1NK 3CCEA 2IW3A 3JAMi 1HR0Q 1AN8A 2K50A 1SFOH 4IALA 1F9SA 1GVPA 2AQ2B 4IUQA 1AFPA 1ZXTA 1N36L 4X66L 3S1RB 5I9PA 3KLSA 4X65L 1HUMA 3W3AA 3JC66 5CBAE 2ENBA 3E0JA 1VQKA 2I5MX 2RHQB 3OPOA 4IURA 2FXQA 1KNEA 3KF8A 3VYSA 4XQJA 4DPGA 4LF5L 3PGZA 3C2PA 2K4KA 3URYA 3DMUA 1VDZA 5M3MH 1F2MA 3PQIA 2KHJA 2PYKA 4UHVA 2B3GA 2SDFA 1KRTA 1VQ7A 1F77A 5A2QL 1EZ8A 1IYUA 3MWYW 2H5XA 2DJFC 4FXGC 4FF4A 3HOYB 4HMJA 2F0LA 1DXMA 1WTXA 3LNNA 1GHJA 2QW7A 5M3FH 1GOZA 3K7UC 2CWPA 2RF4A 2LFNA 3ND9A 1HTPA 4AIMA 4X62Q 1CKNB 5BR8L 3HOXG 2O4XA 2BDNA 1N36Q 2Z6KA 1IBLQ 2HT1A 1BO0A 4KKTA 4OX9L 1RJTA 5C3EB 2IHFA 1QWYA 2KECA 1PV4A 2NVYH 4LNQA 4DUYL 1C4QA 5GROA 5BN4A 3QWNA 4GLXA 3MTSA 1TT2A 1KIXA 4OHJA 3HOZB 3BZCA 1I6HH 5JAVA 1JICA 1PRTD 1B4OA 1QNUA 4DR2L 4YHHL 2L1BA 3G6EA 1SRUA 3DXJC 4ZLTF 2D0PA 4GKJL 1XNQQ 3U50C 1WTRA 2R93G 2Z0SA 2OF1A 2DGYA 4UY8C 4QGUA 4JI4L 5J39A 5EGTA 3TSSA 1UE1A 2C35B 3CCLA 1PTOB 3NTHA 5KIXA 3PO2B 5IWAL 5IYCG 2UU9Q 1UAPA 3ND8A 1E2VA 5D3IB 2YTYA 3H3VI 3I56A 1ONLA 3J80L 3AQQA 2K05A 5ELBA 2WB1B 4X6AH 4B3SL 1LT4D 1NMFA 1TIID 4JBKA 5FJ8H 4DV0Q 1TU2B 4RCNA 4X64L 5M3FG 4GKKL 1I3QB 2R93H 1EWHA 3K80C 4KJNA 1HNXL 2AKWB 3I55A 5T1GA 1CKNA 4B9WA 2VW9A 2FJ2A 1HJPA 2B29A 4K5XA 2HIXA 3TZUA 1CZWA 1Q8KA 1S5DD 4DR6L 1HA5A 1WTHA 1EQRA 3BVMA 3J7ZC 3MXNA 3PSIA 2XRQD 4N9PA 1GKHA 3I91A 1UE7A 3M4QA 2FFKB 1PZID 1PFNA 3KK7A 5IIFA 2D5DA 3SDZA 4RGTA 3FHWA 5EPKA 3HOWB 1UNSA 5C4HA 1PFBA 1V1OA 3DEPA 4PZ8A 1G8ZD 1S5BD 1XMOQ 3J80E 3K57A 4R4CA 4IFDH 2BOSA 5LMUL 4IUNA 2CFMA 5EBDA 4R4TA 3T16A 4OWTB 5IODA 2F03A 2BA1A 2MFIA 4JYAL 4LFBQ 1AW7A 2F0PA 3CD6A 1IYJB 1HCZA 4Y7NH 2RQXA 1D2BA 4FP5D 3TS2A 1HZ9A 4DAMA 1BNZA 3WWVA 3RLNA 1QG7A 1X32A 3R8BA 2IX3A 3RD4A 1DONA 4DV7L 5EAYA 3BZKA 1C9OA 2TMPA 2EYFA 5D14A 2CQOA 4KKSA 3I4NG 2K7VA 3PIPA 3VA5A 4CJ1B 4JI0Q 1KC8C 3CQZH 3I2ZA 4ZKBB 3KLSX 5FJ8G 5IT9c 5ELCA 2QDLA 3S14B 3J81c 4JI5L 2HCCA 3GQBA 3H15A 2J7ZA 1EY8A 1IW7D 1CTMA 3K5NA 1DZ1A 5FLMH 2RA4A 1NR2A 1G2SA 1R4QB 2UUAQ 2XGTA 1MHWC 3HGBA 4QIWB 2F0QA 3VR4A 1BOSA 2EJGC 2VL6A 3IRBA 3S1NH 1H9KA 1FNUA 4JC0A 3OWFA 4LUOA 3NTIA 3KLRA 5E1FA 3VR6A 5C6AA 4HR7B 1N33L 1NE3A 2QILA 4DR7Q 4UP9A 2ZTEA 2JA8B 4ZQ3A 2KEEA 3BVZA 4J6HA 2MQHA 1LTTD 2OWOA 2CH4A 3IFTA 5JOBA 4XT1B 4OO1H 3HOVH 4DV5Q 1EWCA 3FKIH 3U4VA 1QCBD 2KENA 5IYDG 3CMEA 4LF4Q 1G291 5IP9H 3K7AB 2KQ3A 3OHXC 1YHBA 1Y1WB 2I5HA 4DR2Q 1CZGA 2VQFQ 3M85A 2RBMA 2MNAA 4A93G 4PZ6A 3SXHA 4Y7NB 2PQAB 5C44B 4RMFA 2LMCB 3DLLA 3S14H 3HOVB 1BF4A 3HOWG 3G7LA 4FF2A 3P20A 3R93A 3FRPB 4ODGA 4LWCA 3OTOL 1N34L 1QUQB 1F9RA 2EYHA 3IAYA 3C1EA 2Z8LA 2N8NA 1PTOC 2AWOA 1E0BA 2PO4A 3KDFA 1EY5A 4B08A 1WTVA 4HSVA 3BJUA 1IHZA 1HNWL 1KL9A 4FF3A 2CKZB 1QILA 3J81E 1TWGH 2JEAI 1HH2P 1CKOA 2I07B 1SMYC 2I5LX 4XT3B 3CHBD 2B2WC 3AMUA 1PH2A 2DJGC 5GAGC 4A3EH 1SNMA 1KQSA 3NELA 4Y52H 5HGQA 5TSSA 5CV6A 4C3HH 1GXDC 1BBXC 3N6RA 4PMCA 4X3UA 4GOPB 1SNCA 4DNTB 1RKNA 3EJIA 4DV2L 1VMCA 1C48A 2KEDA 4B3TQ 1I4QA 4TQUS 2F4VQ 2X6GA 2FHTA 4XQNA 3C1FA 1STNA 3T1HQ 3K5MA 1PH1A 3TP7A 3VR2A 5IY0A 1TS2A 1A2UA 4LF6Q 3E9IA 4YIJA 5IYDH 3SK8A 4HAEA 1NSNS 4A3EG 1GD7A 2L9HA 2QEJC 2F0VA 4HN7A 2ASBA 2KVMA 1BQQT 3T1YL 2I0QA 4F87A 3AB9A 5IGBA 3S2HH 1XTDA 1K3RA 1BBWA 2D62A 4A93H 1QUQA 1YI2A 2MGSA 3CC2A 5IT9L 1LT3D 2EOTA 2EY2A 1YJNA 4B3SQ 1I4RA 1R9TB 4JI3L 2EVBA 4QIWE 1GUNA 2HCIA 1IKLA 1EYDA 3B6YA 1V1QA 4JI0L 1MBYA 1WCMH 2BH2A 3TS0A 2NYZD 1L0XB 4YY3Q 5M5XB 4JV5Q 1SNQA 3I70A 3PF5A 4OL7A 2EDGA 1MI2A 1TWGB 4NXMQ 1E22A 4NXNQ 1QZGA 5GADC 2I46A 1IBLL 1CQFA 2KOLA 2F3IA 4LFAL 1WFQA 1B1ZA 1RDPD 2F0HA 3M4PA 5IE8A 3HOZH 2VB3X 4LUVA 3P7JA 1D5XC 1MKHA 1QB5D 4CJ0B 4H13C 5EKLA 4RWSC 2WACA 5CV5A 4LF5Q 1Y8NB 1MIUA 3S1QH 4A3BB 1EU3A 3EBEA 2C9OA 3GTMB 3MAQA 4KI0A 3D3RA 1JOQA 1STHA 3FPPA 4DFAA 2NVQH 1Y14B 2SEBD 2HHHQ 4YCUA 3S16B 4K2KA 4HTHA 4BA1I 1SJHD 1U4PA 1X3FA 5KEEA 1N8RC 1HR0L 4OEMB 5I6WA 1LTRD 3I4NH 3MVVA 2IL8A 4JOIC 4J15A 1LYLA 4QF4A 3NE5B 1PMRA 1MJCA 4KN7C 1SYCA 2HQLA 3RLOA 2Z4IA 1JOOA 3ITPA 4WORA 2ZJQA 4A3FH 4DR3L 2NTTA 4CDDC 4CJ2C 2AQ3B 2D9UA 4BY1B 2F3VA 4K14A 1CQVA 2ICIA 2B63G 3S1MH 1BXTA 3I4MB 5JVH3 2ZTDA 2PNHA 1VCIA 4CKBA 3FEWX 3KLWA 4OELB 1ENFA 2F0KA 3CC4A 2R7FA 1M8AA 4YCVA 1ET9A 2G5DA 4HIMA 1I50B 1S4ZA 4C3HG 5A35A 1CA5A 4HJAA 4DR6Q 1EEID 1OXXK 1QVCA 3L9AX 1QJOA 5BN3A 1VQPA 3HFZB 2NVQB 5DNFA 2XVSA 2WFWA 1JJCB 2XN9C 1PVOA 2NB0A 1U4RA 1STYA 4B3ML 4X65Q 2D2CC 1KHIA 4N9TA 2L12A 1A0IA 2B2VA 5C0XH 4L5RC 3W5OA 4FO2A 3TBIB 3FKIG 1LT5D 2A6ED 4JI1Q 4L5QA 1BCPF 2NVTB 4DF7A 4PZ7A 3PUYA 4YWKA 4A3IB 2L0CA 3J81i 4IPDA 1XMQL 3RUZA 3K58A 2JA6H 4MNOA 1J5EL 4HIOA 1Q8IA 4ZK9B 4OXPA 3GTJH 1Z47A 2L5TA 4C3JH 3NENA 4LF9Q 3NBHA 2NVTH 4LF4L 1G91A 1J9OA 1ML0D 5BN5A 5HURA 2R92G 3A5ZB 4K2LA 2Q2IA 2RDHA 1QVGA 5CV9A 1SEBD 3H0GB 1Q46A 5DAUA 5LL6S 3S15B 4Q5VA 4B3RQ 3GV6A 3W1GA 4CKEA 1SJED 3E5SA 2K5VA 2L11A 2B2VC 1BCPD 2LSSA 1TQOA 3GTGH 4C2MB 4DAPA 3DUZA 1B3QA 3D4WA 2M9VA 5LMNW 1SAPA 2LS01 2EJFC 5I2XA 2WKCA 1YHQA 3EFXD 2QF7A 2KUMA 2JA5B 2NBFA 1PYWD 2F0WA 1SROA 2EYLA 3JAML 3CC7A 4JV5L 3BU2A 1X3GA 1TWHH 1A63A 3D8GA 1JB7A 4DR5L 2KHIA 3UDGA 2UXBL 1D1KA 2UXCL 3U9OA 2VUMG 1RTOA 4A3KB 1I6HB 4XQQA 4BXXG 3CCQA 3T4AC 2CCZA 1D5ZC 1VQHA 3HP3A 4L5TA 3NBIA 4MN3A 4ZRZA 4K0KQ 2WB1E 2PMZE 2E2IB 1UE5A 5DLQE 5CC4A 4ALPA 4YCWA 2A1AA 3NUCA 5IGCA 4JK1C 3H3VC 3U4ZA 2NN6G 2IWHA 1EYGA 4JOIA 2P5ZX 2NZHA 3GTPB 4MTKA 3QOJA 1Q82C 2E2IH 1KNAA 5EPLA 4C3IH 1VQMA 1NR4A 1RF2D 4I65A 3G48A 4WJWA 3ERQA 1SNDA 3SHLA 3HOYG 2DUDA 3F1ZA 5FK9C 4EX5A 4FVMA 4ZUJA 5J1ZA 5JJKA 1JE5A 3SE0A 2AUKA 1D7QA 3IL8A 4PQXA 1J6QA 1VQBA 1TR5A 1VQGA 4EQNA 4A3GG 1A2TA 1GUGA 5G3LF 3I3CA 2UXDL 1G6ZA 4EVOA 1GJXA 4ME3A 1I94Q 5C4XB 1SLJA 3NWTA 5CYUA 1RODA 2A6HD 5L37A 1PH3A 3N52A 1H9SA 1VQ8A 3BS1A 2Q8RE 2SNSA 3M3YH 1CSQA 5DM63 5JEAG 2E5LQ 1B8AA 1BBUA 1E7ZA 1EQQA 2IT1A 3CCSA 1U4LA 5FLMG 2PMZB 4V190 1FGBD 3M7NA 2IJ0A 2E2JH 1VS0A 5IGFA 1I6VC 1XMOL 2WIIB 4M1UB 1VQNA 4KD3A 3G6JB 4RAUC 2Y0SG 3FDTA 3GO5A 3NWSA 1W3SA 3T1HL 1DOLA 3NQTA 2A68D 1YNXA 1X3EA 2D0OA 4JYAQ 5FO7B 2F0UA 3PO2G 3G4SA 4C56C 1GUTA 4WFN3 1TWCH 3S2HB 4DR1L 4R8NA 2GVBA 3QOLA 4K8IA 1K73C 1LLRD 2EY6A 2ZM6L 2MJ8A 1WCMG 3QB3A 1S5ED 1EUJA 1L1OB 2CQAA 2LY7A 1HUNA 1UEBA 2IHEA 2GA4B 2G9DA 2R7DA 2XIWA 1P16A 4LF9L 1ILQA 2YU9H 1N33Q 1K8MA 2PCFB 1AE2A 4XYOA 1EY0A 4IFDG 1YVCA 4KTAA 2JA7H 2ZJRA 1CUKA 3CCVA 1R4PB 1F2LA 1PTOH 4LW1A 3HOZG 4KY6A 3Q22A 2A6EC 1VQDA 4IOAA 1XX8A 4A3DB 4QL5A 1K3BC 2VZAA 1HRJA 4CGYB 2VUMH 3J7A5 5LL6X 4BBSH 2UUCL 2AUJD 2B63H 4LF7Q 1PLFA 1BDOA 2EY1A 2UUAL 3WOEA 4ZAIA 2X6LA 1K28A 3U9SA 1Y8OB 1XTCD 2IPKD 3A8KE 2M00A 3AFPA 3BDLA 2N55A 5C0XG 1RHPA 2B2TA 3I4MG 5C5LA 1CM9A 3A7AB 3T56B 2IY5B 2VXWA 3G71A 4A3JH 4HIKA 1TS5A 1Y1WH 2BA0A 3ONAB 5AJ3L 1MSHA 1LV9A 2NVXH 3DM3A 4GOPC 2MP1A 3M9BA 4OWWB 1T9HA 3KFUA 4IUUA 2UUCQ 2F0TA 3HZXA 3CRLC 1Z7TA 4ILWA 1H9RA 3KF8B 4LF6L 5FOBB 4OX9Q 3TQYA 3HOUB 4DR3Q 2NZ1D 2KBNA 4U673 2Q2HA 4LFAQ 5IGEA 3P1HA 5IP7H 5F2DA 1NJIC 1X54A 3S9WA 4AYBE 3NSWA 4DK3C 2A19A 3K8AA 3CKIB 3CP0A 4MIUA 4RGMA 4APVA 1VQEA 4TRDA 1ZYRD 3HEJA 2ID0A 2B8FA 3DWAA 1PRTB 4OO1I 2N3SA 4IJHA 3T13A 3R3OA 2ZTCA 3IKJA 3D4DA 2LKVA 1V1PB 4DUZL 1NMGA 3M4YA
chains in the Genus database with same CATH topology
1VQCA 1YJNA 4B3SQ 3L2PA 4JI3L 1PH5A 4JBJA 2RHSB 3HKZG 4QIWE 5BR8Q 4JG2A 2R6GA 4GKKQ 3B6YA 3GTQH 2QA4A 3RZOH 1L1OC 1V1QA 3SGIA 1PH6A 4JI0L 1WCMH 3RZDH 2BH2A 3H0GG 1AH9A 3TS0A 4YY3Q 4JI1L 4JI7Q 2OCEA 4JV5Q 3CPFA 2HIVA 3W1BA 3PF5A 4H02A 3S15H 3I7FA 4AYBG 4NXMQ 1E22A 4NXNQ 4A3CG 1Z9FA 1SN8A 3CF5A 1QZGA 2JA5H 5GADC 4JBWA 1PH8A 1IBLL 4A3DH 3A5UA 1FJGL 2F3IA 5M5WH 1WFQA 4LFAL 3J80c 1A8VA 1B7YB 1HZAA 3PV0A 3J81j 2VQFL 1GM5A 4UP7A 2JK8A 3OTOQ 4DV1L 2EXDA 1N34Q 5J3BA 3M4PA 3TREA 5IE8A 4A3IH 1EIYB 4JI5Q 3HOZH 2OQ0A 4OONA 2YTXA 4LUVA 3RN2A 1YIJA 1PA6A 1X56A 3GTLH 1V9PA 1MKHA 3UE1A 1S40A 4LF8Q 1OXVA 1XNRL 5ELNA 4WJ4A 1JJGA 1EOVA 2K52A 1PYBA 2ALYB 2Q2UA 4A3KH 5E7NA 4LF5Q 4LFCL 1MIUA 4R4OA 3UDFA 3S1QH 3T1YQ 3EBEA 5IYCH 1OXTA 3HKSA 1HZBA 5M5XH 4GNXA 3RN5A 3AEVA 1N32L 1VQ4A 4DR1Q 4KI0A 2MO0A 3HKZE 1OXUA 1PH7A 5JJLA 2NVQH 2R92H 1Y14B 2HHHQ 4YCUA 3RLFA 5C3EG 4YWLA 4BA1I 1X3FA 4LF8L 1N8RC 3FP9A 1IBKQ 4DKAC 1HR0L 4DV6L 4DV5L 3I4NH 2EQSA 4LFBL 3PO2H 4KLKA 4WJ3M 5IP7G 2EIFA 4JOIC 4J15A 1LYLA 1K9MC 1I94L 1P8LA 4P73A 4DR7L 1MJCA 1RIPA 2HQLA 3RLOA 3MXNB 4DR5Q 2JA8G 2ZJQA 3ULJA 4X62L 3CXCA 1XMQQ 4DV0L 4A3FH 1K8AC 4DR3L 1HNZL 4A76A 2K5HA 3KDFB 1L1OA 3PUVA 1Q7YC 3CCEA 2B63G 3JAMi 2VQEL 3S1MH 1HR0Q 4IPGA 2ZTDA 2K50A 1SFOH 1M90C 1GVPA 2PNHA 1VCIA 4K0KL 3KLWA 1N36L 3PF4A 4DV3L 4X66L 5HY6A 4DV2Q 3CC4A 1HR0W 2R7FA 4YCVA 3ER0A 4X65L 2JA7G 4P72A 3JC66 3A0JA 2IX1A 2MO1A 4HIMA 4IJLA 3OW2A 2Y0SE 2I5MX 1LM0A 2RHQB 3UE0A 1VQKA 3GTOH 2HHHL 4HJAA 4LUZA 2VNUD 2FXQA 5M5YH 5GAHC 3PO3G 2F52A 4PMWA 4DR6Q 1OXXK 1A62A 1QVCA 4NPSA 1VQPA 4DPGA 4LF5L 3PGZA 3HFZB 3TEHB 2K4KA 4FDBA 3HOYH 2WFWA 2JA5G 1JJCB 3PUXA 4POGA 5M3MH 2WB1G 1PVOA 2KHJA 4DNIA 3S17H 2B3GA 3PUZA 5C44H 1FGUA 4B3ML 1KRTA 1VQ7A 4X65Q 1KHIA 1PH4A 2H5XA 4DR4Q 5IP9G 4KHPL 1U0LA 3LGJA 5M3MG 1A0IA 4L5RC 3W5OA 4JI2Q 3FKIG 1K8GA 4JI1Q 4L5QA 2VQEQ 1BKBA 4PZ7A 3PUYA 5M3FH 1UWVA 4YWKA 3K7UC 4A3BG 2E2HH 2CWPA 4JI8L 2RF4A 3CMAA 1PH9A 1JT8A 4AIMA 4IPDA 4X62Q 1CKNB 3J81i 5BR8L 3HOXG 1XMQL 1N36Q 2JA6H 2JQOA 2Z6KA 4MNOA 1IBLQ 2HT1A 3ULLA 5ELOA 1J5EL 1FVIA 3K81C 4O0AA 3F2DA 4HIOA 1C0AA 3HOXH 3GD7A 4OX9L 1PHJA 4A3LH 4JI7L 2IHFA 4OXPA 3GTJH 3KOJA 3EIVA 1XNQL 1PV4A 4B3RL 2NVYH 4UPAA 4LNQA 1X9NA 1Z47A 5LMNL 4DUYL 4GLXA 5GROA 4BXXH 4C3JH 2PI2A 2E5LL 3NENA 1KIXA 4LF9Q 3BZCA 1VQAA 2KCTA 1I6HH 2R7ZH 2NVTH 1SE8A 1WI5A 4LF4L 5JJIA 4DR2L 2R92G 4YWMA 3A5ZB 4LFCQ 4GLVB 2Q2IA 4YHHL 1QVGA 2Q2TA 3UDXA 1SRUA 1Q46A 1YBYA 2Z6KC 3G6EA 1VQ5A 4A4IA 4AH6A 4BY7G 2D0PA 4GKJL 1XNQQ 4B3RQ 1RL2A 2JJQA 3W1GA 2YYZA 3U50C 4GLAC 2R93G 2Z0SA 4QJFA 4LF7L 3L7ZC 1OTCA 1WJJA 2DGYA 2N49A 4IPHA 2K5VA 4UY8C 1X6OA 2OQKA 4QGUA 2LSSA 2WAQG 4IPCA 1V43A 3PCOB 4JI4L 3GTGH 4UP8A 1B70B 1UE1A 2C35B 3CCLA 2VY3A 5LMNW 5IWAL 5IYCG 2UU9Q 2GVAA 4EQ5A 1Y1WG 2V1CC 3ICEA 1VQ9A 4QQBX 2YTYA 3H3VI 3I56A 1YHQA 2KCMA 4A3JG 1O7IA 3AQQA 5LMUQ 3ERSX 1SROA 3CC7A 4A3GH 4JV5L 4B3SL 1TWFH 4X6AH 3BU2A 1X3GA 3GTKH 3CCJA 1TWHH 1IBMQ 1J5EQ 3TRZA 1A63A 1JB7A 4DR5L 1NMFA 3CW2C 2OTJA 4XTCS 2KHIA 2LXJA 5FJ8H 1E1TA 3UDGA 1YHAA 4DV0Q 4JBKA 2R7ZG 1HNWQ 4X64L 5M3FG 1Y1VG 4GKKL 2UXCL 2UXBL 2R93H 5GAEC 3K80C 1I5FA 1IL2A 2VUMG 1YEZA 1HNXL 4BXXG 2AKWB 3CCQA 5IWAQ 3I55A 2UU9L 2CCZA 1VQHA 1CKNA 1VQFA 2VW9A 1HJPA 3GDEA 2B29A 2HIXA 4GKJQ 2AMCB 1L2FA 3S24A 4L5TA 1Q8KA 4DR6L 3Q8DA 1EQRA 3J7ZC 3ULPA 2GN5A 2WB1E 4KHZA 4K0KQ 3PSIA 1YJ9A 3F2CA 2PMZE 1GKHA 5IYBG 1UE7A 2N78A 3M4QA 1UE5A 1IBML 5DLQE 1NBWA 3I4MH 2NN6I 4ALPA 4YCWA 1GO3E 2A1AA 3JAMc 4P75A 1NY4A 3U4ZA 2NN6G 3HOVG 3FHWA 5C0XI 1YZ6A 2QEXA 3D31A 4AQYQ 1VQOA 1EYGA 1U5KA 1XPUA 1WOCA 2BH8A 4GN3B 4JOIA 4P71A 4PZ8A 4R4QA 2NZHA 5C4JH 1XMOQ 1EFWA 4R4CA 1SR3A 4DV4Q 2ATWA 1XNRQ 1KRSA 4O2DA 1Q82C 2E2IH 1D8LA 2JA6G 5LMUL 2CFMA 2L15A 2UXDQ 4R4TA 3CCUA 1Q86C 4OWTB 4C3IH 5GQOA 1VQMA 4IFDI 3G48A 3F2BA 2ES2A 2BA1A 1N9WA 2MFIA 4HJ7A 3HOYG 4JI8Q 1BVSA 3CAMA 4GNXB 3S16H 2CWAA 2PI2E 2K75A 4JYAL 4LFBQ 2DUDA 2XTIA 4HJ9A 1IYJB 3F1ZA 4Y7NH 3CD6A 3TS2A 1HZ9A 1Y1VH 2K14A 4DAMA 4EX5A 1Q81C 3HOUG 1E3PA 1TXYA 5JJKA 1JE5A 3WWVA 1CSPA 3RLNA 5IYBH 4A75A 1M1KC 1D7QA 1XJVA 4IOCA 1J6QA 1VQBA 1VQGA 1IBKL 4A3GG 4DUZQ 4OWXB 4DV7L 1G6PA 5C44G 5EAYA 3BZKA 1C9OA 2RCNA 2UXDL 5AJ3Q 3H0GH 4ME3A 1I94Q 2CQOA 1HNXQ 1SLJA 4HIDA 1S3OA 2UUBQ 1VQ6A 3I4NG 3PIPA 4QY7A 1PH3A 1ASZA 4JI0Q 1KC8C 3CQZH 3I2ZA 1VQ8A 5FJ8G 2ZM6Q 5IT9c 1JMCA 1UE6A 3J81c 1CSQA 3M3YH 4JI6Q 4JI5L 1L0WA 5JEAG 1LUZA 2E5LQ 4NB3A 1EWIA 3J80i 3S1RH 4JBMA 1B8AA 3PIOA 4PG3A 1ASYA 3H15A 1BBUA 2LXKA 1E7ZA 5H1SE 2IT1A 4DV7Q 2JA9A 4TVAB 3CCSA 4A3IG 1EQQA 1MJEA 2JA8H 1HZCA 3L0OA 5FLMG 2A8VA 3GTPH 4A3KG 2AHOB 5FLMH 1S72A 3M7NA 5JEAJ 3A74A 5FLXc 2E2JH 1VS0A 4A3CH 1XMOL 3H3VH 4B3TL 4DAYB 1W2BA 2UUAQ 2XGTA 3RNUA 4DR4L 1VQNA 3NBHB 1G51A 2Y0SG 2VL6A 3GO5A 1W3SA 4KHPQ 3IRBA 3RR5A 3T1HL 4A3BH 3S1NH 1K83H 1FL0A 3AFQA 4JI2L 1YNXA 1X3EA 2D0OA 4JYAQ 3CCRA 4JI4Q 4JC0A 4LUOA 3KJPA 4DV6Q 3PO2G 3G4SA 4MZ9A 1YITA 1WYDA 4B3MQ 4XIGS 4A3LG 1TWCH 1N33L 1NE3A 4DR1L 4DR7Q 4UP9A 2ZTEA 2GVBA 1K73C 2PQAA 2ZM6L 1Q1EA 1Q1BA 3GTMH 2MQHA 3KF6B 1I3QH 1WCMG 2OWOA 1EUJA 1L1OB 3K7AH 4IFDJ 1CKMA 5C4XH 4GN4B 4HJ5A 4IO9A 4BBSG 3E9HA 1UEBA 3HOVH 1I50H 2IHEA 4DV5Q 2UUBL 3FKIH 1EIFA 3U4VA 4DUYQ 2UXBQ 2KENA 2R7DA 5IYDG 3CMEA 1Q12A 3E0EA 1P16A 1G291 4LF4Q 4LF9L 3F8TA 5IP9H 2YU9H 4BBRH 1N33Q 2VS1A 2ZJPA 1IXRA 1AE2A 1YHBA 2I5HA 4DV3Q 1QZHA 4JI6L 1IZ6A 1YVCA 2JA7H 4DR2Q 2OTLA 4IFDG 2VQFQ 3M85A 1CUKA 2ZJRA 3CCVA 2MNAA 4A93G 4PZ6A 4C2MH 4LW1A 2PQAB 4DV1Q 3HOZG 1LTLA 3HOUH 3CPWA 4RMFA 2K5NA 1E1OA 1VQDA 4IOAA 4NXML 4QL5A 2VZAA 2VUMH 3J7A5 4BBSH 5C4XG 3DLLA 2UUCL 2WAQE 1PYSB 2F4VL 2B63H 3S14H 3HOWG 1VQLA 4LF7Q 4A3MG 1DGSA 2UUAL 5K36G 4LWCA 3OTOL 1N34L 1KD1C 4AQYL 4BY1H 1QUQB 4A3FG 4BBRG 4A3MH 3HOWH 3UDIA 4GN5A 1VQJA 2YTVA 3AFPA 2N8NA 4MTNA 4L5SA 2WP8J 2AWOA 3PO3H 5C0XG 3KDFA 3EN2A 3I4MG 5C0XJ 4GOPA 3D0FA 3BJUA 1N32Q 2IX0A 3M4OH 4R4IA 1KL9A 3MEFA 1HNWL 2IY5B 2AWNA 1OXSC 2CKZB 2E8GA 3G71A 4A3JH 1TWGH 2JEAI 1HH2P 3KYHC 3NEMA 1XPRA 1CKOA 2UXCQ 4JCVE 4HIKA 2I5LX 1YJWA 1SMXA 1TWAH 4BY7H 1Y1WH 4OO1G 2BA0A 1X55A 2QGQA 5AJ3L 1PH2A 1AE3A 5GAGC 3CCMA 4A3EH 2NVXH 1KQSA 3NELA 5LMNQ 3DM3A 4GOPC 5HGQA 3M9BA 4BY1G 1X65A 1T9HA 4OWWB 4C3HH 3KFUA 4Y52H 3KF6A 2UUCQ 4RG1A 4X64Q 2JEBI 3KF8B 4LF6L 1H95A 4GS3A 1QVFA 3I4OA 4GOPB 4OX9Q 3TQYA 1KXLA 4DR3Q 1HNZQ 1KAWA 2KBNA 1NTGA 4X66Q 4DV2L 2Q2HA 4LFAQ 5IP7H 4B3TQ 4GNXC 1NJIC 1X54A 3STBC 4BA2I 4AYBE 1JJ2A 3U58A 2JE6I 4TQUS 3ZJYC 2F4VQ 4DV4L 3T1HQ 1PH1A 3K0XA 4NXNL 4DK3C 2A19A 3AYHB 4P74A 3K8AA 3CP0A 3STBD 3VDYA 4HJ8A 3PUWA 5IY0A 1C7YA 1FJGQ 4APVA 4YHHQ 1VQEA 1K0RA 3E9IA 4DK6C 4LF6Q 4JI3Q 5IYDH 3KJOA 4A3EG 4R1JA 1GD7A 2YV5A 2ID0A 2ASBA 1E24A 3T1YL 2I0QA 3OYYA 1PFSA 4A3DG 1VQIA 3S2HH 1XTDA 4OO1I 4YY3L 1K3RA 1BBWA 2D62A 2N3SA 4POFA 1QUQA 4IJHA 1R9TH 4A93H 2ZTCA 1YI2A 5C3EH 1XPOA 3CC2A 3S2DH 2NZOA 4DUZL 1NMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQC A;  1YJN A;  4B3S Q;  3L2P A;  4JI3 L;  1PH5 A;  4JBJ A;  2RHS B;  3HKZ G;  4QIW E;  5BR8 Q;  4JG2 A;  2R6G A;  4GKK Q;  3B6Y A;  3GTQ H;  2QA4 A;  3RZO H;  1L1O C;  1V1Q A;  3SGI A;  1PH6 A;  4JI0 L;  1WCM H;  3RZD H;  2BH2 A;  3H0G G;  1AH9 A;  3TS0 A;  4YY3 Q;  4JI1 L;  4JI7 Q;  2OCE A;  4JV5 Q;  3CPF A;  2HIV A;  3W1B A;  3PF5 A;  4H02 A;  3S15 H;  3I7F A;  4AYB G;  4NXM Q;  1E22 A;  4NXN Q;  4A3C G;  1Z9F A;  1SN8 A;  3CF5 A;  1QZG A;  2JA5 H;  5GAD C;  4JBW A;  1PH8 A;  1IBL L;  4A3D H;  3A5U A;  1FJG L;  2F3I A;  5M5W H;  1WFQ A;  4LFA L;  3J80 c;  1A8V A;  1B7Y B;  1HZA A;  3PV0 A;  3J81 j;  2VQF L;  1GM5 A;  4UP7 A;  2JK8 A;  3OTO Q;  4DV1 L;  2EXD A;  1N34 Q;  5J3B A;  3M4P A;  3TRE A;  5IE8 A;  4A3I H;  1EIY B;  4JI5 Q;  3HOZ H;  2OQ0 A;  4OON A;  2YTX A;  4LUV A;  3RN2 A;  1YIJ A;  1PA6 A;  1X56 A;  3GTL H;  1V9P A;  1MKH A;  3UE1 A;  1S40 A;  4LF8 Q;  1OXV A;  1XNR L;  5ELN A;  4WJ4 A;  1JJG A;  1EOV A;  2K52 A;  1PYB A;  2ALY B;  2Q2U A;  4A3K H;  5E7N A;  4LF5 Q;  4LFC L;  1MIU A;  4R4O A;  3UDF A;  3S1Q H;  3T1Y Q;  3EBE A;  5IYC H;  1OXT A;  3HKS A;  1HZB A;  5M5X H;  4GNX A;  3RN5 A;  3AEV A;  1N32 L;  1VQ4 A;  4DR1 Q;  4KI0 A;  2MO0 A;  3HKZ E;  1OXU A;  1PH7 A;  5JJL A;  2NVQ H;  2R92 H;  1Y14 B;  2HHH Q;  4YCU A;  3RLF A;  5C3E G;  4YWL A;  4BA1 I;  1X3F A;  4LF8 L;  1N8R C;  3FP9 A;  1IBK Q;  4DKA C;  1HR0 L;  4DV6 L;  4DV5 L;  3I4N H;  2EQS A;  4LFB L;  3PO2 H;  4KLK A;  4WJ3 M;  5IP7 G;  2EIF A;  4JOI C;  4J15 A;  1LYL A;  1K9M C;  1I94 L;  1P8L A;  4P73 A;  4DR7 L;  1MJC A;  1RIP A;  2HQL A;  3RLO A;  3MXN B;  4DR5 Q;  2JA8 G;  2ZJQ A;  3ULJ A;  4X62 L;  3CXC A;  1XMQ Q;  4DV0 L;  4A3F H;  1K8A C;  4DR3 L;  1HNZ L;  4A76 A;  2K5H A;  3KDF B;  1L1O A;  3PUV A;  1Q7Y C;  3CCE A;  2B63 G;  3JAM i;  2VQE L;  3S1M H;  1HR0 Q;  4IPG A;  2ZTD A;  2K50 A;  1SFO H;  1M90 C;  1GVP A;  2PNH A;  1VCI A;  4K0K L;  3KLW A;  1N36 L;  3PF4 A;  4DV3 L;  4X66 L;  5HY6 A;  4DV2 Q;  3CC4 A;  1HR0 W;  2R7F A;  4YCV A;  3ER0 A;  4X65 L;  2JA7 G;  4P72 A;  3JC6 6;  3A0J A;  2IX1 A;  2MO1 A;  4HIM A;  4IJL A;  3OW2 A;  2Y0S E;  2I5M X;  1LM0 A;  2RHQ B;  3UE0 A;  1VQK A;  3GTO H;  2HHH L;  4HJA A;  4LUZ A;  2VNU D;  2FXQ A;  5M5Y H;  5GAH C;  3PO3 G;  2F52 A;  4PMW A;  4DR6 Q;  1OXX K;  1A62 A;  1QVC A;  4NPS A;  1VQP A;  4DPG A;  4LF5 L;  3PGZ A;  3HFZ B;  3TEH B;  2K4K A;  4FDB A;  3HOY H;  2WFW A;  2JA5 G;  1JJC B;  3PUX A;  4POG A;  5M3M H;  2WB1 G;  1PVO A;  2KHJ A;  4DNI A;  3S17 H;  2B3G A;  3PUZ A;  5C44 H;  1FGU A;  4B3M L;  1KRT A;  1VQ7 A;  4X65 Q;  1KHI A;  1PH4 A;  2H5X A;  4DR4 Q;  5IP9 G;  4KHP L;  1U0L A;  3LGJ A;  5M3M G;  1A0I A;  4L5R C;  3W5O A;  4JI2 Q;  3FKI G;  1K8G A;  4JI1 Q;  4L5Q A;  2VQE Q;  1BKB A;  4PZ7 A;  3PUY A;  5M3F H;  1UWV A;  4YWK A;  3K7U C;  4A3B G;  2E2H H;  2CWP A;  4JI8 L;  2RF4 A;  3CMA A;  1PH9 A;  1JT8 A;  4AIM A;  4IPD A;  4X62 Q;  1CKN B;  3J81 i;  5BR8 L;  3HOX G;  1XMQ L;  1N36 Q;  2JA6 H;  2JQO A;  2Z6K A;  4MNO A;  1IBL Q;  2HT1 A;  3ULL A;  5ELO A;  1J5E L;  1FVI A;  3K81 C;  4O0A A;  3F2D A;  4HIO A;  1C0A A;  3HOX H;  3GD7 A;  4OX9 L;  1PHJ A;  4A3L H;  4JI7 L;  2IHF A;  4OXP A;  3GTJ H;  3KOJ A;  3EIV A;  1XNQ L;  1PV4 A;  4B3R L;  2NVY H;  4UPA A;  4LNQ A;  1X9N A;  1Z47 A;  5LMN L;  4DUY L;  4GLX A;  5GRO A;  4BXX H;  4C3J H;  2PI2 A;  2E5L L;  3NEN A;  1KIX A;  4LF9 Q;  3BZC A;  1VQA A;  2KCT A;  1I6H H;  2R7Z H;  2NVT H;  1SE8 A;  1WI5 A;  4LF4 L;  5JJI A;  4DR2 L;  2R92 G;  4YWM A;  3A5Z B;  4LFC Q;  4GLV B;  2Q2I A;  4YHH L;  1QVG A;  2Q2T A;  3UDX A;  1SRU A;  1Q46 A;  1YBY A;  2Z6K C;  3G6E A;  1VQ5 A;  4A4I A;  4AH6 A;  4BY7 G;  2D0P A;  4GKJ L;  1XNQ Q;  4B3R Q;  1RL2 A;  2JJQ A;  3W1G A;  2YYZ A;  3U50 C;  4GLA C;  2R93 G;  2Z0S A;  4QJF A;  4LF7 L;  3L7Z C;  1OTC A;  1WJJ A;  2DGY A;  2N49 A;  4IPH A;  2K5V A;  4UY8 C;  1X6O A;  2OQK A;  4QGU A;  2LSS A;  2WAQ G;  4IPC A;  1V43 A;  3PCO B;  4JI4 L;  3GTG H;  4UP8 A;  1B70 B;  1UE1 A;  2C35 B;  3CCL A;  2VY3 A;  5LMN W;  5IWA L;  5IYC G;  2UU9 Q;  2GVA A;  4EQ5 A;  1Y1W G;  2V1C C;  3ICE A;  1VQ9 A;  4QQB X;  2YTY A;  3H3V I;  3I56 A;  1YHQ A;  2KCM A;  4A3J G;  1O7I A;  3AQQ A;  5LMU Q;  3ERS X;  1SRO A;  3CC7 A;  4A3G H;  4JV5 L;  4B3S L;  1TWF H;  4X6A H;  3BU2 A;  1X3G A;  3GTK H;  3CCJ A;  1TWH H;  1IBM Q;  1J5E Q;  3TRZ A;  1A63 A;  1JB7 A;  4DR5 L;  1NMF A;  3CW2 C;  2OTJ A;  4XTC S;  2KHI A;  2LXJ A;  5FJ8 H;  1E1T A;  3UDG A;  1YHA A;  4DV0 Q;  4JBK A;  2R7Z G;  1HNW Q;  4X64 L;  5M3F G;  1Y1V G;  4GKK L;  2UXC L;  2UXB L;  2R93 H;  5GAE C;  3K80 C;  1I5F A;  1IL2 A;  2VUM G;  1YEZ A;  1HNX L;  4BXX G;  2AKW B;  3CCQ A;  5IWA Q;  3I55 A;  2UU9 L;  2CCZ A;  1VQH A;  1CKN A;  1VQF A;  2VW9 A;  1HJP A;  3GDE A;  2B29 A;  2HIX A;  4GKJ Q;  2AMC B;  1L2F A;  3S24 A;  4L5T A;  1Q8K A;  4DR6 L;  3Q8D A;  1EQR A;  3J7Z C;  3ULP A;  2GN5 A;  2WB1 E;  4KHZ A;  4K0K Q;  3PSI A;  1YJ9 A;  3F2C A;  2PMZ E;  1GKH A;  5IYB G;  1UE7 A;  2N78 A;  3M4Q A;  1UE5 A;  1IBM L;  5DLQ E;  1NBW A;  3I4M H;  2NN6 I;  4ALP A;  4YCW A;  1GO3 E;  2A1A A;  3JAM c;  4P75 A;  1NY4 A;  3U4Z A;  2NN6 G;  3HOV G;  3FHW A;  5C0X I;  1YZ6 A;  2QEX A;  3D31 A;  4AQY Q;  1VQO A;  1EYG A;  1U5K A;  1XPU A;  1WOC A;  2BH8 A;  4GN3 B;  4JOI A;  4P71 A;  4PZ8 A;  4R4Q A;  2NZH A;  5C4J H;  1XMO Q;  1EFW A;  4R4C A;  1SR3 A;  4DV4 Q;  2ATW A;  1XNR Q;  1KRS A;  4O2D A;  1Q82 C;  2E2I H;  1D8L A;  2JA6 G;  5LMU L;  2CFM A;  2L15 A;  2UXD Q;  4R4T A;  3CCU A;  1Q86 C;  4OWT B;  4C3I H;  5GQO A;  1VQM A;  4IFD I;  3G48 A;  3F2B A;  2ES2 A;  2BA1 A;  1N9W A;  2MFI A;  4HJ7 A;  3HOY G;  4JI8 Q;  1BVS A;  3CAM A;  4GNX B;  3S16 H;  2CWA A;  2PI2 E;  2K75 A;  4JYA L;  4LFB Q;  2DUD A;  2XTI A;  4HJ9 A;  1IYJ B;  3F1Z A;  4Y7N H;  3CD6 A;  3TS2 A;  1HZ9 A;  1Y1V H;  2K14 A;  4DAM A;  4EX5 A;  1Q81 C;  3HOU G;  1E3P A;  1TXY A;  5JJK A;  1JE5 A;  3WWV A;  1CSP A;  3RLN A;  5IYB H;  4A75 A;  1M1K C;  1D7Q A;  1XJV A;  4IOC A;  1J6Q A;  1VQB A;  1VQG A;  1IBK L;  4A3G G;  4DUZ Q;  4OWX B;  4DV7 L;  1G6P A;  5C44 G;  5EAY A;  3BZK A;  1C9O A;  2RCN A;  2UXD L;  5AJ3 Q;  3H0G H;  4ME3 A;  1I94 Q;  2CQO A;  1HNX Q;  1SLJ A;  4HID A;  1S3O A;  2UUB Q;  1VQ6 A;  3I4N G;  3PIP A;  4QY7 A;  1PH3 A;  1ASZ A;  4JI0 Q;  1KC8 C;  3CQZ H;  3I2Z A;  1VQ8 A;  5FJ8 G;  2ZM6 Q;  5IT9 c;  1JMC A;  1UE6 A;  3J81 c;  1CSQ A;  3M3Y H;  4JI6 Q;  4JI5 L;  1L0W A;  5JEA G;  1LUZ A;  2E5L Q;  4NB3 A;  1EWI A;  3J80 i;  3S1R H;  4JBM A;  1B8A A;  3PIO A;  4PG3 A;  1ASY A;  3H15 A;  1BBU A;  2LXK A;  1E7Z A;  5H1S E;  2IT1 A;  4DV7 Q;  2JA9 A;  4TVA B;  3CCS A;  4A3I G;  1EQQ A;  1MJE A;  2JA8 H;  1HZC A;  3L0O A;  5FLM G;  2A8V A;  3GTP H;  4A3K G;  2AHO B;  5FLM H;  1S72 A;  3M7N A;  5JEA J;  3A74 A;  5FLX c;  2E2J H;  1VS0 A;  4A3C H;  1XMO L;  3H3V H;  4B3T L;  4DAY B;  1W2B A;  2UUA Q;  2XGT A;  3RNU A;  4DR4 L;  1VQN A;  3NBH B;  1G51 A;  2Y0S G;  2VL6 A;  3GO5 A;  1W3S A;  4KHP Q;  3IRB A;  3RR5 A;  3T1H L;  4A3B H;  3S1N H;  1K83 H;  1FL0 A;  3AFQ A;  4JI2 L;  1YNX A;  1X3E A;  2D0O A;  4JYA Q;  3CCR A;  4JI4 Q;  4JC0 A;  4LUO A;  3KJP A;  4DV6 Q;  3PO2 G;  3G4S A;  4MZ9 A;  1YIT A;  1WYD A;  4B3M Q;  4XIG S;  4A3L G;  1TWC H;  1N33 L;  1NE3 A;  4DR1 L;  4DR7 Q;  4UP9 A;  2ZTE A;  2GVB A;  1K73 C;  2PQA A;  2ZM6 L;  1Q1E A;  1Q1B A;  3GTM H;  2MQH A;  3KF6 B;  1I3Q H;  1WCM G;  2OWO A;  1EUJ A;  1L1O B;  3K7A H;  4IFD J;  1CKM A;  5C4X H;  4GN4 B;  4HJ5 A;  4IO9 A;  4BBS G;  3E9H A;  1UEB A;  3HOV H;  1I50 H;  2IHE A;  4DV5 Q;  2UUB L;  3FKI H;  1EIF A;  3U4V A;  4DUY Q;  2UXB Q;  2KEN A;  2R7D A;  5IYD G;  3CME A;  1Q12 A;  3E0E A;  1P16 A;  1G29 1;  4LF4 Q;  4LF9 L;  3F8T A;  5IP9 H;  2YU9 H;  4BBR H;  1N33 Q;  2VS1 A;  2ZJP A;  1IXR A;  1AE2 A;  1YHB A;  2I5H A;  4DV3 Q;  1QZH A;  4JI6 L;  1IZ6 A;  1YVC A;  2JA7 H;  4DR2 Q;  2OTL A;  4IFD G;  2VQF Q;  3M85 A;  1CUK A;  2ZJR A;  3CCV A;  2MNA A;  4A93 G;  4PZ6 A;  4C2M H;  4LW1 A;  2PQA B;  4DV1 Q;  3HOZ G;  1LTL A;  3HOU H;  3CPW A;  4RMF A;  2K5N A;  1E1O A;  1VQD A;  4IOA A;  4NXM L;  4QL5 A;  2VZA A;  2VUM H;  3J7A 5;  4BBS H;  5C4X G;  3DLL A;  2UUC L;  2WAQ E;  1PYS B;  2F4V L;  2B63 H;  3S14 H;  3HOW G;  1VQL A;  4LF7 Q;  4A3M G;  1DGS A;  2UUA L;  5K36 G;  4LWC A;  3OTO L;  1N34 L;  1KD1 C;  4AQY L;  4BY1 H;  1QUQ B;  4A3F G;  4BBR G;  4A3M H;  3HOW H;  3UDI A;  4GN5 A;  1VQJ A;  2YTV A;  3AFP A;  2N8N A;  4MTN A;  4L5S A;  2WP8 J;  2AWO A;  3PO3 H;  5C0X G;  3KDF A;  3EN2 A;  3I4M G;  5C0X J;  4GOP A;  3D0F A;  3BJU A;  1N32 Q;  2IX0 A;  3M4O H;  4R4I A;  1KL9 A;  3MEF A;  1HNW L;  2IY5 B;  2AWN A;  1OXS C;  2CKZ B;  2E8G A;  3G71 A;  4A3J H;  1TWG H;  2JEA I;  1HH2 P;  3KYH C;  3NEM A;  1XPR A;  1CKO A;  2UXC Q;  4JCV E;  4HIK A;  2I5L X;  1YJW A;  1SMX A;  1TWA H;  4BY7 H;  1Y1W H;  4OO1 G;  2BA0 A;  1X55 A;  2QGQ A;  5AJ3 L;  1PH2 A;  1AE3 A;  5GAG C;  3CCM A;  4A3E H;  2NVX H;  1KQS A;  3NEL A;  5LMN Q;  3DM3 A;  4GOP C;  5HGQ A;  3M9B A;  4BY1 G;  1X65 A;  1T9H A;  4OWW B;  4C3H H;  3KFU A;  4Y52 H;  3KF6 A;  2UUC Q;  4RG1 A;  4X64 Q;  2JEB I;  3KF8 B;  4LF6 L;  1H95 A;  4GS3 A;  1QVF A;  3I4O A;  4GOP B;  4OX9 Q;  3TQY A;  1KXL A;  4DR3 Q;  1HNZ Q;  1KAW A;  2KBN A;  1NTG A;  4X66 Q;  4DV2 L;  2Q2H A;  4LFA Q;  5IP7 H;  4B3T Q;  4GNX C;  1NJI C;  1X54 A;  3STB C;  4BA2 I;  4AYB E;  1JJ2 A;  3U58 A;  2JE6 I;  4TQU S;  3ZJY C;  2F4V Q;  4DV4 L;  3T1H Q;  1PH1 A;  3K0X A;  4NXN L;  4DK3 C;  2A19 A;  3AYH B;  4P74 A;  3K8A A;  3CP0 A;  3STB D;  3VDY A;  4HJ8 A;  3PUW A;  5IY0 A;  1C7Y A;  1FJG Q;  4APV A;  4YHH Q;  1VQE A;  1K0R A;  3E9I A;  4DK6 C;  4LF6 Q;  4JI3 Q;  5IYD H;  3KJO A;  4A3E G;  4R1J A;  1GD7 A;  2YV5 A;  2ID0 A;  2ASB A;  1E24 A;  3T1Y L;  2I0Q A;  3OYY A;  1PFS A;  4A3D G;  1VQI A;  3S2H H;  1XTD A;  4OO1 I;  4YY3 L;  1K3R A;  1BBW A;  2D62 A;  2N3S A;  4POF A;  1QUQ A;  4IJH A;  1R9T H;  4A93 H;  2ZTC A;  1YI2 A;  5C3E H;  1XPO A;  3CC2 A;  3S2D H;  2NZO A;  4DUZ L;  1NMG A; 
#chains in the Genus database with same CATH topology
 3X3N A;  2PZU A;  4O42 A;  3L2P A;  3BG3 A;  3OW7 A;  1A3T A;  4JBJ A;  2RHS B;  2K33 A;  3HKZ G;  5IGG A;  4JG2 A;  1EOT A;  3GP7 A;  3CRK C;  1SE2 A;  1II3 A;  3VYT A;  5M9O A;  1L1O C;  1RD9 D;  1AH9 A;  1B53 A;  4JI1 L;  4JI7 Q;  1PTO D;  3CPF A;  2HIV A;  3EQL C;  1WD0 A;  4H02 A;  3S15 H;  4ULL A;  4A3C G;  1EQT A;  2JA5 H;  4PMB A;  1ET6 A;  5M5W H;  1B7Y B;  3DEO A;  3PV0 A;  4NW2 A;  5J3B A;  5EQ0 A;  1EIY B;  1GUS A;  2K5Q A;  2RKS A;  2YTX A;  2EXZ A;  1CI3 M;  1X56 A;  1C8C A;  3UE1 A;  1BCP C;  3MFY A;  1WD1 A;  1EOV A;  1LTA D;  5JPN C;  4R4O A;  3T1Y Q;  5IYC H;  1OXT A;  3HKS A;  1HZB A;  5M5X H;  4GNX A;  3AEV A;  4MHE A;  1N32 L;  1VQ4 A;  1ILP A;  2CHB D;  2MO0 A;  1OXU A;  3K5O A;  2PQE A;  5I2Y A;  1LT6 D;  5C3E G;  1YNN D;  3H6M A;  4NKL A;  1SSO A;  1IBK Q;  4DKA C;  4G7H C;  4A3M B;  4LFB L;  3PO2 H;  3S1M B;  1I94 L;  4H0L C;  2F4I A;  2JA8 G;  4DU9 A;  4C3I G;  3MXN B;  3I72 A;  1XMQ Q;  3CXC A;  1K8A C;  4DV0 L;  1SFO B;  4S3S A;  2HUG A;  1O78 A;  3BYY B;  1L1O A;  2X69 A;  3E3X A;  2K28 A;  4N8X 1;  1TWA B;  4BY7 B;  1ZYR C;  1HA6 A;  4X3T A;  1NNX A;  1M90 C;  1STB A;  4K8J A;  1T5E A;  5EBC A;  4K5W A;  3BDO A;  3BVG A;  1I4X A;  4DV3 L;  5DM7 3;  3A7L A;  5C5M A;  3ER0 A;  2JA7 G;  4P72 A;  2IX1 A;  4K6D A;  2MO1 A;  1EYC A;  1LM0 A;  1RTN A;  3GTO H;  1BR9 A;  1IW7 C;  5GAH C;  3PO3 G;  2F52 A;  1AEX A;  3T53 B;  2BDO A;  2V4D A;  1DYQ A;  2A74 C;  3BZD B;  4POG A;  4DNI A;  3S17 H;  1D5M C;  1JC7 A;  2K03 A;  5C44 H;  1SBB B;  3I4N B;  3SR1 A;  5M3F B;  1L0Y B;  4KHP L;  1U0L A;  3LGJ A;  5M3M G;  2PNR C;  4JI2 Q;  1TWC B;  1VF5 C;  2RDG A;  1JOK A;  3ZYY X;  4BS9 A;  4CDE C;  5FLX L;  3K6O A;  3Q6S A;  2PZW A;  1BKB A;  1PTO F;  1UWV A;  2E2H H;  1PH9 A;  4JI8 L;  3S2D B;  1JT8 A;  4KV6 A;  2ZXO A;  2JQO A;  1C0A A;  3ULL A;  5CBE E;  1FVI A;  3K81 C;  1HQM C;  1PHJ A;  4JI7 L;  3CU7 A;  3EIV A;  3KOJ A;  4B3R L;  2ZT9 C;  2K1B A;  4UPA A;  2F0S A;  3E6Z X;  5LMN L;  4BXX H;  2PI2 A;  1QNK A;  1WTO A;  1VQA A;  5CMD A;  2R7Z H;  3TN2 A;  2B2T C;  2NVY B;  1PDQ A;  2RCF A;  4ME5 A;  2Z6K C;  1YBY A;  4KY7 A;  4AH6 A;  1RL2 A;  2F3W A;  2JJQ A;  1PZK D;  4V0B A;  4AYB B;  1WCM B;  3ERO A;  1TWH B;  4QJF A;  3L7Z C;  2J0T D;  2N49 A;  1X6O A;  3MXP A;  1GUW A;  4IPC A;  3PCO B;  4F88 A;  4UP8 A;  3GTL B;  4X3K A;  1Y8P B;  4F7X A;  2VY3 A;  4C3J G;  2GVA A;  1Y1W G;  2V1C C;  1VQ9 A;  1STA A;  4QQB X;  1SYD A;  2KCM A;  4DK0 A;  4A3J G;  1YNN C;  5LMU Q;  3ERS X;  3CCJ A;  1J5E Q;  3SK4 A;  4XTC S;  3V2T A;  2LXJ A;  1YHA A;  1EIG A;  5C3X A;  1Y1V G;  2A68 C;  5GAE C;  1IL2 A;  1YEZ A;  2B63 B;  2DY8 A;  2L55 A;  5HGT A;  1VQF A;  3GDE A;  3TME A;  4GKJ Q;  4NMZ A;  5K5P A;  2AMC B;  3KUP A;  4KHV A;  3Q8D A;  1RCV D;  3VYR A;  3ULP A;  2GN5 A;  1KLG D;  2EPB A;  5FO8 B;  1KDB A;  4XYQ A;  5IYB G;  1Y69 U;  1IBM L;  2JA7 B;  1NBW A;  3KBX A;  3SVM A;  3TP5 A;  2A69 D;  4P75 A;  2B2U A;  4CKC A;  5C0X I;  3H09 A;  2EYP A;  2QEX A;  4AQY Q;  3JAM E;  1XPU A;  4A3E B;  2BH8 A;  4P71 A;  1EFW A;  2ATW A;  2E2J B;  3Q23 A;  1LAB A;  4BBR B;  1XNR Q;  1T5X D;  3F2U A;  2UXD Q;  3CCU A;  1Q86 C;  1JB3 A;  1MGS A;  5GQO A;  4IFD I;  1JE4 A;  2ES2 A;  1N9W A;  4HJ7 A;  3I4L A;  4HSP A;  4GNX B;  4F8M A;  3J81 L;  2K75 A;  2DNC A;  5M5Y B;  2XTI A;  4HJ9 A;  4IQZ A;  3HOU G;  3KBG A;  3O13 A;  4LK1 C;  2EYO A;  1X3Q A;  3PMF A;  4A75 A;  1M1K C;  3TP6 A;  1F9P A;  4RKB A;  4IOC A;  4IZ8 A;  4OWX B;  3MFG A;  5C44 G;  1JWS D;  3A54 A;  2RCN A;  4HMI A;  1SDF A;  5D3D A;  1VQ6 A;  4QY7 A;  4CDC C;  3I8Z A;  2KJX A;  4J8Q A;  1EY7 A;  1JMC A;  1UE6 A;  3OWE B;  4JI6 Q;  2F0M A;  4NB3 A;  3J80 i;  1ASY A;  4PG3 A;  5H1S E;  2JA9 A;  4KKU A;  1MJE A;  1HZC A;  2EY5 A;  3GTP H;  4A3K G;  1S72 A;  5FLX c;  4I7A A;  2J4X A;  1I4G A;  4G4K A;  1W2B A;  4DAV A;  1O7Y A;  1DM0 B;  5JJZ A;  2EJM A;  4ZUI A;  4DR4 L;  1H9S B;  1EIH A;  4Q0F A;  4KHP Q;  3RR5 A;  4A3B H;  4RGN A;  1AZQ A;  4JI2 L;  4QUF A;  4JI4 Q;  1LAC A;  1OO9 B;  4TKO B;  4MZ9 A;  1YIT A;  4B3M Q;  2B2Y C;  5KNC A;  4A3L G;  1H9J A;  3DWP A;  4RHR A;  3FKI B;  1Q1E A;  1Q1B A;  4R8I A;  3GTM H;  3MEH A;  4CBV A;  4EGV A;  3K7A H;  1CKM A;  4IO9 A;  4GN4 B;  1FR3 A;  4BBS G;  3E9H A;  1LTI D;  4LJZ C;  2NN6 H;  1Y1V B;  2UUB L;  1EIF A;  2XWB B;  4DUY Q;  2WAQ B;  3NTK A;  4H44 C;  3E0E A;  5AFW A;  1H9M A;  2VS1 A;  2ZJP A;  1IXR A;  4DV3 Q;  1QZH A;  3WDN A;  2HDM A;  1IZ6 A;  2OTL A;  1A3U A;  4EQP A;  1B3A A;  4C2M H;  5J22 A;  2CW0 C;  1FD7 D;  3HOU H;  4M8A A;  2K5N A;  1E1O A;  4K6L A;  1J8I A;  5E3F A;  5C4X G;  2R92 B;  1PYS B;  3LWU A;  3M7G A;  4ID6 A;  1DGS A;  4KMU C;  4OGQ C;  1KD1 C;  3A8I E;  4AQY L;  3RZD B;  4BY1 H;  4A3F G;  4BBR G;  4A3M H;  5IT9 E;  3HOW H;  5CGK A;  1KDC A;  4GN5 A;  1X3P A;  3K0Y A;  1B9M A;  1JOR A;  4MTN A;  2H4O A;  5C4J B;  2WP8 J;  1Q3L A;  2B39 A;  3PO3 H;  3GTQ B;  3EN2 A;  2F0I A;  5C0X J;  5JEA H;  1XYI A;  3D0F A;  2M2L A;  2H1E A;  1CT1 D;  2IX0 A;  1N32 Q;  1EL0 A;  2A69 C;  1OXS C;  2E8G A;  3C3L A;  4IUP A;  4A3G B;  3NEM A;  1UUP A;  5G3L D;  1SNO A;  1YJW A;  1DCZ A;  1SMX A;  1TWA H;  2XNA C;  4BY7 H;  4OO1 G;  4DXG A;  2JA6 B;  2QGQ A;  2DY7 A;  3GTG B;  3CCM A;  2NTS A;  5LMN Q;  3D6C A;  1X65 A;  3R2I A;  2KHS A;  1DOK A;  3EA6 A;  2JEB I;  1H95 A;  1QVF A;  1KXL A;  1HNZ Q;  1NTG A;  1WVL A;  1SE3 A;  5COY A;  2EE1 A;  4UAI A;  3V05 A;  3STB C;  4BA2 I;  4DK1 A;  1JJ2 A;  1JWM D;  2JE6 I;  3ZJY C;  4DV4 L;  4NXN L;  4P74 A;  1IL8 A;  4HJ8 A;  3PUW A;  1FJG Q;  4I7Z C;  4XXE A;  3KJO A;  2PW5 A;  2Y0S B;  1E2Z A;  1EQV A;  5ELF A;  1E24 A;  1O7L A;  3OYY A;  1PFS A;  4ABN A;  4A3D G;  1R9T H;  4POF A;  3QG1 A;  2XSC A;  1S5F D;  3MC0 B;  4OIK A;  3MZ5 A;  1TY0 A;  4DGZ A;  1VQC A;  3HRZ C;  2K5W A;  5A2Q E;  1GUO A;  1IKM A;  1VMP A;  3EVQ A;  4CHT B;  4GKK Q;  3GTQ H;  1MSG A;  3RZO H;  1LTS D;  3RZD H;  3H0G G;  2O2L D;  1STG A;  4G57 A;  2OCE A;  3W1B A;  3L3O C;  1XWE A;  1HPC A;  5I4D A;  1Z9F A;  4Z9C B;  2K04 A;  3CF5 A;  1V1P A;  2N88 A;  4JBW A;  1PH8 A;  2Q8T A;  4B9X A;  3A5U A;  4UDU C;  1FJG L;  2E2D C;  2K5D A;  1A8V A;  1HZA A;  3QJY A;  4IUT A;  3J81 j;  4FXK C;  1EEF D;  2VQF L;  4UP7 A;  1GM5 A;  3TRE A;  4A3I H;  3VA7 A;  3V96 A;  2F1M A;  3I90 A;  4OON A;  4FNF A;  3VR5 A;  1YIJ A;  3RN2 A;  1PA6 A;  3GTL H;  3FMC A;  3S1Q B;  4QMG A;  1W6K A;  4LF8 Q;  1XNR L;  1JJG A;  1LTG D;  1PYB A;  2ALY B;  2Q2U A;  4G7O C;  4A3K H;  3J7A V;  1AP0 A;  1ESF A;  2EYM A;  3IFD A;  1W6J A;  4DR1 Q;  5C3W A;  4PNY A;  4C1N I;  3J7Y W;  1PH7 A;  5JJL A;  2R92 H;  3FPU B;  3A55 A;  1F2Y A;  1HFN A;  2EYJ A;  2QCP X;  3FP9 A;  5E4X A;  4DV6 L;  3HS0 C;  4OIJ A;  2EQS A;  3DWQ A;  5IP7 G;  3A8J E;  4P73 A;  3H94 A;  2F0G A;  1RIP A;  2XRS D;  4DR5 Q;  3WOF A;  1SNP A;  3ULJ A;  4X62 L;  2E2H B;  1BCP B;  2R7Z B;  4A76 A;  3KDF B;  1CA6 A;  1O7Z A;  3PUV A;  1Q7Y C;  1YNJ D;  2VQE L;  2C5C A;  4IPG A;  4KK7 A;  1SYE A;  1K0S A;  4K0K L;  3PF4 A;  4ZCK A;  4DV2 Q;  2SOB A;  5HY6 A;  4A93 B;  2CW0 D;  1HR0 W;  4DA2 A;  3A0J A;  5EKI A;  5K36 H;  3OW2 A;  4IJL A;  2Y0S E;  3UE0 A;  1SXT A;  2HHH L;  2VNU D;  4LUZ A;  5M5Y H;  4DNR B;  1SYB A;  4PMW A;  2F0D A;  1F2Z A;  1A62 A;  4NPS A;  1U4M A;  3TEH B;  1DOM A;  4FDB A;  2FIN B;  3DM1 A;  3NP8 A;  3HOY H;  3OMC A;  4QUC A;  2JA5 G;  2NVX B;  3CQZ B;  3PUX A;  2WB1 G;  1SE4 A;  3PUZ A;  4TSS A;  2JYO A;  1G2T A;  1FGU A;  1EY9 A;  4N8F A;  1PH4 A;  4KD4 A;  4DR4 Q;  1SMY D;  5IP9 G;  2VUM B;  2AQ1 B;  3S17 B;  1MD2 D;  1K8G A;  3BYT B;  2VQE Q;  3X3M A;  4A3B G;  3CMA A;  1WTW A;  3QO2 A;  1TY2 A;  5KYL A;  1IYV A;  5I6Y A;  3GTO B;  5ELO A;  4O0A A;  3F2D A;  4RH6 A;  3HOX H;  2B2W A;  3GD7 A;  2CVR A;  1GHK A;  4A3L H;  2WIN B;  4DXF A;  1XNQ L;  1PRT C;  1EYA A;  2B2Y A;  1X9N A;  3P75 A;  2FMC A;  2E5L L;  2KCT A;  5D65 A;  3LWE A;  4QB4 A;  1SE8 A;  1WI5 A;  4FXD A;  4E6I A;  1TS4 A;  3NHH A;  5IOC A;  2VB2 X;  5EJW A;  5JJI A;  4YWM A;  4LFC Q;  4GLV B;  2EZV A;  2Q2T A;  3UDX A;  3W2D A;  5FLX E;  2JN4 A;  1Q90 A;  2RSO A;  3RMH A;  4A4I A;  1VQ5 A;  4BY7 G;  3D6W A;  5LHY 1;  2RDF A;  3TP8 A;  4RFB A;  2YYZ A;  1SYG A;  4GLA C;  4RA8 A;  1CHP D;  3MXU A;  5ISR A;  3C46 A;  4LF7 L;  4FF1 A;  1SYF A;  4FYD A;  1OTC A;  1WJJ A;  3M3Y B;  4IPH A;  5E4W C;  2OQK A;  2HDL A;  2WAQ G;  4NP5 A;  1V43 A;  1ZKO A;  1B70 B;  4C3H B;  4PV1 C;  3PO3 B;  4EQ5 A;  1A6X A;  3ICE A;  3J7A F;  4HCS A;  1ENC A;  1ICW A;  1O7I A;  4GZY C;  4DN4 M;  1B9N A;  4A3G H;  1TWF H;  3GTK H;  1IBM Q;  2QDB A;  3TRZ A;  1EU4 A;  3CW2 C;  2OTJ A;  2R7Z G;  1E1T A;  4H7B A;  1A3V A;  1HNW Q;  1BUV T;  1I5F A;  5CV4 A;  2Z6B A;  5IWA Q;  2UU9 L;  4A3F B;  4EQO A;  3S24 A;  1L2F A;  2PZT A;  2F0O A;  3QIA A;  4KHZ A;  1YJ9 A;  4ZYS A;  3F2C A;  1KAA A;  3I4M H;  2N78 A;  4LAA A;  1FYC A;  2NN6 I;  1GO3 E;  3JAM c;  2MHV A;  3PIO 3;  1NY4 A;  3HOV G;  1YZ6 A;  2R3Z A;  3D31 A;  1VQO A;  5FKA C;  1U5K A;  3LX0 A;  1WOC A;  4GN3 B;  4R4Q A;  1B2T A;  5C4J H;  1PFM A;  1SR3 A;  2KA7 A;  4DV4 Q;  1KRS A;  2NWG A;  4O2D A;  1D1I A;  1D8L A;  2JA6 G;  2L15 A;  1K8O A;  4R9W A;  4G7Z C;  3F2B A;  2KCC A;  4JI8 Q;  1BVS A;  3CAM A;  3S16 H;  2CWA A;  2PI2 E;  5M3M B;  2O5I C;  1Z6H A;  2OEO A;  2NUC A;  1QOH A;  1Y1V H;  2K14 A;  1Q81 C;  5CV8 A;  3QR8 A;  1E3P A;  1TXY A;  2A6H C;  3DHQ A;  3NPP A;  1NAP A;  2WV6 D;  1CSP A;  5IYB H;  1XJV A;  2F0N A;  2R61 A;  1ESR A;  2HQE A;  2ZXR A;  1IBK L;  4DUZ Q;  2OT2 A;  1F9Q A;  1G6P A;  3OIQ A;  1JR0 D;  4O1N A;  3HG9 A;  5AJ3 Q;  3H0G H;  1HXY D;  4U68 A;  3SK5 A;  4LMQ D;  1HNX Q;  4HID A;  1TVX A;  1S3O A;  2UUB Q;  2O5J C;  1ICF B;  1ASZ A;  2DNE A;  2ZM6 Q;  3GTK B;  4QCL A;  1L0W A;  1LUZ A;  1EWI A;  3S1R H;  4NDX A;  4JBM A;  3PIO A;  2LXK A;  5IGD A;  2PW7 A;  4DV7 Q;  4TVA B;  4A3I G;  1WTQ A;  5NUC A;  2JA8 H;  3L0O A;  1S5C D;  2BE5 D;  3HOX B;  2JSO A;  2K32 A;  2A8V A;  2Z1C A;  2AHO B;  4L63 B;  5JEA J;  3A74 A;  4A3C H;  1ZEQ X;  1DD2 A;  1AZP A;  3H3V H;  1JWU D;  3HKZ B;  3VYU A;  4DAY B;  4B3T L;  3RNU A;  1TKW B;  3NBH B;  1B44 D;  1CHQ D;  1G51 A;  4BWG B;  3TZD A;  1K83 H;  1FL0 A;  3VR3 A;  3AFQ A;  1YNJ C;  3CCR A;  4JPB W;  1EZ6 A;  1A15 A;  3KJP A;  4C3J B;  4DV6 Q;  1D6E C;  3AU7 A;  1KLU D;  1WYD A;  4XIG S;  5T1I A;  5KND A;  1FNW A;  3Q24 A;  4L6T B;  1PXU A;  3GTJ B;  1I4H A;  4KY5 A;  3D4R A;  2PQA A;  3MHB A;  5KGU A;  3KF6 B;  1I3Q H;  2R93 B;  4IFD J;  2YU9 B;  1XXG A;  5C4X H;  4HJ5 A;  1I50 H;  1O80 A;  2Z4H A;  2UXB Q;  1Q12 A;  5M5W B;  3F8T A;  4BBR H;  4P2C B;  4JI6 L;  3OIP A;  2ZXP A;  2MPM A;  1FNV A;  4DV1 Q;  1PZJ D;  1LTL A;  3CPW A;  2OXP A;  4NXM L;  1I4P A;  5ELD A;  2WAQ E;  2F4V L;  3A56 A;  1VQL A;  1K83 B;  4A3M G;  5K36 G;  3UI2 A;  3SEB A;  1CK1 A;  3UDI A;  5C4Z A;  1VQJ A;  1JCK B;  3OOC A;  2YTV A;  1HTL D;  4L5S A;  4IN3 A;  2BE5 C;  4JVZ A;  1LO5 D;  2G9H D;  1UEA B;  1KAB A;  3SK6 A;  5JVG 3;  1KDA A;  5EKK A;  4GOP A;  3NQI A;  4WRD A;  2RSN A;  1HQR D;  3M4O H;  4R4I A;  3MEF A;  4RGO S;  2AWN A;  2B8G A;  2UXC Q;  3KYH C;  1XPR A;  4JCV E;  3K59 A;  1LTB D;  4RHS A;  2KCN A;  1X55 A;  4J1M A;  1AE3 A;  4X3S A;  3GV3 A;  4BY1 G;  4RCO A;  5I9O A;  1QE6 A;  3KF6 A;  2CH4 W;  2DN8 A;  4RG1 A;  4X64 Q;  4GS3 A;  3TDQ A;  3I4O A;  1KAW A;  4X66 Q;  2TSS A;  3Q0A A;  4GNX C;  3U58 A;  2Z9H A;  2E74 C;  1U9R A;  2A73 B;  3K0X A;  1CFM A;  1KTK A;  3AYH B;  3STB D;  3VDY A;  2L4N A;  1C7Y A;  2PPB C;  3S1N B;  4YHH Q;  1K0R A;  4DK6 C;  3T51 B;  4JI3 Q;  5CR3 A;  5COR A;  4R1J A;  2YV5 A;  5KNB A;  4C3I B;  1VQI A;  5KRU A;  1EY4 A;  2JXM B;  3OMG A;  1B50 A;  3M4O B;  4YY3 L;  4KN4 C;  2BCO A;  1JQY D;  5C3E H;  1ENA A;  2A5H A;  2Q8I B;  4XDX A;  1XPO A;  3S2D H;  2NZO A;  4A3J B;  4IUV A;  3MXG A;  1WTP A;  1STE A;  1PH5 A;  2K6A A;  2F0E A;  5BR8 Q;  2R6G A;  5DEH A;  2HD3 A;  4BBS B;  1TWF B;  1M4V A;  2QA4 A;  3SGI A;  1PH6 A;  4RKL A;  3R2T A;  2JP1 A;  1EY6 A;  3OSO A;  3PIP 3;  1EFI D;  3I7F A;  4AYB G;  2MUY A;  3RZO B;  3MA2 B;  1SN8 A;  4JW0 A;  2ICE C;  4A3D H;  4K5V A;  1HHV A;  3J80 c;  3OTO Q;  2JK8 A;  1N34 Q;  4DV1 L;  2EXD A;  5FO9 B;  5KYI A;  4JI5 Q;  2OQ0 A;  3BDC A;  1NUC A;  1V9P A;  3FVQ A;  1S40 A;  4WJ4 A;  1OXV A;  1TS3 A;  1PRT F;  5ELN A;  2WKD A;  2K52 A;  3NXW A;  2RVL A;  2XWJ B;  1NCV A;  2FMM A;  5E7N A;  4LFC L;  3H91 A;  3UDF A;  1V8Q A;  3K5L A;  2K01 A;  4DAY A;  3RN5 A;  4ZKC B;  5ELE A;  3I73 A;  3HKZ E;  2F0F A;  2E75 C;  2F0J A;  3RLF A;  1HFG A;  4YWL A;  5CV7 A;  2B2U C;  4HCE A;  4LF8 L;  4DV5 L;  4CDF C;  4KLK A;  3NK9 A;  4WJ3 M;  2EIF A;  1K9M C;  1P8L A;  1VF7 A;  2E76 C;  1DJR D;  4DR7 L;  5EPJ A;  1HNZ L;  2QKI C;  1E2W A;  2SNM A;  2K5H A;  4HED A;  4KJO A;  4L8J A;  5JPM C;  4C1N K;  3CCE A;  2IW3 A;  3JAM i;  1HR0 Q;  1AN8 A;  2K50 A;  1SFO H;  4IAL A;  1F9S A;  1GVP A;  2AQ2 B;  4IUQ A;  1AFP A;  1ZXT A;  1N36 L;  4X66 L;  3S1R B;  5I9P A;  3KLS A;  4X65 L;  1HUM A;  3W3A A;  3JC6 6;  5CBA E;  2ENB A;  3E0J A;  1VQK A;  2I5M X;  2RHQ B;  3OPO A;  4IUR A;  2FXQ A;  1KNE A;  3KF8 A;  3VYS A;  4XQJ A;  4DPG A;  4LF5 L;  3PGZ A;  3C2P A;  2K4K A;  3URY A;  3DMU A;  1VDZ A;  5M3M H;  1F2M A;  3PQI A;  2KHJ A;  2PYK A;  4UHV A;  2B3G A;  2SDF A;  1KRT A;  1VQ7 A;  1F77 A;  5A2Q L;  1EZ8 A;  1IYU A;  3MWY W;  2H5X A;  2DJF C;  4FXG C;  4FF4 A;  3HOY B;  4HMJ A;  2F0L A;  1DXM A;  1WTX A;  3LNN A;  1GHJ A;  2QW7 A;  5M3F H;  1GOZ A;  3K7U C;  2CWP A;  2RF4 A;  2LFN A;  3ND9 A;  1HTP A;  4AIM A;  4X62 Q;  1CKN B;  5BR8 L;  3HOX G;  2O4X A;  2BDN A;  1N36 Q;  2Z6K A;  1IBL Q;  2HT1 A;  1BO0 A;  4KKT A;  4OX9 L;  1RJT A;  5C3E B;  2IHF A;  1QWY A;  2KEC A;  1PV4 A;  2NVY H;  4LNQ A;  4DUY L;  1C4Q A;  5GRO A;  5BN4 A;  3QWN A;  4GLX A;  3MTS A;  1TT2 A;  1KIX A;  4OHJ A;  3HOZ B;  3BZC A;  1I6H H;  5JAV A;  1JIC A;  1PRT D;  1B4O A;  1QNU A;  4DR2 L;  4YHH L;  2L1B A;  3G6E A;  1SRU A;  3DXJ C;  4ZLT F;  2D0P A;  4GKJ L;  1XNQ Q;  3U50 C;  1WTR A;  2R93 G;  2Z0S A;  2OF1 A;  2DGY A;  4UY8 C;  4QGU A;  4JI4 L;  5J39 A;  5EGT A;  3TSS A;  1UE1 A;  2C35 B;  3CCL A;  1PTO B;  3NTH A;  5KIX A;  3PO2 B;  5IWA L;  5IYC G;  2UU9 Q;  1UAP A;  3ND8 A;  1E2V A;  5D3I B;  2YTY A;  3H3V I;  3I56 A;  1ONL A;  3J80 L;  3AQQ A;  2K05 A;  5ELB A;  2WB1 B;  4X6A H;  4B3S L;  1LT4 D;  1NMF A;  1TII D;  4JBK A;  5FJ8 H;  4DV0 Q;  1TU2 B;  4RCN A;  4X64 L;  5M3F G;  4GKK L;  1I3Q B;  2R93 H;  1EWH A;  3K80 C;  4KJN A;  1HNX L;  2AKW B;  3I55 A;  5T1G A;  1CKN A;  4B9W A;  2VW9 A;  2FJ2 A;  1HJP A;  2B29 A;  4K5X A;  2HIX A;  3TZU A;  1CZW A;  1Q8K A;  1S5D D;  4DR6 L;  1HA5 A;  1WTH A;  1EQR A;  3BVM A;  3J7Z C;  3MXN A;  3PSI A;  2XRQ D;  4N9P A;  1GKH A;  3I91 A;  1UE7 A;  3M4Q A;  2FFK B;  1PZI D;  1PFN A;  3KK7 A;  5IIF A;  2D5D A;  3SDZ A;  4RGT A;  3FHW A;  5EPK A;  3HOW B;  1UNS A;  5C4H A;  1PFB A;  1V1O A;  3DEP A;  4PZ8 A;  1G8Z D;  1S5B D;  1XMO Q;  3J80 E;  3K57 A;  4R4C A;  4IFD H;  2BOS A;  5LMU L;  4IUN A;  2CFM A;  5EBD A;  4R4T A;  3T16 A;  4OWT B;  5IOD A;  2F03 A;  2BA1 A;  2MFI A;  4JYA L;  4LFB Q;  1AW7 A;  2F0P A;  3CD6 A;  1IYJ B;  1HCZ A;  4Y7N H;  2RQX A;  1D2B A;  4FP5 D;  3TS2 A;  1HZ9 A;  4DAM A;  1BNZ A;  3WWV A;  3RLN A;  1QG7 A;  1X32 A;  3R8B A;  2IX3 A;  3RD4 A;  1DON A;  4DV7 L;  5EAY A;  3BZK A;  1C9O A;  2TMP A;  2EYF A;  5D14 A;  2CQO A;  4KKS A;  3I4N G;  2K7V A;  3PIP A;  3VA5 A;  4CJ1 B;  4JI0 Q;  1KC8 C;  3CQZ H;  3I2Z A;  4ZKB B;  3KLS X;  5FJ8 G;  5IT9 c;  5ELC A;  2QDL A;  3S14 B;  3J81 c;  4JI5 L;  2HCC A;  3GQB A;  3H15 A;  2J7Z A;  1EY8 A;  1IW7 D;  1CTM A;  3K5N A;  1DZ1 A;  5FLM H;  2RA4 A;  1NR2 A;  1G2S A;  1R4Q B;  2UUA Q;  2XGT A;  1MHW C;  3HGB A;  4QIW B;  2F0Q A;  3VR4 A;  1BOS A;  2EJG C;  2VL6 A;  3IRB A;  3S1N H;  1H9K A;  1FNU A;  4JC0 A;  3OWF A;  4LUO A;  3NTI A;  3KLR A;  5E1F A;  3VR6 A;  5C6A A;  4HR7 B;  1N33 L;  1NE3 A;  2QIL A;  4DR7 Q;  4UP9 A;  2ZTE A;  2JA8 B;  4ZQ3 A;  2KEE A;  3BVZ A;  4J6H A;  2MQH A;  1LTT D;  2OWO A;  2CH4 A;  3IFT A;  5JOB A;  4XT1 B;  4OO1 H;  3HOV H;  4DV5 Q;  1EWC A;  3FKI H;  3U4V A;  1QCB D;  2KEN A;  5IYD G;  3CME A;  4LF4 Q;  1G29 1;  5IP9 H;  3K7A B;  2KQ3 A;  3OHX C;  1YHB A;  1Y1W B;  2I5H A;  4DR2 Q;  1CZG A;  2VQF Q;  3M85 A;  2RBM A;  2MNA A;  4A93 G;  4PZ6 A;  3SXH A;  4Y7N B;  2PQA B;  5C44 B;  4RMF A;  2LMC B;  3DLL A;  3S14 H;  3HOV B;  1BF4 A;  3HOW G;  3G7L A;  4FF2 A;  3P20 A;  3R93 A;  3FRP B;  4ODG A;  4LWC A;  3OTO L;  1N34 L;  1QUQ B;  1F9R A;  2EYH A;  3IAY A;  3C1E A;  2Z8L A;  2N8N A;  1PTO C;  2AWO A;  1E0B A;  2PO4 A;  3KDF A;  1EY5 A;  4B08 A;  1WTV A;  4HSV A;  3BJU A;  1IHZ A;  1HNW L;  1KL9 A;  4FF3 A;  2CKZ B;  1QIL A;  3J81 E;  1TWG H;  2JEA I;  1HH2 P;  1CKO A;  2I07 B;  1SMY C;  2I5L X;  4XT3 B;  3CHB D;  2B2W C;  3AMU A;  1PH2 A;  2DJG C;  5GAG C;  4A3E H;  1SNM A;  1KQS A;  3NEL A;  4Y52 H;  5HGQ A;  5TSS A;  5CV6 A;  4C3H H;  1GXD C;  1BBX C;  3N6R A;  4PMC A;  4X3U A;  4GOP B;  1SNC A;  4DNT B;  1RKN A;  3EJI A;  4DV2 L;  1VMC A;  1C48 A;  2KED A;  4B3T Q;  1I4Q A;  4TQU S;  2F4V Q;  2X6G A;  2FHT A;  4XQN A;  3C1F A;  1STN A;  3T1H Q;  3K5M A;  1PH1 A;  3TP7 A;  3VR2 A;  5IY0 A;  1TS2 A;  1A2U A;  4LF6 Q;  3E9I A;  4YIJ A;  5IYD H;  3SK8 A;  4HAE A;  1NSN S;  4A3E G;  1GD7 A;  2L9H A;  2QEJ C;  2F0V A;  4HN7 A;  2ASB A;  2KVM A;  1BQQ T;  3T1Y L;  2I0Q A;  4F87 A;  3AB9 A;  5IGB A;  3S2H H;  1XTD A;  1K3R A;  1BBW A;  2D62 A;  4A93 H;  1QUQ A;  1YI2 A;  2MGS A;  3CC2 A;  5IT9 L;  1LT3 D;  2EOT A;  2EY2 A;  1YJN A;  4B3S Q;  1I4R A;  1R9T B;  4JI3 L;  2EVB A;  4QIW E;  1GUN A;  2HCI A;  1IKL A;  1EYD A;  3B6Y A;  1V1Q A;  4JI0 L;  1MBY A;  1WCM H;  2BH2 A;  3TS0 A;  2NYZ D;  1L0X B;  4YY3 Q;  5M5X B;  4JV5 Q;  1SNQ A;  3I70 A;  3PF5 A;  4OL7 A;  2EDG A;  1MI2 A;  1TWG B;  4NXM Q;  1E22 A;  4NXN Q;  1QZG A;  5GAD C;  2I46 A;  1IBL L;  1CQF A;  2KOL A;  2F3I A;  4LFA L;  1WFQ A;  1B1Z A;  1RDP D;  2F0H A;  3M4P A;  5IE8 A;  3HOZ H;  2VB3 X;  4LUV A;  3P7J A;  1D5X C;  1MKH A;  1QB5 D;  4CJ0 B;  4H13 C;  5EKL A;  4RWS C;  2WAC A;  5CV5 A;  4LF5 Q;  1Y8N B;  1MIU A;  3S1Q H;  4A3B B;  1EU3 A;  3EBE A;  2C9O A;  3GTM B;  3MAQ A;  4KI0 A;  3D3R A;  1JOQ A;  1STH A;  3FPP A;  4DFA A;  2NVQ H;  1Y14 B;  2SEB D;  2HHH Q;  4YCU A;  3S16 B;  4K2K A;  4HTH A;  4BA1 I;  1SJH D;  1U4P A;  1X3F A;  5KEE A;  1N8R C;  1HR0 L;  4OEM B;  5I6W A;  1LTR D;  3I4N H;  3MVV A;  2IL8 A;  4JOI C;  4J15 A;  1LYL A;  4QF4 A;  3NE5 B;  1PMR A;  1MJC A;  4KN7 C;  1SYC A;  2HQL A;  3RLO A;  2Z4I A;  1JOO A;  3ITP A;  4WOR A;  2ZJQ A;  4A3F H;  4DR3 L;  2NTT A;  4CDD C;  4CJ2 C;  2AQ3 B;  2D9U A;  4BY1 B;  2F3V A;  4K14 A;  1CQV A;  2ICI A;  2B63 G;  3S1M H;  1BXT A;  3I4M B;  5JVH 3;  2ZTD A;  2PNH A;  1VCI A;  4CKB A;  3FEW X;  3KLW A;  4OEL B;  1ENF A;  2F0K A;  3CC4 A;  2R7F A;  1M8A A;  4YCV A;  1ET9 A;  2G5D A;  4HIM A;  1I50 B;  1S4Z A;  4C3H G;  5A35 A;  1CA5 A;  4HJA A;  4DR6 Q;  1EEI D;  1OXX K;  1QVC A;  3L9A X;  1QJO A;  5BN3 A;  1VQP A;  3HFZ B;  2NVQ B;  5DNF A;  2XVS A;  2WFW A;  1JJC B;  2XN9 C;  1PVO A;  2NB0 A;  1U4R A;  1STY A;  4B3M L;  4X65 Q;  2D2C C;  1KHI A;  4N9T A;  2L12 A;  1A0I A;  2B2V A;  5C0X H;  4L5R C;  3W5O A;  4FO2 A;  3TBI B;  3FKI G;  1LT5 D;  2A6E D;  4JI1 Q;  4L5Q A;  1BCP F;  2NVT B;  4DF7 A;  4PZ7 A;  3PUY A;  4YWK A;  4A3I B;  2L0C A;  3J81 i;  4IPD A;  1XMQ L;  3RUZ A;  3K58 A;  2JA6 H;  4MNO A;  1J5E L;  4HIO A;  1Q8I A;  4ZK9 B;  4OXP A;  3GTJ H;  1Z47 A;  2L5T A;  4C3J H;  3NEN A;  4LF9 Q;  3NBH A;  2NVT H;  4LF4 L;  1G91 A;  1J9O A;  1ML0 D;  5BN5 A;  5HUR A;  2R92 G;  3A5Z B;  4K2L A;  2Q2I A;  2RDH A;  1QVG A;  5CV9 A;  1SEB D;  3H0G B;  1Q46 A;  5DAU A;  5LL6 S;  3S15 B;  4Q5V A;  4B3R Q;  3GV6 A;  3W1G A;  4CKE A;  1SJE D;  3E5S A;  2K5V A;  2L11 A;  2B2V C;  1BCP D;  2LSS A;  1TQO A;  3GTG H;  4C2M B;  4DAP A;  3DUZ A;  1B3Q A;  3D4W A;  2M9V A;  5LMN W;  1SAP A;  2LS0 1;  2EJF C;  5I2X A;  2WKC A;  1YHQ A;  3EFX D;  2QF7 A;  2KUM A;  2JA5 B;  2NBF A;  1PYW D;  2F0W A;  1SRO A;  2EYL A;  3JAM L;  3CC7 A;  4JV5 L;  3BU2 A;  1X3G A;  1TWH H;  1A63 A;  3D8G A;  1JB7 A;  4DR5 L;  2KHI A;  3UDG A;  2UXB L;  1D1K A;  2UXC L;  3U9O A;  2VUM G;  1RTO A;  4A3K B;  1I6H B;  4XQQ A;  4BXX G;  3CCQ A;  3T4A C;  2CCZ A;  1D5Z C;  1VQH A;  3HP3 A;  4L5T A;  3NBI A;  4MN3 A;  4ZRZ A;  4K0K Q;  2WB1 E;  2PMZ E;  2E2I B;  1UE5 A;  5DLQ E;  5CC4 A;  4ALP A;  4YCW A;  2A1A A;  3NUC A;  5IGC A;  4JK1 C;  3H3V C;  3U4Z A;  2NN6 G;  2IWH A;  1EYG A;  4JOI A;  2P5Z X;  2NZH A;  3GTP B;  4MTK A;  3QOJ A;  1Q82 C;  2E2I H;  1KNA A;  5EPL A;  4C3I H;  1VQM A;  1NR4 A;  1RF2 D;  4I65 A;  3G48 A;  4WJW A;  3ERQ A;  1SND A;  3SHL A;  3HOY G;  2DUD A;  3F1Z A;  5FK9 C;  4EX5 A;  4FVM A;  4ZUJ A;  5J1Z A;  5JJK A;  1JE5 A;  3SE0 A;  2AUK A;  1D7Q A;  3IL8 A;  4PQX A;  1J6Q A;  1VQB A;  1TR5 A;  1VQG A;  4EQN A;  4A3G G;  1A2T A;  1GUG A;  5G3L F;  3I3C A;  2UXD L;  1G6Z A;  4EVO A;  1GJX A;  4ME3 A;  1I94 Q;  5C4X B;  1SLJ A;  3NWT A;  5CYU A;  1ROD A;  2A6H D;  5L37 A;  1PH3 A;  3N52 A;  1H9S A;  1VQ8 A;  3BS1 A;  2Q8R E;  2SNS A;  3M3Y H;  1CSQ A;  5DM6 3;  5JEA G;  2E5L Q;  1B8A A;  1BBU A;  1E7Z A;  1EQQ A;  2IT1 A;  3CCS A;  1U4L A;  5FLM G;  2PMZ B;  4V19 0;  1FGB D;  3M7N A;  2IJ0 A;  2E2J H;  1VS0 A;  5IGF A;  1I6V C;  1XMO L;  2WII B;  4M1U B;  1VQN A;  4KD3 A;  3G6J B;  4RAU C;  2Y0S G;  3FDT A;  3GO5 A;  3NWS A;  1W3S A;  3T1H L;  1DOL A;  3NQT A;  2A68 D;  1YNX A;  1X3E A;  2D0O A;  4JYA Q;  5FO7 B;  2F0U A;  3PO2 G;  3G4S A;  4C56 C;  1GUT A;  4WFN 3;  1TWC H;  3S2H B;  4DR1 L;  4R8N A;  2GVB A;  3QOL A;  4K8I A;  1K73 C;  1LLR D;  2EY6 A;  2ZM6 L;  2MJ8 A;  1WCM G;  3QB3 A;  1S5E D;  1EUJ A;  1L1O B;  2CQA A;  2LY7 A;  1HUN A;  1UEB A;  2IHE A;  2GA4 B;  2G9D A;  2R7D A;  2XIW A;  1P16 A;  4LF9 L;  1ILQ A;  2YU9 H;  1N33 Q;  1K8M A;  2PCF B;  1AE2 A;  4XYO A;  1EY0 A;  4IFD G;  1YVC A;  4KTA A;  2JA7 H;  2ZJR A;  1CUK A;  3CCV A;  1R4P B;  1F2L A;  1PTO H;  4LW1 A;  3HOZ G;  4KY6 A;  3Q22 A;  2A6E C;  1VQD A;  4IOA A;  1XX8 A;  4A3D B;  4QL5 A;  1K3B C;  2VZA A;  1HRJ A;  4CGY B;  2VUM H;  3J7A 5;  5LL6 X;  4BBS H;  2UUC L;  2AUJ D;  2B63 H;  4LF7 Q;  1PLF A;  1BDO A;  2EY1 A;  2UUA L;  3WOE A;  4ZAI A;  2X6L A;  1K28 A;  3U9S A;  1Y8O B;  1XTC D;  2IPK D;  3A8K E;  2M00 A;  3AFP A;  3BDL A;  2N55 A;  5C0X G;  1RHP A;  2B2T A;  3I4M G;  5C5L A;  1CM9 A;  3A7A B;  3T56 B;  2IY5 B;  2VXW A;  3G71 A;  4A3J H;  4HIK A;  1TS5 A;  1Y1W H;  2BA0 A;  3ONA B;  5AJ3 L;  1MSH A;  1LV9 A;  2NVX H;  3DM3 A;  4GOP C;  2MP1 A;  3M9B A;  4OWW B;  1T9H A;  3KFU A;  4IUU A;  2UUC Q;  2F0T A;  3HZX A;  3CRL C;  1Z7T A;  4ILW A;  1H9R A;  3KF8 B;  4LF6 L;  5FOB B;  4OX9 Q;  3TQY A;  3HOU B;  4DR3 Q;  2NZ1 D;  2KBN A;  4U67 3;  2Q2H A;  4LFA Q;  5IGE A;  3P1H A;  5IP7 H;  5F2D A;  1NJI C;  1X54 A;  3S9W A;  4AYB E;  3NSW A;  4DK3 C;  2A19 A;  3K8A A;  3CKI B;  3CP0 A;  4MIU A;  4RGM A;  4APV A;  1VQE A;  4TRD A;  1ZYR D;  3HEJ A;  2ID0 A;  2B8F A;  3DWA A;  1PRT B;  4OO1 I;  2N3S A;  4IJH A;  3T13 A;  3R3O A;  2ZTC A;  3IKJ A;  3D4D A;  2LKV A;  1V1P B;  4DUZ L;  1NMG A;  3M4Y A; 
#chains in the Genus database with same CATH homology
 1VQC A;  1YJN A;  4B3S Q;  3L2P A;  4JI3 L;  1PH5 A;  4JBJ A;  2RHS B;  3HKZ G;  4QIW E;  5BR8 Q;  4JG2 A;  2R6G A;  4GKK Q;  3B6Y A;  3GTQ H;  2QA4 A;  3RZO H;  1L1O C;  1V1Q A;  3SGI A;  1PH6 A;  4JI0 L;  1WCM H;  3RZD H;  2BH2 A;  3H0G G;  1AH9 A;  3TS0 A;  4YY3 Q;  4JI1 L;  4JI7 Q;  2OCE A;  4JV5 Q;  3CPF A;  2HIV A;  3W1B A;  3PF5 A;  4H02 A;  3S15 H;  3I7F A;  4AYB G;  4NXM Q;  1E22 A;  4NXN Q;  4A3C G;  1Z9F A;  1SN8 A;  3CF5 A;  1QZG A;  2JA5 H;  5GAD C;  4JBW A;  1PH8 A;  1IBL L;  4A3D H;  3A5U A;  1FJG L;  2F3I A;  5M5W H;  1WFQ A;  4LFA L;  3J80 c;  1A8V A;  1B7Y B;  1HZA A;  3PV0 A;  3J81 j;  2VQF L;  1GM5 A;  4UP7 A;  2JK8 A;  3OTO Q;  4DV1 L;  2EXD A;  1N34 Q;  5J3B A;  3M4P A;  3TRE A;  5IE8 A;  4A3I H;  1EIY B;  4JI5 Q;  3HOZ H;  2OQ0 A;  4OON A;  2YTX A;  4LUV A;  3RN2 A;  1YIJ A;  1PA6 A;  1X56 A;  3GTL H;  1V9P A;  1MKH A;  3UE1 A;  1S40 A;  4LF8 Q;  1OXV A;  1XNR L;  5ELN A;  4WJ4 A;  1JJG A;  1EOV A;  2K52 A;  1PYB A;  2ALY B;  2Q2U A;  4A3K H;  5E7N A;  4LF5 Q;  4LFC L;  1MIU A;  4R4O A;  3UDF A;  3S1Q H;  3T1Y Q;  3EBE A;  5IYC H;  1OXT A;  3HKS A;  1HZB A;  5M5X H;  4GNX A;  3RN5 A;  3AEV A;  1N32 L;  1VQ4 A;  4DR1 Q;  4KI0 A;  2MO0 A;  3HKZ E;  1OXU A;  1PH7 A;  5JJL A;  2NVQ H;  2R92 H;  1Y14 B;  2HHH Q;  4YCU A;  3RLF A;  5C3E G;  4YWL A;  4BA1 I;  1X3F A;  4LF8 L;  1N8R C;  3FP9 A;  1IBK Q;  4DKA C;  1HR0 L;  4DV6 L;  4DV5 L;  3I4N H;  2EQS A;  4LFB L;  3PO2 H;  4KLK A;  4WJ3 M;  5IP7 G;  2EIF A;  4JOI C;  4J15 A;  1LYL A;  1K9M C;  1I94 L;  1P8L A;  4P73 A;  4DR7 L;  1MJC A;  1RIP A;  2HQL A;  3RLO A;  3MXN B;  4DR5 Q;  2JA8 G;  2ZJQ A;  3ULJ A;  4X62 L;  3CXC A;  1XMQ Q;  4DV0 L;  4A3F H;  1K8A C;  4DR3 L;  1HNZ L;  4A76 A;  2K5H A;  3KDF B;  1L1O A;  3PUV A;  1Q7Y C;  3CCE A;  2B63 G;  3JAM i;  2VQE L;  3S1M H;  1HR0 Q;  4IPG A;  2ZTD A;  2K50 A;  1SFO H;  1M90 C;  1GVP A;  2PNH A;  1VCI A;  4K0K L;  3KLW A;  1N36 L;  3PF4 A;  4DV3 L;  4X66 L;  5HY6 A;  4DV2 Q;  3CC4 A;  1HR0 W;  2R7F A;  4YCV A;  3ER0 A;  4X65 L;  2JA7 G;  4P72 A;  3JC6 6;  3A0J A;  2IX1 A;  2MO1 A;  4HIM A;  4IJL A;  3OW2 A;  2Y0S E;  2I5M X;  1LM0 A;  2RHQ B;  3UE0 A;  1VQK A;  3GTO H;  2HHH L;  4HJA A;  4LUZ A;  2VNU D;  2FXQ A;  5M5Y H;  5GAH C;  3PO3 G;  2F52 A;  4PMW A;  4DR6 Q;  1OXX K;  1A62 A;  1QVC A;  4NPS A;  1VQP A;  4DPG A;  4LF5 L;  3PGZ A;  3HFZ B;  3TEH B;  2K4K A;  4FDB A;  3HOY H;  2WFW A;  2JA5 G;  1JJC B;  3PUX A;  4POG A;  5M3M H;  2WB1 G;  1PVO A;  2KHJ A;  4DNI A;  3S17 H;  2B3G A;  3PUZ A;  5C44 H;  1FGU A;  4B3M L;  1KRT A;  1VQ7 A;  4X65 Q;  1KHI A;  1PH4 A;  2H5X A;  4DR4 Q;  5IP9 G;  4KHP L;  1U0L A;  3LGJ A;  5M3M G;  1A0I A;  4L5R C;  3W5O A;  4JI2 Q;  3FKI G;  1K8G A;  4JI1 Q;  4L5Q A;  2VQE Q;  1BKB A;  4PZ7 A;  3PUY A;  5M3F H;  1UWV A;  4YWK A;  3K7U C;  4A3B G;  2E2H H;  2CWP A;  4JI8 L;  2RF4 A;  3CMA A;  1PH9 A;  1JT8 A;  4AIM A;  4IPD A;  4X62 Q;  1CKN B;  3J81 i;  5BR8 L;  3HOX G;  1XMQ L;  1N36 Q;  2JA6 H;  2JQO A;  2Z6K A;  4MNO A;  1IBL Q;  2HT1 A;  3ULL A;  5ELO A;  1J5E L;  1FVI A;  3K81 C;  4O0A A;  3F2D A;  4HIO A;  1C0A A;  3HOX H;  3GD7 A;  4OX9 L;  1PHJ A;  4A3L H;  4JI7 L;  2IHF A;  4OXP A;  3GTJ H;  3KOJ A;  3EIV A;  1XNQ L;  1PV4 A;  4B3R L;  2NVY H;  4UPA A;  4LNQ A;  1X9N A;  1Z47 A;  5LMN L;  4DUY L;  4GLX A;  5GRO A;  4BXX H;  4C3J H;  2PI2 A;  2E5L L;  3NEN A;  1KIX A;  4LF9 Q;  3BZC A;  1VQA A;  2KCT A;  1I6H H;  2R7Z H;  2NVT H;  1SE8 A;  1WI5 A;  4LF4 L;  5JJI A;  4DR2 L;  2R92 G;  4YWM A;  3A5Z B;  4LFC Q;  4GLV B;  2Q2I A;  4YHH L;  1QVG A;  2Q2T A;  3UDX A;  1SRU A;  1Q46 A;  1YBY A;  2Z6K C;  3G6E A;  1VQ5 A;  4A4I A;  4AH6 A;  4BY7 G;  2D0P A;  4GKJ L;  1XNQ Q;  4B3R Q;  1RL2 A;  2JJQ A;  3W1G A;  2YYZ A;  3U50 C;  4GLA C;  2R93 G;  2Z0S A;  4QJF A;  4LF7 L;  3L7Z C;  1OTC A;  1WJJ A;  2DGY A;  2N49 A;  4IPH A;  2K5V A;  4UY8 C;  1X6O A;  2OQK A;  4QGU A;  2LSS A;  2WAQ G;  4IPC A;  1V43 A;  3PCO B;  4JI4 L;  3GTG H;  4UP8 A;  1B70 B;  1UE1 A;  2C35 B;  3CCL A;  2VY3 A;  5LMN W;  5IWA L;  5IYC G;  2UU9 Q;  2GVA A;  4EQ5 A;  1Y1W G;  2V1C C;  3ICE A;  1VQ9 A;  4QQB X;  2YTY A;  3H3V I;  3I56 A;  1YHQ A;  2KCM A;  4A3J G;  1O7I A;  3AQQ A;  5LMU Q;  3ERS X;  1SRO A;  3CC7 A;  4A3G H;  4JV5 L;  4B3S L;  1TWF H;  4X6A H;  3BU2 A;  1X3G A;  3GTK H;  3CCJ A;  1TWH H;  1IBM Q;  1J5E Q;  3TRZ A;  1A63 A;  1JB7 A;  4DR5 L;  1NMF A;  3CW2 C;  2OTJ A;  4XTC S;  2KHI A;  2LXJ A;  5FJ8 H;  1E1T A;  3UDG A;  1YHA A;  4DV0 Q;  4JBK A;  2R7Z G;  1HNW Q;  4X64 L;  5M3F G;  1Y1V G;  4GKK L;  2UXC L;  2UXB L;  2R93 H;  5GAE C;  3K80 C;  1I5F A;  1IL2 A;  2VUM G;  1YEZ A;  1HNX L;  4BXX G;  2AKW B;  3CCQ A;  5IWA Q;  3I55 A;  2UU9 L;  2CCZ A;  1VQH A;  1CKN A;  1VQF A;  2VW9 A;  1HJP A;  3GDE A;  2B29 A;  2HIX A;  4GKJ Q;  2AMC B;  1L2F A;  3S24 A;  4L5T A;  1Q8K A;  4DR6 L;  3Q8D A;  1EQR A;  3J7Z C;  3ULP A;  2GN5 A;  2WB1 E;  4KHZ A;  4K0K Q;  3PSI A;  1YJ9 A;  3F2C A;  2PMZ E;  1GKH A;  5IYB G;  1UE7 A;  2N78 A;  3M4Q A;  1UE5 A;  1IBM L;  5DLQ E;  1NBW A;  3I4M H;  2NN6 I;  4ALP A;  4YCW A;  1GO3 E;  2A1A A;  3JAM c;  4P75 A;  1NY4 A;  3U4Z A;  2NN6 G;  3HOV G;  3FHW A;  5C0X I;  1YZ6 A;  2QEX A;  3D31 A;  4AQY Q;  1VQO A;  1EYG A;  1U5K A;  1XPU A;  1WOC A;  2BH8 A;  4GN3 B;  4JOI A;  4P71 A;  4PZ8 A;  4R4Q A;  2NZH A;  5C4J H;  1XMO Q;  1EFW A;  4R4C A;  1SR3 A;  4DV4 Q;  2ATW A;  1XNR Q;  1KRS A;  4O2D A;  1Q82 C;  2E2I H;  1D8L A;  2JA6 G;  5LMU L;  2CFM A;  2L15 A;  2UXD Q;  4R4T A;  3CCU A;  1Q86 C;  4OWT B;  4C3I H;  5GQO A;  1VQM A;  4IFD I;  3G48 A;  3F2B A;  2ES2 A;  2BA1 A;  1N9W A;  2MFI A;  4HJ7 A;  3HOY G;  4JI8 Q;  1BVS A;  3CAM A;  4GNX B;  3S16 H;  2CWA A;  2PI2 E;  2K75 A;  4JYA L;  4LFB Q;  2DUD A;  2XTI A;  4HJ9 A;  1IYJ B;  3F1Z A;  4Y7N H;  3CD6 A;  3TS2 A;  1HZ9 A;  1Y1V H;  2K14 A;  4DAM A;  4EX5 A;  1Q81 C;  3HOU G;  1E3P A;  1TXY A;  5JJK A;  1JE5 A;  3WWV A;  1CSP A;  3RLN A;  5IYB H;  4A75 A;  1M1K C;  1D7Q A;  1XJV A;  4IOC A;  1J6Q A;  1VQB A;  1VQG A;  1IBK L;  4A3G G;  4DUZ Q;  4OWX B;  4DV7 L;  1G6P A;  5C44 G;  5EAY A;  3BZK A;  1C9O A;  2RCN A;  2UXD L;  5AJ3 Q;  3H0G H;  4ME3 A;  1I94 Q;  2CQO A;  1HNX Q;  1SLJ A;  4HID A;  1S3O A;  2UUB Q;  1VQ6 A;  3I4N G;  3PIP A;  4QY7 A;  1PH3 A;  1ASZ A;  4JI0 Q;  1KC8 C;  3CQZ H;  3I2Z A;  1VQ8 A;  5FJ8 G;  2ZM6 Q;  5IT9 c;  1JMC A;  1UE6 A;  3J81 c;  1CSQ A;  3M3Y H;  4JI6 Q;  4JI5 L;  1L0W A;  5JEA G;  1LUZ A;  2E5L Q;  4NB3 A;  1EWI A;  3J80 i;  3S1R H;  4JBM A;  1B8A A;  3PIO A;  4PG3 A;  1ASY A;  3H15 A;  1BBU A;  2LXK A;  1E7Z A;  5H1S E;  2IT1 A;  4DV7 Q;  2JA9 A;  4TVA B;  3CCS A;  4A3I G;  1EQQ A;  1MJE A;  2JA8 H;  1HZC A;  3L0O A;  5FLM G;  2A8V A;  3GTP H;  4A3K G;  2AHO B;  5FLM H;  1S72 A;  3M7N A;  5JEA J;  3A74 A;  5FLX c;  2E2J H;  1VS0 A;  4A3C H;  1XMO L;  3H3V H;  4B3T L;  4DAY B;  1W2B A;  2UUA Q;  2XGT A;  3RNU A;  4DR4 L;  1VQN A;  3NBH B;  1G51 A;  2Y0S G;  2VL6 A;  3GO5 A;  1W3S A;  4KHP Q;  3IRB A;  3RR5 A;  3T1H L;  4A3B H;  3S1N H;  1K83 H;  1FL0 A;  3AFQ A;  4JI2 L;  1YNX A;  1X3E A;  2D0O A;  4JYA Q;  3CCR A;  4JI4 Q;  4JC0 A;  4LUO A;  3KJP A;  4DV6 Q;  3PO2 G;  3G4S A;  4MZ9 A;  1YIT A;  1WYD A;  4B3M Q;  4XIG S;  4A3L G;  1TWC H;  1N33 L;  1NE3 A;  4DR1 L;  4DR7 Q;  4UP9 A;  2ZTE A;  2GVB A;  1K73 C;  2PQA A;  2ZM6 L;  1Q1E A;  1Q1B A;  3GTM H;  2MQH A;  3KF6 B;  1I3Q H;  1WCM G;  2OWO A;  1EUJ A;  1L1O B;  3K7A H;  4IFD J;  1CKM A;  5C4X H;  4GN4 B;  4HJ5 A;  4IO9 A;  4BBS G;  3E9H A;  1UEB A;  3HOV H;  1I50 H;  2IHE A;  4DV5 Q;  2UUB L;  3FKI H;  1EIF A;  3U4V A;  4DUY Q;  2UXB Q;  2KEN A;  2R7D A;  5IYD G;  3CME A;  1Q12 A;  3E0E A;  1P16 A;  1G29 1;  4LF4 Q;  4LF9 L;  3F8T A;  5IP9 H;  2YU9 H;  4BBR H;  1N33 Q;  2VS1 A;  2ZJP A;  1IXR A;  1AE2 A;  1YHB A;  2I5H A;  4DV3 Q;  1QZH A;  4JI6 L;  1IZ6 A;  1YVC A;  2JA7 H;  4DR2 Q;  2OTL A;  4IFD G;  2VQF Q;  3M85 A;  1CUK A;  2ZJR A;  3CCV A;  2MNA A;  4A93 G;  4PZ6 A;  4C2M H;  4LW1 A;  2PQA B;  4DV1 Q;  3HOZ G;  1LTL A;  3HOU H;  3CPW A;  4RMF A;  2K5N A;  1E1O A;  1VQD A;  4IOA A;  4NXM L;  4QL5 A;  2VZA A;  2VUM H;  3J7A 5;  4BBS H;  5C4X G;  3DLL A;  2UUC L;  2WAQ E;  1PYS B;  2F4V L;  2B63 H;  3S14 H;  3HOW G;  1VQL A;  4LF7 Q;  4A3M G;  1DGS A;  2UUA L;  5K36 G;  4LWC A;  3OTO L;  1N34 L;  1KD1 C;  4AQY L;  4BY1 H;  1QUQ B;  4A3F G;  4BBR G;  4A3M H;  3HOW H;  3UDI A;  4GN5 A;  1VQJ A;  2YTV A;  3AFP A;  2N8N A;  4MTN A;  4L5S A;  2WP8 J;  2AWO A;  3PO3 H;  5C0X G;  3KDF A;  3EN2 A;  3I4M G;  5C0X J;  4GOP A;  3D0F A;  3BJU A;  1N32 Q;  2IX0 A;  3M4O H;  4R4I A;  1KL9 A;  3MEF A;  1HNW L;  2IY5 B;  2AWN A;  1OXS C;  2CKZ B;  2E8G A;  3G71 A;  4A3J H;  1TWG H;  2JEA I;  1HH2 P;  3KYH C;  3NEM A;  1XPR A;  1CKO A;  2UXC Q;  4JCV E;  4HIK A;  2I5L X;  1YJW A;  1SMX A;  1TWA H;  4BY7 H;  1Y1W H;  4OO1 G;  2BA0 A;  1X55 A;  2QGQ A;  5AJ3 L;  1PH2 A;  1AE3 A;  5GAG C;  3CCM A;  4A3E H;  2NVX H;  1KQS A;  3NEL A;  5LMN Q;  3DM3 A;  4GOP C;  5HGQ A;  3M9B A;  4BY1 G;  1X65 A;  1T9H A;  4OWW B;  4C3H H;  3KFU A;  4Y52 H;  3KF6 A;  2UUC Q;  4RG1 A;  4X64 Q;  2JEB I;  3KF8 B;  4LF6 L;  1H95 A;  4GS3 A;  1QVF A;  3I4O A;  4GOP B;  4OX9 Q;  3TQY A;  1KXL A;  4DR3 Q;  1HNZ Q;  1KAW A;  2KBN A;  1NTG A;  4X66 Q;  4DV2 L;  2Q2H A;  4LFA Q;  5IP7 H;  4B3T Q;  4GNX C;  1NJI C;  1X54 A;  3STB C;  4BA2 I;  4AYB E;  1JJ2 A;  3U58 A;  2JE6 I;  4TQU S;  3ZJY C;  2F4V Q;  4DV4 L;  3T1H Q;  1PH1 A;  3K0X A;  4NXN L;  4DK3 C;  2A19 A;  3AYH B;  4P74 A;  3K8A A;  3CP0 A;  3STB D;  3VDY A;  4HJ8 A;  3PUW A;  5IY0 A;  1C7Y A;  1FJG Q;  4APV A;  4YHH Q;  1VQE A;  1K0R A;  3E9I A;  4DK6 C;  4LF6 Q;  4JI3 Q;  5IYD H;  3KJO A;  4A3E G;  4R1J A;  1GD7 A;  2YV5 A;  2ID0 A;  2ASB A;  1E24 A;  3T1Y L;  2I0Q A;  3OYY A;  1PFS A;  4A3D G;  1VQI A;  3S2H H;  1XTD A;  4OO1 I;  4YY3 L;  1K3R A;  1BBW A;  2D62 A;  2N3S A;  4POF A;  1QUQ A;  4IJH A;  1R9T H;  4A93 H;  2ZTC A;  1YI2 A;  5C3E H;  1XPO A;  3CC2 A;  3S2D H;  2NZO A;  4DUZ L;  1NMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...