2KHIA

Nmr structure of the domain 4 of the e. coli ribosomal protein s1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
WVAIAKRYPEGTKLTGRVTNLTDYGCFVEIEEGVEGLVHVSEMDWTNKNIHPSKVVNVGDVVEVMVLDIDEERRRISLGLKQCKANPWQQFAETH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the relationship between Gram-negative and Gram-positive S1 proteins by sequence analysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S1
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2khiA00
1CSPA 4A3MG 3HOVH 3PO3H 2R7ZH 4BA1I 2EXDA 2K14A 1N36L 3E9IA 4YHHQ 4BY7H 4B3RQ 4JI1Q 2KHJA 3U4ZA 2VW9A 2BA1A 4FDBA 3CW2C 3CC4A 3TS2A 3NENA 2YTYA 1X3EA 4LWCA 4NXNQ 3CMAA 3CCQA 4BXXH 3HOUG 3GTKH 2C35B 3PO2G 3PSIA 3CCLA 3J7ZC 3RLOA 4DV1Q 1AH9A 3HOUH 4POFA 4LF7L 4A75A 2JA6G 1BBWA 2YV5A 4AQYQ 5IYDG 3STBC 3IRBA 4OO1I 1VQ5A 5AJ3L 5JJKA 4DR4L 4BY1H 1KAWA 1EQRA 1NBWA 1MJEA 1PH4A 2R93H 1PH5A 5IP9G 5ELOA 4KI0A 5C3EH 1IBKL 1Q7YC 1JMCA 1K0RA 2WB1G 1X65A 2FXQA 2JA9A 2OQ0A 4A3GG 5GAHC 1L2FA 5IWAQ 3M4QA 1C7YA 2VL6A 1S3OA 4EX5A 1WYDA 1CKNB 1HNXQ 4LUOA 3HOZG 3S16H 3I4NH 4LUZA 5FJ8H 2L15A 4IPGA 1XNQL 4A3FG 4QQBX 2D0PA 4DNIA 3UE1A 1B7YB 1E7ZA 1KC8C 3UE0A 1AE3A 2IX0A 3G48A 1IXRA 1VS0A 4UPAA 3CMEA 4RG1A 4DAMA 1NY4A 1VQHA 4LW1A 4L5TA 3RZDH 1XPOA 1Y1WH 1N33L 3A5UA 3LGJA 4JI0L 4JBMA 4AIMA 5LMUL 4DUYL 4DK6C 1QVGA 2I5LX 1XMQQ 1NE3A 2WB1E 3S14H 2QA4A 4H02A 3I4MG 4OO1G 4IOAA 4LF8Q 4A93G 1H95A 1UE1A 2HHHL 3NELA 4O2DA 4R4CA 3H15A 4IO9A 4XIGS 5C4XH 2ASBA 2VS1A 2CFMA 4GLAC 3K0XA 1FL0A 2K5VA 2ZTEA 3TREA 3RR5A 3T1HQ 2E5LL 2PQAA 4A3BG 4LF9Q 5JEAG 2ZTDA 2CQOA 5IE8A 5K36G 3UDGA 2H5XA 1FVIA 3RN5A 3PIOA 4L5SA 4BXXG 3G6EA 4IFDJ 2B63H 3CCRA 3JC66 4B3SQ 4RMFA 4LFBQ 1HZCA 2ATWA 1X55A 4DV0Q 4PZ6A 3A74A 1EUJA 3CC2A 1UE7A 4A3EG 3NBHB 2KHIA 4L5QA 2JJQA 2UUCQ 3EIVA 1S40A 1A0IA 4YCUA 4DV3L 3GTQH 3J81j 1EIYB 5IYCH 4LF7Q 1JB7A 4KLKA 2UUAQ 1U5KA 1DGSA 1IBLL 4J15A 1TWAH 3K8AA 5ELNA 1QUQB 4DR1L 4R4QA 5BR8L 4DV2L 1CKMA 4X64L 1MKHA 5LMNL 1IBKQ 2JA7H 1VQ6A 1I50H 1VCIA 2I5MX 2IY5B 4TQUS 4GS3A 3AEVA 1HNWL 1CKNA 4HIKA 2UUBL 4DUZL 5M3MH 3B6YA 3H0GG 4AYBG 1VQMA 3STBD 1JJGA 3PF4A 2MQHA 1X3GA 4OWTB 5GROA 3KF6A 3FKIH 1OXXK 5H1SE 3HOWG 2A1AA 4P71A 3UDFA 3L7ZC 2VQEQ 1N8RC 5M5YH 4JOIC 1YIJA 2ZM6Q 1I3QH 1EOVA 5LMUQ 2JA5H 2JQOA 3MEFA 4MTNA 4NB3A 1Q81C 1QVFA 3CPFA 3M3YH 4AH6A 3OW2A 1VQAA 5M3FG 4NXML 3ICEA 1CSQA 1LM0A 3PUVA 1BKBA 4JI6Q 2K4KA 4Y7NH 2E2IH 1YHAA 4UP7A 1YHQA 4DKAC 4UP9A 4K0KQ 4HIOA 3CCJA 1YITA 2BH2A 1Y14B 3J81i 1KQSA 1GKHA 4DR2Q 1Q8KA 1J5EL 2UXBL 1VQLA 2I5HA 4R1JA 1VQJA 2MFIA 2UU9L 2VZAA 2NVQH 2RCNA 4YY3L 3S1MH 1PYBA 4LUVA 1ASZA 1X56A 3GTOH 3M9BA 1N32Q 4OX9L 2EIFA 3ULPA 3S15H 4R4TA 4B3ML 1TWHH 1X54A 4A76A 1KHIA 1TXYA 4L5RC 4LFCQ 4IFDG 1L0WA 2R93G 3W1GA 2Q2HA 2F4VL 3HOZH 2K5NA 2NZOA 4GN4B 4A3EH 5FLXc 1EFWA 2UUAL 2HIXA 4A3CH 3I4NG 4JV5Q 4PMWA 4QL5A 3FP9A 3HKSA 4JBWA 4BY1G 1KRTA 4LNQA 4A3GH 4C2MH 4JI4Q 3K81C 4GNXC 3KF8B 3TS0A 2LXJA 2N49A 1I94L 1PH7A 3ZJYC 1PH1A 1PHJA 4X62L 4GKKQ 4WJ3M 4DUZQ 3KJOA 4DPGA 4Y52H 3KOJA 5J3BA 3KJPA 1EYGA 3NEMA 1G291 1WCMG 4HJ7A 3PIPA 4DV1L 3GTMH 3HOWH 5C4JH 3BU2A 1QZHA 1D7QA 4AQYL 3K80C 3MXNB 3PCOB 4IPHA 2Q2TA 3PO2H 4QY7A 4A3BH 3HOVG 2GVBA 1VQCA 5IYDH 3I56A 5HY6A 3GTPH 2OTJA 4UY8C 4KHPQ 3KLWA 3GTLH 4YCWA 1UE6A 3I55A 5M5XH 3CAMA 4JI5L 1YEZA 5M5WH 1GD7A 1VQKA 2K52A 2PI2E 1Q82C 1WJJA 1IBMQ 1V9PA 2VNUD 4K0KL 2NN6G 5AJ3Q 4IPCA 3VDYA 2MNAA 5M3FH 3GTGH 4TVAB 3AQQA 3DM3A 1N9WA 3PUYA 4JBJA 4WJ4A 5C3EG 1YI2A 2Y0SE 4OONA 3I4OA 4GNXA 2E8GA 4DR7L 1SRUA 1OTCA 2AKWB 2YTXA 4JG2A 4LF6L 4LF8L 2B63G 3M7NA 1RIPA 3CP0A 1HJPA 2K75A 4HJ8A 3CXCA 4A3KG 1KRSA 5JEAJ 4X66L 3CCVA 4JI3L 1P8LA 4DV6Q 3M4PA 4GLXA 2JA8G 1PFSA 1D8LA 3F2CA 1FJGQ 2IHFA 1XJVA 4LF9L 3TRZA 1V43A 1E3PA 4A4IA 4DV7Q 3HKZG 4DAYB 4JV5L 4ME3A 1G51A 1K9MC 4LFAQ 4JI8Q 2Q2UA 1BVSA 3RN2A 1E22A 1TWGH 3A0JA 1X9NA 2BH8A 3L0OA 1WCMH 1V1QA 2HHHQ 4QJFA 1PA6A 1YJNA 3S1RH 1UEBA 2JA5G 4A3DG 5IYBG 1HR0L 2UUCL 1N34L 1X6OA 2QGQA 4EQ5A 1O7IA 1SROA 3M85A 2YU9H 2UXDQ 1PH3A 1NMFA 3PUWA 4DR6L 5E7NA 4DR3L 1VQPA 1IYJB 1UWVA 3S1NH 4X64Q 4OWXB 4KHPL 4DV4Q 3AFPA 1K8AC 3RZOH 1VQOA 4YWLA 2VQFL 2UXCQ 2Z6KA 2JA7G 1S72A 3ER0A 1HZ9A 4JI0Q 2JA6H 4HIMA 3U4VA 1IBLQ 3S1QH 3KF6B 4YHHL 1M90C 4IOCA 1PYSB 1GO3E 2RF4A 1HNZL 4HJ9A 4C3IH 3GO5A 2E2JH 4DV5L 2IT1A 4XTCS 4JC0A 3CCEA 5GAGC 2UUBQ 3F2DA 3T1HL 2E5LQ 1JJCB 2KCMA 2K50A 3UDIA 1BBUA 3W1BA 4APVA 3GDEA 2LXKA 4GOPB 1T9HA 2AWNA 1W2BA 2NVXH 2KCTA 4A3LG 4JI3Q 3S2HH 2R7DA 3ULJA 4IPDA 4OWWB 1J6QA 3CF5A 3RNUA 4GN3B 1A8VA 4A93H 2AMCB 4LFBL 1YZ6A 2B29A 3K7AH 4HJ5A 2JEAI 1K83H 1SE8A 3CD6A 4P73A 1Y1VH 4JI8L 4LFAL 3I7FA 2UU9Q 2R92G 2VUMH 2PNHA 1SN8A 2ZJRA 4A3MH 1E24A 3S17H 3E9HA 3ULLA 1GVPA 1CUKA 2AWOA 4X65Q 4JI6L 4B3MQ 2JK8A 5C0XI 2R7ZG 1XNQQ 1N36Q 4R4IA 2NVYH 1OXSC 1VQ7A 2XTIA 2Z0SA 3F2BA 3HFZB 3RLFA 2UXBQ 3CCMA 3GD7A 1R9TH 2I0QA 2E2HH 3RLNA 3G4SA 4PG3A 4NXNL 4PZ7A 2ID0A 1HNWQ 1A63A 3HOXG 4DR3Q 2EQSA 4BBSG 1E1TA 1YVCA 5IP7G 4HJAA 4LFCL 3KDFA 4C3HH 1I94Q 2VQFQ 4B3RL 1VQFA 4JI1L 5IP9H 1Z9FA 1QUQA 1CKOA 1EIFA 5JJLA 3Q8DA 2JA8H 3W5OA 1C0AA 2VQEL 1Q1BA 4HIDA 3HKZE 1HR0W 4MNOA 3OTOL 1XMOL 3S2DH 4JOIA 2OTLA 4A3IG 2N3SA 5IWAL 2ES2A 5IT9c 2D62A 1SFOH 3J80i 3TQYA 3CPWA 5M3MG 5IYBH 4DR5Q 1HNZQ 1ASYA 4GKJL 1WI5A 1YJWA 2JE6I 4LF4L 3A5ZB 4GKKL 3BZKA 5C0XG 4DR4Q 4JI5Q 3H0GH 1XPRA 1P16A 4A3JG 2OCEA 4BBRH 3TEHB 1YJ9A 1VQGA 1TWCH 1OXVA 2YYZA 4O0AA 3U58A 1M1KC 3U50C 4KHZA 2QEXA 4A3FH 5FJ8G 1XMQL 2CKZB 2DUDA 4IJLA 1HNXL 4QGUA 3CC7A 3ERSX 1MIUA 4B3TL 5C44G 5BR8Q 1PH9A 4JBKA 4LF5L 2NN6I 2KBNA 3EBEA 5GQOA 1LYLA 2D0OA 2HIVA 2N8NA 2NZHA 2ZJQA 4DR7Q 4JI7Q 2VY3A 1G6PA 2YTVA 2RHSB 1XPUA 4A3DH 1N33Q 3I4MH 4JI2Q 1EQQA 4DK3C 1IBML 1VQ9A 1QVCA 1MJCA 4MZ9A 2VUMG 3T1YL 3PUZA 3F1ZA 4DV6L 3E0EA 1B70B 1QZGA 5IYCG 1Q46A 1PH8A 1B8AA 1L1OB 4GN5A 5C0XJ 1Q86C 2HT1A 1GM5A 2IX1A 4B3SL 1I5FA 3CCUA 1K8GA 2PMZE 4GNXB 2MO1A 2ZM6L 2BA0A 1YBYA 1Z47A 2RHQB 2PQAB 2HQLA 1OXUA 2ZJPA 2F52A 1YNXA 3GTJH 3CCSA 4A3LH 3PO3G 1U0LA 2AHOB 4YWKA 3KDFB 4A3KH 4X66Q 2CWAA 3JAMc 1VQDA 1XTDA 1W3SA 4A3CG 1N34Q 4BA2I 5DLQE 1C9OA 3AYHB 1LTLA 1FJGL 3OYYA 3OTOQ 1KL9A 4DV2Q 1XMOQ 4DV0L 1OXTA 1NJIC 3JAMi 3PF5A 4JCVE 1J5EQ 1XNRQ 1AE2A 4JYAQ 5GADC 5C4XG 2XGTA 2ALYB 1VQ8A 1VQEA 4YY3Q 1SR3A 1A62A 1X3FA 5FLMG 3BZCA 4DV3Q 4DR5L 2K5HA 1KD1C 4GKJQ 4OX9Q 4POGA 5FLMH 2DGYA 4UP8A 1Y1WG 1SMXA 4DV4L 4LF4Q 1EWIA 1TWFH 3KFUA 1HR0Q 1IL2A 2OWOA 2UXCL 4C3JH 4DR1Q 1Q1EA 3DLLA 2KENA 3M4OH 4NPSA 2R92H 1JE5A 5LMNQ 4IFDI 4YCVA 1SLJA 3D0FA 1IZ6A 2WP8J 2A8VA 1K3RA 2CWPA 2R6GA 3PGZA 3UDXA 4X6AH 1NMGA 3CQZH 4P75A 1NTGA 4LF6Q 2WAQE 2OQKA 3PV0A 4B3TQ 4LF5Q 5IY0A 1VQIA 3G71A 1PV4A 3F8TA 1Q12A 3PUXA 3H3VI 4BY7G 4JI7L 1PVOA 1JJ2A 2JEBI 3D31A 5LMNW 4ALPA 3BJUA 2ZTCA 1WFQA 2Q2IA 2GVAA 2WAQG 4JI2L 3WWVA 1KIXA 4DR2L 4DV7L 1I6HH 2MO0A 5GAEC 3T1YQ 1FGUA 3EN2A 4OXPA 1HH2P 3I2ZA 4P72A 3L2PA 4NXMQ 2B3GA 2CCZA 4P74A 1WOCA 4PZ8A 4IJHA 4QIWE 2A19A 2NVTH 4BBSH 5HGQA 4DV5Q 4AYBE 3FHWA 4GOPA 5EAYA 3J80c 1E1OA 2Z6KC 3KYHC 1L1OC 3HOYH 5JJIA 2V1CC 4GLVB 5IP7H 1PH6A 1HZBA 3FKIG 3HOYG 1JT8A 4A3IH 3J7A5 3S24A 1PH2A 2R7FA 2N78A 1VQNA 2PI2A 4R4OA 4YWMA 2UXDL 1KXLA 2F3IA 5C44H 4DR6Q 3H3VH 4DUYQ 1N32L 3SGIA 4A3JH 2LSSA 1XNRL 4JI4L 1VQBA 2Y0SG 2IHEA 4JYAL 1HZAA 1Y1VG 2GN5A 4BBRG 1UE5A 4X62Q 1YHBA 3J81c 1K73C 1VQ4A 2F4VQ 1L1OA 3AFQA 4X65L 1RL2A 2WFWA 3K7UC 1LUZA 4GOPC 3HOXH
chains in the Genus database with same CATH superfamily
4A3GB 5FLXL 1ZYRC 2K14A 1N36L 4AYBB 1LTRD 2KHJA 4K2KA 1H9SB 2E2IB 2F0UA 1EFID 2FFKB 1PTOC 3DM1A 4LWCA 2P5ZX 3LWEA 2HCCA 3CCQA 2F0NA 1J8IA 2CH4A 4DAVA 2ZT9C 3GTKH 2C35B 3PO2G 1AH9A 2V4DA 5IIFA 4LF7L 3STBC 2F0MA 3KLSA 1M8AA 3VR6A 4RH6A 4RFBA 4CDEC 2OQ0A 4A3GG 1L0XB 1CKNB 2F0DA 4DNIA 2IX0A 4N9TA 1IXRA 1VS0A 4UPAA 4RG1A 4XT3B 1VQHA 4LW1A 1PRTB 4L5TA 5T1GA 3A5UA 4JI0L 1ILPA 4Y7NB 4AIMA 5LMUL 4KK7A 3T53B 2WB1E 4A93G 1QOHA 4H02A 3HOYB 4LF8Q 2HHHL 4O2DA 4R4CA 2VS1A 1JOOA 2CFMA 4GLAC 1FL0A 2LFNA 4HMIA 3T1HQ 2K32A 2B2YA 1SNMA 3UDGA 2I07B 1FVIA 5G3LD 3TSSA 4L5SA 2WB1B 4DV0Q 4PZ6A 3A74A 1EUJA 3CC2A 1JICA 4A3EG 1TWCB 2EE1A 4H13C 2JJQA 1QCBD 3IFTA 5I9PA 2UUCQ 1VF5C 4IQZA 3GTQH 4K8JA 3VYSA 3J81j 1ONLA 4KLKA 1QILA 3M4OB 2XSCA 4J15A 1I4RA 5LL6X 4DR1L 2L12A 5COYA 4X64L 1MKHA 5LMNL 5JVG3 2JA7H 1VQ6A 1I50H 1VCIA 2IY5B 4TQUS 4HIKA 4K8IA 1MGSA 1PFNA 3EVQA 3STBD 1A3TA 2EYLA 3PF4A 4OWTB 1PZID 5C4XB 3FKIH 4P71A 3X3NA 5M5YH 2EY5A 2JA5H 1PRTC 4NDXA 4DU9A 1JORA 1SNPA 3CPFA 4CJ1B 1EY5A 1V8QA 1F9RA 1E0BA 2O5JC 1MD2D 1EY8A 2K4KA 4ABNA 2E2IH 4UP7A 1RDPD 2BCOA 2BH2A 1Y14B 2Q8TA 3DUZA 5DM63 2EJFC 1J5EL 2MFIA 4PQXA 2VZAA 3U9OA 3HG9A 3A7AB 2FMMA 4LUVA 1X56A 3GTOH 3ONAB 1ICFB 3HKZB 1L0YB 1B4OA 3M9BA 1CK1A 3ULPA 4R4TA 4B3ML 1TWHH 1WTVA 3PO3B 4A76A 2JA8B 5EKIA 1RJTA 4RWSC 3HOZH 3SK6A 4QF4A 3CU7A 4A3EH 3OHXC 4A3CH 4PMWA 3FP9A 1EYAA 1HCZA 3BYYB 2N49A 1I94L 1GUTA 3T56B 5J3BA 1STYA 3GTMH 4DV1L 1K3BC 1WD1A 1DD2A 5IGBA 4RA8A 4AQYL 3MXNB 3PCOB 4QY7A 4A3BH 1H9KA 3H6MA 4C1NK 5EKLA 2OTJA 5C4ZA 1UE6A 3QOJA 4DXGA 4C56C 4O1NA 2GA4B 1GXDC 4BBSB 2K52A 5CV9A 1WVLA 1WD0A 2A69D 3VDYA 4BS9A 2MNAA 5M3FH 3AQQA 1N9WA 1NR4A 4ID6A 2R61A 3I70A 1XXGA 2Y0SE 3V96A 3I4OA 1OO9B 3I3CA 1OTCA 2AKWB 2YTXA 4JG2A 1QE6A 5JPMC 1A2TA 1DZ1A 2B2WA 2A69C 5IOCA 1WTWA 2ICEC 4ZKCB 4LF9L 3T4AC 1V43A 1E3PA 5C44B 4X3UA 4ME3A 1K9MC 2Q2UA 2DNEA 1BVSA 3OIQA 1E22A 4HAEA 2KCNA 3A0JA 1X9NA 1G2TA 2BH8A 2BE5D 1BNZA 1CA6A 1LTGD 3HZXA 4A3DG 3VA5A 1HR0L 2PMZB 2H1EA 4CBVA 2QGQA 4EQ5A 2SEBD 1TWFB 1YNNC 3JAML 1SROA 3M85A 3GTPB 2YU9H 4C3HG 2UXDQ 4DR6L 5E7NA 1IYJB 1RD9D 3QOLA 4DV4Q 3AFPA 2UXCQ 1SYCA 4KJOA 1HZ9A 2M2LA 4F8MA 3U4VA 3TP5A 2QILA 3CQZB 4C3IH 4HTHA 3GO5A 1K8OA 1AZPA 3CCEA 3SXHA 2K50A 3UDIA 3GDEA 1DOKA 1T9HA 3LWUA 2KCTA 3N52A 1GHJA 4KJNA 1CA5A 4LK1C 1FYCA 3TBIB 1RTOA 4GN3B 1BDOA 1A3VA 1YZ6A 2B29A 5IGCA 1BBXC 4LFAL 3I7FA 5J1ZA 2KEDA 1SE4A 5I2YA 2R92G 2K33A 3ULLA 4JI6L 4X65Q 2DY8A 2X6LA 2JK8A 5C0XI 2Y0SB 1WTPA 3NPPA 3F2BA 3HFZB 2D5DA 1PZJD 3GD7A 3G4SA 3MFYA 2K05A 3HOXG 4DR3Q 2RQXA 4L8JA 2F3VA 2M9VA 3BDCA 5BN3A 1SMYC 2EYPA 2PQEA 1CKOA 1EIFA 2JA8H 3W5OA 3J80L 2VQEL 3HOUB 3OTOL 3MZ5A 4IZ8A 1J9OA 2SDFA 1SAPA 4A3IG 3A55A 2AQ2B 5IWAL 5IT9c 1SFOH 3H3VC 4N9PA 5IYBH 3S14B 1YJWA 4LF4L 4KN4C 4FXDA 4GKKL 1W6JA 3BZKA 3H0GH 1KTKA 2ENBA 2RSNA 2EZVA 5LL6S 1TWCH 2YYZA 1Y1VB 3AB9A 3U50C 4KHZA 5EJWA 2QEXA 5FJ8G 4KY7A 3S17B 3OSOA 1D1IA 5C44G 4HCEA 5I6YA 2D0OA 2HIVA 1SYFA 1PZKD 2ZJQA 2NWGA 3E3XA 2VXWA 1EY6A 1A3UA 1EY0A 1EQQA 1IBML 1GUSA 1QVCA 4MZ9A 2VUMG 2E2HB 3F1ZA 3MFGA 1TS3A 1T5XD 1I5FA 4ME5A 1NAPA 1B1ZA 2FMCA 2CVRA 1S5BD 2AHOB 2F1MA 3KDFB 4X66Q 2CWAA 1BCPF 3JAMc 5J39A 3MAQA 4IUQA 4KV6A 3OMCA 4CDDC 1FJGL 1XMOQ 5E1FA 1ML0D 4DV0L 1OXTA 3EROA 1J5EQ 4JCVE 1AE2A 5GADC 2XGTA 2ALYB 2NUCA 1VQEA 2A68C 1SR3A 4DR5L 4GKJQ 4ILWA 5FLMH 2DGYA 2A73B 1B3QA 4L6TB 2NZ1D 3MVVA 4DR1Q 3DLLA 2KENA 4WFN3 3O13A 5LMNQ 4YCVA 4IFDI 1SLJA 2O2LD 2WP8J 1K3RA 4X6AH 1VDZA 4P75A 3ND9A 2XVSA 2WAQE 3PV0A 4LF5Q 2FINB 3S9WA 1VQIA 1TY2A 3F8TA 1Q12A 1SNCA 4BY7G 2LKVA 3EA6A 4IUNA 2CQAA 4XT1B 1JJ2A 3D31A 4ALPA 2B2TC 3A7LA 2GVAA 4KKUA 1ENFA 4DR2L 2MO0A 4GZYC 5ELEA 5ELDA 2EVBA 3BVZA 3BVMA 4IJHA 4RCNA 4DV5Q 1F2YA 1V1PA 4AYBE 4GOPA 2Z6KC 3KYHC 1L1OC 2V1CC 2E75C 5IP7H 1PH2A 1STHA 1ET6A 1KXLA 5C44H 3NSWA 5CYUA 4A3JH 2HCIA 2Y0SG 4JYAL 2GN5A 3CKIB 4A3FB 4X62Q 1K73C 3AFQA 2K28A 2WFWA 5IT9L 5I9OA 1MSGA 1LUZA 1CSPA 2Z6BA 1U9RA 5JEAH 2LY7A 4JI1Q 3U4ZA 3BS1A 4K14A 3CC4A 3C1EA 3K5LA 1LT6D 2MUYA 3CMAA 2NBFA 4BXXH 4KMUC 3CCLA 3J7ZC 4DV1Q 3DWAA 5JVH3 4OO1I 2YV5A 1KAAA 4AQYQ 1SJHD 4R9WA 2IWHA 2L9HA 5AJ3L 4DR4L 5JJKA 1S5CD 1KAWA 1EQRA 1TS2A 5IGGA 1AP0A 1Q7YC 1F77A 2WB1G 2JA9A 2CHBD 1Q8IA 2VL6A 1CZWA 4FP5D 3RMHA 1MI2A 3QO2A 1PYWD 3VR3A 3UE0A 1NNXA 4LJZC 4UDUC 4DAMA 1N33L 2L1BA 1IHZA 4DUYL 4DXFA 1QVGA 2F03A 2EYHA 5DNFA 5IT9E 2QA4A 3I4MG 1QWYA 5M5XB 1EIHA 4IO9A 4A3DB 4G4KA 5C4XH 3VYUA 1S5FD 3K0XA 2BE5C 3DWPA 3TREA 3IFDA 4LF9Q 1JWMD 2ZTDA 1WTQA 4RKBA 1TWHB 1XYIA 3R8BA 4IFDJ 4BXXG 3G6EA 4B3SQ 2TMPA 2ATWA 3SR1A 4ZLTF 3H91A 2KHIA 4XYOA 3D4RA 2F0HA 3EIVA 1S40A 4DV3L 2NTSA 4I65A 4DAYA 1TY0A 5DM73 4LF7Q 5A2QL 1LACA 1SE3A 1IBLL 4J6HA 3K8AA 5ELNA 1B3AA 5I2XA 5BR8L 4DF7A 3R93A 5AFWA 2UUBL 3B6YA 4AYBG 1TR5A 3AMUA 2NVQB 1OXXK 1VMCA 1Y69U 2A1AA 3UDFA 1DONA 3L7ZC 2VQEQ 1N8RC 1I3QH 5FO7B 2F0SA 4LAAA 1TVXA 5LMUQ 2JQOA 4MTNA 1Q81C 4J1MA 3K5NA 3M3YH 1GUWA 3OW2A 4NXML 3D8GA 1CSQA 1BKBA 5C3XA 1YHQA 4UP9A 4K0KQ 2EY1A 3CCJA 1SFOB 2B63B 1Q8KA 1G8ZD 1VQLA 4QMGA 1GOZA 1VQJA 3NBIA 1ASZA 1V1OA 3IAYA 4OX9L 5E4XA 1TXYA 4LFCQ 2EYFA 4IFDG 1BQQT 1L0WA 1EZ6A 2R93G 3FEWX 3NWSA 2NZOA 4GN4B 5FLXc 3T51B 3NHHA 1SMYD 5M5WB 3I4NG 4JV5Q 3C1FA 3GV6A 1DJRD 2E74C 4JBWA 3K81C 3VYRA 3KF8B 3TS0A 1SYDA 2X69A 2PNRC 1PHJA 1STBA 3C2PA 4NKLA 4WJ3M 4PMBA 3KJOA 4M1UB 3NEMA 3S1NB 4HCSA 3QR8A 2OF1A 3I72A 2DY7A 1Y8PB 4KTAA 3HOVG 4DNRB 2GVBA 3Q6SA 4UY8C 1AEXA 1SNDA 2EJMA 4YCWA 4RGOS 3CAMA 1TIID 2MPMA 3SHLA 3K59A 2NN6H 4OEMB 1VQKA 1Q82C 1WJJA 1V9PA 5K5PA 3WOFA 2NN6G 2PZWA 2BDOA 3DEPA 1O7LA 2A68D 2Q8IB 2D9UA 2Z4HA 3PIP3 3GTGH 3NK9A 4WJ4A 1V1PB 5CC4A 1C4QA 1H9MA 1YI2A 3HEJA 3TMEA 2R7ZB 3NE5B 4GNXA 1HHVA 4HJ8A 5JEAJ 2A5HA 4JI3L 1LTTD 4GLXA 1B44D 2R93B 1SBBB 1PFSA 4QCLA 3F2CA 1B50A 2KEEA 4DAYB 1G51A 2J0TD 4JI8Q 3J7AF 3RN2A 1SYEA 2F0JA 4QJFA 1UEBA 1X6OA 5EPLA 1FD7D 1O7IA 1PH3A 1I6HB 1HQRD 3S1NH 3MXGA 1K8AC 3RZOH 3P20A 1VQOA 4XQNA 4NP5A 2VQFL 4A3JB 3FPPA 4F87A 3ER0A 4CDFC 4H7BA 3NTHA 4RAUC 3M3YB 4HJ9A 2R3ZA 3D4DA 1EYCA 2F0KA 2IT1A 4FF3A 2G9HD 1HTLD 4V0BA 2AUJD 1JJCB 2KCMA 1UAPA 1W2BA 2AWNA 2Z8LA 3I4LA 3S2HH 4IPDA 5FO9B 1EY9A 1NUCA 1A8VA 4A93H 2AMCB 3FVQA 3L9AX 3CD6A 1EY4A 1ZYRD 3H94A 2PW7A 2VUMH 4FO2A 1IL8A 2PNHA 1SN8A 1ZXTA 1PFMA 4A3MH 4QUCA 3BYTB 2AWOA 5TSSA 5IGFA 2QDLA 2XN9C 1HRJA 1N36Q 3KF8A 2ZXOA 3GTJB 5L37A 1S5DD 1LT4D 1STNA 2UXBQ 2I0QA 4PV1C 1DCZA 4PZ7A 2ID0A 5E4WC 5EQ0A 4OGQC 3SDZA 2RSOA 3KDFA 1HFGA 4C3HH 4JI1L 5IP9H 5JJLA 1Y8OB 1PRTF 1Q1BA 3RUZA 5A35A 2JP1A 2L55A 1EEID 3S2DH 2N3SA 5CV4A 3CPWA 3J81L 2JE6I 3A5ZB 3W2DA 4DR4Q 3DWQA 4JI5Q 3J80E 2B8FA 4JVZA 2OCEA 2K01A 1BCPB 1BOSA 3TEHB 1YJ9A 4O0AA 1TU2B 1LLRD 5M9OA 4E6IA 4QGUA 3ERSX 3CC7A 2B2UA 1MIUA 4B3TL 5BR8Q 4EQPA 2KBNA 3EBEA 1IYVA 2YU9B 2F0LA 2NZHA 4EQNA 4JI7Q 3V05A 2VY3A 3FPUB 1G6PA 2RHSB 3SEBA 1N33Q 4JI2Q 4DK3C 2A6EC 1VQ9A 1B70B 2SOBA 1T5EA 3SK8A 3EQLC 3QB3A 3HRZC 2IX1A 1M4VA 3QWNA 2PMZE 2HD3A 3K0YA 2HQLA 2EYJA 3DMUA 2F52A 1YNXA 3GTJH 2ZJPA 5HURA 3CCSA 1U0LA 4YWKA 2Z9HA 4CJ0B 4XQJA 1W6KA 1N34Q 5DLQE 1SEBD 4ZKBB 4Q5VA 3OTOQ 4TSSA 3GQBA 1XNRQ 3JAMi 3PF5A 2QF7A 1ESFA 1KD1C 1X3FA 1LT5D 3BZCA 4DV3Q 4K5VA 4OX9Q 1E2ZA 1SXTA 2BOSA 5M3FB 4LF4Q 1IL2A 2OWOA 4A3IB 4C3JH 2K1BA 2O4XA 4I7ZC 4C3JG 2LS01 1NCVA 1X3QA 2A8VA 2R6GA 4ZK9B 3UDXA 1NMGA 3CQZH 5DEHA 1NTGA 4LF6Q 4YIJA 1EU4A 3T16A 5IY0A 1PV4A 3G71A 2NB0A 3H3VI 5JOBA 1PVOA 2WAQG 3X3MA 3K5OA 1EIGA 1FGUA 3EN2A 3I2ZA 2DJGC 4BY1B 2O5IC 4NXMQ 1BR9A 2B3GA 4BBSH 4PZ8A 4FXGC 2A19A 1JE4A 5EAYA 1E1OA 1II3A 5ELCA 5JJIA 1JT8A 3FKIG 4A3IH 2WINB 5C5LA 2F3IA 3H3VH 5D14A 1HZAA 3Q23A 1YHBA 2N55A 2VUMB 4ODGA 3HOXH 4A3MG 3SK4A 5I4DA 2R7ZH 4BA1I 2EOTA 5BN5A 3I8ZA 2VW9A 4J8QA 4OELB 3CW2C 3U9SA 1F2MA 3NENA 1X3EA 5KRUA 1F2LA 4NXNQ 2RDFA 3FRPB 2MJ8A 2AQ3B 2Z4IA 4POFA 4A75A 3IL8A 1BBWA 2JA6G 5IYDG 3IRBA 4U68A 1IKLA 1SNOA 4C3HB 2C5CA 1PH5A 5IP9G 5D3IB 4KI0A 5C3EH 1IBKL 1JMCA 1K0RA 1X65A 1LT3D 2FXQA 4CKCA 3M4QA 1JWSD 3IKJA 1HNXQ 3HOZG 4LUOA 2JA7B 3I4NH 4LUZA 2L15A 3UE1A 1B7YB 3CHBD 1E7ZA 2D2CC 3QJYA 4K5WA 1I3QB 3NP8A 1XPOA 1Y1WH 3LGJA 4JBMA 1VF7A 3W3AA 2I5LX 1XMQQ 1NE3A 4BWGB 2LMCB 2KA7A 4OO1G 1UUPA 2WACA 3NELA 3H15A 1FNWA 4XIGS 2JA5B 1S4ZA 2ASBA 4ZUJA 2K5VA 4A3BG 2E2DC 3S15B 1I50B 5JEAG 2K5DA 5ELFA 5K36G 3A54A 2J4XA 1JR0D 2WAQB 4HN7A 3CCRA 1DOLA 1HZCA 1X55A 4XXEA 1UE7A 4L5QA 4A3KB 5KGUA 3NXWA 4YCUA 5EBCA 2J7ZA 1EIYB 3P7JA 5IYCH 2UUAQ 1U5KA 5CV7A 4OHJA 1TWAH 4R4QA 4DV2L 1CKMA 1MHWC 4ZQ3A 3AEVA 1PLFA 2EYMA 4DUZL 2JXMB 3H0GG 5M3MH 1VQMA 5EBDA 1JJGA 5GROA 2B2VC 5JPNC 3M7GA 5HGTA 4FVMA 3HOWG 4K2LA 4O42A 4BBRB 5K36H 4JOIC 2ZM6Q 2IX3A 2PW5A 3MWYW 5IGDA 5KYLA 5T1IA 1B9NA 1QVFA 4AH6A 1CT1D 1VQAA 5M3FG 5FOBB 3MC0B 3ICEA 3PUVA 3VYTA 4JI6Q 1QNKA 3NTIA 1YHAA 1CZGA 4DKAC 3K5MA 1KQSA 1GKHA 5EGTA 3S2DB 2I5HA 3TP8A 3S1MH 3C46A 1N32Q 3S15H 1Q3LA 1X54A 1X32A 3DHQA 5JJZA 2KOLA 2Q2HA 3W1GA 4IALA 1DYQA 4ZAIA 1KLUD 1WTXA 2HIXA 3NTKA 3OW7A 4QL5A 3BG3A 3HKSA 5C6AA 1R9TB 4LNQA 3HOVB 4JI4Q 4GNXC 1PH1A 4GKKQ 4Y52H 3KOJA 3KJPA 1EYGA 1WCMG 1H9JA 5C4JH 1BCPC 2EY6A 1D7QA 4IPHA 2Q2TA 2PO4A 1HXYD 5C3WA 2DNCA 3I56A 3GTPH 4HSVA 4KHPQ 3GTLH 1CM9A 3I55A 4JI5L 2K7VA 3TZUA 2QKIC 5CORA 1GD7A 2PI2E 1IBMQ 1HA6A 3CRLC 2VNUD 1B53A 1Y1WB 4K0KL 4MN3A 4X3KA 4RGMA 2XWJB 4U673 3NUCA 5ISRA 5KNBA 3PUYA 4JBJA 2MHVA 5C3EG 2OXPA 4OONA 1RCVD 2E8GA 4LF6L 2C9OA 2B63G 2N88A 1RIPA 2XRSD 2K75A 1KRSA 2Z1CA 4X66L 3CCVA 1BF4A 1AFPA 4DAPA 1P8LA 4G7OC 4A93B 4I7AA 2JA8G 2ICIA 2L11A 2IHFA 1FJGQ 3QG1A 3TP7A 4A4IA 3HKZG 4JV5L 2PYKA 1CHPD 3NWTA 2CW0C 1HUMA 3L0OA 1WCMH 1V1QA 2HHHQ 5CR3A 1PA6A 3KUPA 2EPBA 1AN8A 1N34L 2QDBA 1PTOF 4CDCC 3MXPA 1VQPA 1UWVA 4F7XA 1JB3A 4FXKC 1ILQA 1EY7A 4X3TA 3CRKC 2RDHA 4YWLA 2Z6KA 3J7AV 1S72A 1BCPD 1ENCA 1QNUA 2K04A 1IYUA 5E3FA 5KYIA 3S1QH 3KF6B 4B9XA 1PYSB 1GO3E 1F2ZA 2RF4A 1GUNA 1HNZL 4B9WA 2E2JH 4DV5L 4HR7B 3ERQA 4C3IG 3GTLB 1FNVA 2E5LQ 1TWGB 4ZYSA 3PO3H 3W1BA 4GOPB 4APVA 2LXKA 2K5QA 2RBMA 4JI3Q 2A6HC 3ULJA 4IFDH 3TZDA 4OWWB 1C48A 3CF5A 1IW7C 3MA2B 4LFBL 3K7AH 1VMPA 4HJ5A 3ND8A 1I4PA 1RHPA 1Y1VH 3L3OC 4JI8L 2UU9Q 1BUVT 1E24A 1GVPA 2B39A 2A6HD 1EZ8A 3OOCA 2R7ZG 3E0JA 2NVYH 1VQ7A 2XTIA 1TQOA 4FYDA 1EU3A 2OT2A 4RHSA 3RLFA 2VB2X 1R9TH 2E76C 4Q0FA 3RLNA 3AU7A 3E5SA 1HNWQ 3UI2A 4PMCA 2RCFA 5IP7G 4DK0A 3URYA 4HJAA 1PMRA 2VQFQ 3NBHA 1Z9FA 2CW0D 2MGSA 2KVMA 5FO8B 4HIDA 1HR0W 4UAIA 4JOIA 2OTLA 5KIXA 3I90A 5FK9C 3SE0A 2FHTA 1G91A 5C0XG 2EJGC 3RZDB 4TKOB 1XPRA 1P16A 5C0XH 2WKDA 1SDFA 4BBRH 1OXVA 1PTOB 1M1KC 1PDQA 4IJLA 1HNXL 3V2TA 1PH9A 2NN6I 1JCKB 5GQOA 1LYLA 4DR7Q 2K6AA 3GTOB 3A56A 1XPUA 4A3DH 1EOTA 3I4MH 2G5DA 1MJCA 3T1YL 4DV6L 3E0EA 3K58A 5IYCG 1B8AA 1L1OB 1I4GA 5IGEA 1WTHA 1Q86C 3GTKB 2QCPX 4B3SL 3BDOA 1LABA 2OEOA 2MP1A 2MO1A 2ZM6L 2BA0A 1YBYA 1Z47A 2JN4A 4QB4A 4A3LH 1E2WA 3S1QB 1CFMA 2F0GA 2PZUA 5C5MA 3MXUA 4BY7B 1VQDA 2KJXA 1XTDA 4A3CG 2EXZA 4BA2I 1KL9A 1NJIC 3TN2A 5C3EB 4WJWA 1VQ8A 4N8X1 3DXJC 5A2QE 3JAME 2K5HA 4KHVA 4UP8A 1PTOD 1SMXA 1Y1WG 1WCMB 5EPJA 1TWFH 3KFUA 3PMFA 1HR0Q 1O78A 2XRQD 3M4YA 3VR4A 3M4OH 4NPSA 3Q0AA 2NYZD 1IZ6A 2CWPA 2OQKA 4B3TQ 1LTBD 1KDBA 1D2BA 3R2IA 3PUXA 4FF1A 4JI7L 4F88A 2DJFC 4KD4A 2JEBI 4NW2A 5LMNW 3S16B 4H0LC 3BJUA 2ZTCA 1HUNA 4JI2L 3WWVA 1KIXA 1TKWB 4X3SA 4DV7L 5DAUA 5GAEC 4QUFA 4OXPA 4P72A 4QIWE 1DM0B 2NVTH 4RCOA 3DEOA 3J80c 1KDAA 2RVLA 5D65A 3ZYYX 2IPKD 1EQVA 1ZKOA 3I4MB 2B2VA 3J7A5 2XNAC 2N78A 1VQNA 2PI2A 3P1HA 1STGA 1N32L 3D6CA 2HDMA 2LSSA 1F9PA 1XNRL 1VQBA 2IHEA 1MSHA 2HQEA 1Y1VG 4BBRG 1A6XA 4IUVA 1D5ZC 1UEAB 1SE2A 3HOWB 2L0CA 2M00A 4X65L 2B8GA 3OIPA 5FJ8H 3HOVH 4BY7H 2EXDA 1QG7A 3H0GB 3E9IA 1LO5D 4YHHQ 1WTOA 4B3RQ 3K6OA 2BA1A 4FDBA 1ET9A 3TS2A 2YTYA 3A8IE 4IUPA 1HTPA 2NVTB 1IKMA 3HOUG 4HMJA 4RGNA 3PSIA 2WIIB 3RLOA 4C3IB 1Q90A 1U4LA 3HOUH 1DXMA 5CV8A 1LV9A 1RTNA 1VQ5A 1D1KA 1NBWA 4BY1H 1BXTA 1MJEA 1PH4A 5M3MB 2R93H 5ELOA 1AZQA 3HOXB 4WRDA 5GAHC 1A2UA 1L2FA 5IWAQ 1C7YA 1S3OA 4EX5A 1WYDA 3S16H 1FNUA 4IPGA 4QQBX 1XNQL 4A3FG 4EQOA 2D0PA 3WOEA 1KC8C 1AE3A 3G48A 3CMEA 1K28A 1NY4A 3RZDH 3I91A 4DK6C 2KHSA 3S14H 1H9RA 4HEDA 1H95A 4IOAA 1XWEA 3S1RB 1K83B 1UE1A 3HS0C 4DK1A 2H4OA 1XTCD 1Z6HA 2WV6D 1SJED 2ZTEA 2PCFB 3RR5A 2E5LL 2PQAA 4A3BB 4ZCKA 2CQOA 5IE8A 1O80A 2X6GA 3S1MB 2H5XA 3RN5A 3PIOA 3R2TA 5LHY1 2IL8A 2B63H 3JC66 4NMZA 4RMFA 4LFBQ 1SSOA 4M8AA 5CV6A 3NBHB 3VR5A 2WKCA 4IURA 4FF2A 5F2DA 2F4IA 1A0IA 1JOQA 2JA6B 2F0WA 3NQTA 4KN7C 2PPBC 1JWUD 1JB7A 1STEA 1DGSA 5C4HA 3Q24A 1ESRA 1TS4A 3HOZB 1QUQB 2KCCA 2ZXRA 1GUOA 1R4PB 1IBKQ 1KABA 1RODA 2I5MX 2F3WA 4GS3A 5KEEA 4K6LA 4KY6A 1HNWL 1CKNA 1RF2D 5I6WA 5D3DA 1CQFA 2MQHA 1X3GA 3GV3A 3KF6A 4CGYB 3VA7A 1PTOH 5H1SE 4JK1C 1D5MC 1D6EC 3MEHA 1YIJA 1EOVA 2RKSA 3MEFA 4NB3A 4OIJA 2KECA 1CHQD 4KKTA 3T13A 1LM0A 1JOKA 4Y7NH 1FR3A 1KLGD 3BVGA 4A3MB 2AUKA 4L63B 4HIOA 3NQIA 3KBGA 1YITA 1G2SA 3J81i 3OWFA 2QEJC 4DR2Q 3R3OA 5CBAE 2UXBL 4R1JA 2UU9L 2NVQH 2RCNA 4YY3L 1PYBA 2F0TA 2A74C 5NUCA 2EIFA 4HSPA 4XDXA 4WORA 1KHIA 4L5RC 4FF4A 1TWAB 4OIKA 2F4VL 3N6RA 4CKBA 1Y8NB 2K5NA 4OO1H 1EFWA 2UUAL 1SNQA 1GHKA 2B2WC 4UHVA 5CBEE 4BY1G 1KRTA 4A3GH 1H9SA 4C2MH 1K0SA 2LXJA 1PH7A 1F9QA 3ZJYC 4LMQD 5KNDA 4X62L 4DUZQ 4DPGA 1U4PA 1G291 4HJ7A 3PIPA 3HOWH 1QB5D 1CI3M 2HDLA 3BU2A 1QZHA 3K80C 3KLSX 3J81E 3P75A 3ITPA 3PO2H 1I4XA 2PZTA 1VQCA 5IYDH 2A6ED 5HY6A 1X3PA 1B9MA 3KLWA 4JW0A 5M5XH 4KD3A 1R4QB 1YEZA 5M5WH 3PIO3 5ELBA 2EDGA 3S2HB 3K57A 3PQIA 1ZEQX 2NVXB 2TSSA 3G6JB 1O7ZA 4H44C 3SK5A 1CQVA 5AJ3Q 4IPCA 4EVOA 4TVAB 3DM3A 3KBXA 2K5WA 4DNTB 2B2UC 4DR7L 1SRUA 1XX8A 3F2UA 1E2VA 4LF8L 3M7NA 3CP0A 1HJPA 3CXCA 4A3KG 4ULLA 4DV6Q 3C3LA 3M4PA 1U4RA 2IJ0A 1D8LA 5IODA 3TRZA 3RZOB 1XJVA 4DV7Q 4CHTB 4LFAQ 3TP6A 4DA2A 4R8NA 1TWGH 4MHEA 2E2JB 4R8IA 4MTKA 1YJNA 3S1RH 5FLXE 2JA5G 2NTTA 2F0QA 5IYBG 2R92B 2UUCL 1EWHA 2VB3X 1HQMC 1JQYD 3E6ZX 2CH4W 2AQ1B 1NMFA 1TS5A 3PUWA 4DR3L 4S3SA 4X64Q 4OWXB 4KHPL 3D4WA 2JA7G 1MBYA 3MXNA 3SVMA 1I4HA 1QJOA 3GTGB 2XWBB 4JI0Q 2JA6H 2F0VA 3A8KE 4HIMA 1IBLQ 3HP3A 4YHHL 1M90C 4IOCA 4IUUA 1TT2A 3G7LA 3LNNA 4FNFA 1ENAA 1EYDA 4XTCS 4JC0A 3A8JE 5GAGC 2UUBQ 3F2DA 3T1HL 2ZXPA 1BBUA 1EL0A 4CKEA 2NVXH 3J7YW 4A3LG 4ZRZA 2R7DA 4DFAA 1KNAA 5BN4A 2BDNA 1J6QA 3RNUA 1RKNA 2EY2A 1S5ED 1SYBA 2JEAI 2F0IA 1K83H 1SE8A 4P73A 5C4JB 4IUTA 1BO0A 2ZJRA 2F0PA 3S17H 3E9HA 4KKSA 1CUKA 4B3MQ 2L4NA 5FKAC 1KDCA 1XNQQ 4N8FA 4R4IA 4QIWB 1OXSC 2Z0SA 1I6VC 2B2YC 4ZUIA 4DGZA 4JPBW 3CCMA 2E2HH 2B2TA 4PG3A 5EKKA 4P2CB 4NXNL 5M5YB 1A63A 2RA4A 3FKIB 2EQSA 4BBSG 1E1TA 2F0OA 1G6ZA 3WDNA 1YVCA 4K5XA 1C8CA 3K7AB 1PRTD 4LFCL 1JC7A 1I94Q 4B3RL 1VQFA 1QUQA 2G9DA 2FJ2A 3Q8DA 3PO2B 1C0AA 3HKZE 1FGBD 4K6DA 4MNOA 1XMOL 2K03A 1HA5A 3HGBA 1DOMA 2NVYB 5CGKA 3BZDB 1HNZQ 2D62A 2ES2A 3J80i 3TQYA 1ASYA 5M3MG 4DR5Q 4GKJL 1WI5A 3OMGA 1EEFD 4TRDA 4C2MB 4XQQA 4A3JG 1GUGA 1VQGA 3U58A 4C3JB 4A3FH 1XMQL 2CKZB 2DUDA 2RDGA 2JYOA 2JSOA 4JBKA 4LF5L 3OWEB 3H09A 2N8NA 5CV5A 2YTVA 1NR2A 5JAVA 3PUZA 1QZGA 1PH8A 3GP7A 1Q46A 4GN5A 5C0XJ 2HT1A 1B2TA 1EQTA 1GM5A 4RHRA 4C1NI 3CCUA 1K8GA 3EJIA 4GNXB 3I73A 2RHQB 5EPKA 2PQAB 3GTQB 1OXUA 3PO3G 4G7ZC 1LTAD 4A3KH 1GJXA 1O7YA 2IW3A 1EWCA 2QW7A 1W3SA 5G3LF 3OPOA 4Z9CB 1C9OA 1D5XC 3AYHB 1LTLA 3OYYA 4KY5A 4DV2Q 3EFXD 1PFBA 1U4MA 5C4XG 4JYAQ 2I46A 3RD4A 4RGTA 3D6WA 4YY3Q 5FLMG 1A62A 4B08A 2F0EA 4POGA 2Q8RE 1UNSA 1LTSD 4DV4L 2EYOA 1YNND 1A15A 1EWIA 1IW7D 2UXCL 4IN3A 4G7HC 1Q1EA 4G57A 3TDQA 2R92H 1JE5A 5CMDA 3D0FA 4V190 1Z7TA 3FDTA 2XIWA 3PGZA 3Q22A 5KNCA 1YNJD 3I4NB 4PNYA 2HUGA 3QIAA 4OL7A 3MTSA 3KLRA 1AW7A 3FMCA 2Q2IA 1WFQA 2SNSA 4CJ2C 1SYGA 1I6HH 3T1YQ 2SNMA 3KK7A 1WTRA 1YNJC 1HH2P 2KUMA 3BDLA 3L2PA 5J22A 1I4QA 2CCZA 4P74A 1HPCA 1WOCA 1HFNA 4EGVA 5HGQA 1F9SA 3FHWA 3D3RA 3HOYH 4A3EB 1STAA 4GLVB 1PH6A 1HZBA 3HOYG 3S24A 2R7FA 2L5TA 4R4OA 4YWMA 1NSNS 2UXDL 1CTMA 1K8MA 4DR6Q 1LTID 2DN8A 4DUYQ 2F0FA 1PXUA 2KQ3A 4MIUA 3SGIA 4JI4L 3VR2A 4RKLA 1KNEA 3MHBA 1UE5A 3GTMB 3J81c 1VQ4A 1ICWA 2F4VQ 1L1OA 1RL2A 3K7UC 4XYQA 4GOPC 4DN4M 3LX0A
chains in the Genus database with same CATH topology
1CSPA 4A3MG 3HOVH 3PO3H 2R7ZH 4BA1I 2EXDA 2K14A 1N36L 3E9IA 4YHHQ 4BY7H 4B3RQ 4JI1Q 2KHJA 3U4ZA 2VW9A 2BA1A 4FDBA 3CW2C 3CC4A 3TS2A 3NENA 2YTYA 1X3EA 4LWCA 4NXNQ 3CMAA 3CCQA 4BXXH 3HOUG 3GTKH 2C35B 3PO2G 3PSIA 3CCLA 3J7ZC 3RLOA 4DV1Q 1AH9A 3HOUH 4POFA 4LF7L 4A75A 2JA6G 1BBWA 2YV5A 4AQYQ 5IYDG 3STBC 3IRBA 4OO1I 1VQ5A 5AJ3L 5JJKA 4DR4L 4BY1H 1KAWA 1EQRA 1NBWA 1MJEA 1PH4A 2R93H 1PH5A 5IP9G 5ELOA 4KI0A 5C3EH 1IBKL 1Q7YC 1JMCA 1K0RA 2WB1G 1X65A 2FXQA 2JA9A 2OQ0A 4A3GG 5GAHC 1L2FA 5IWAQ 3M4QA 1C7YA 2VL6A 1S3OA 4EX5A 1WYDA 1CKNB 1HNXQ 4LUOA 3HOZG 3S16H 3I4NH 4LUZA 5FJ8H 2L15A 4IPGA 1XNQL 4A3FG 4QQBX 2D0PA 4DNIA 3UE1A 1B7YB 1E7ZA 1KC8C 3UE0A 1AE3A 2IX0A 3G48A 1IXRA 1VS0A 4UPAA 3CMEA 4RG1A 4DAMA 1NY4A 1VQHA 4LW1A 4L5TA 3RZDH 1XPOA 1Y1WH 1N33L 3A5UA 3LGJA 4JI0L 4JBMA 4AIMA 5LMUL 4DUYL 4DK6C 1QVGA 2I5LX 1XMQQ 1NE3A 2WB1E 3S14H 2QA4A 4H02A 3I4MG 4OO1G 4IOAA 4LF8Q 4A93G 1H95A 1UE1A 2HHHL 3NELA 4O2DA 4R4CA 3H15A 4IO9A 4XIGS 5C4XH 2ASBA 2VS1A 2CFMA 4GLAC 3K0XA 1FL0A 2K5VA 2ZTEA 3TREA 3RR5A 3T1HQ 2E5LL 2PQAA 4A3BG 4LF9Q 5JEAG 2ZTDA 2CQOA 5IE8A 5K36G 3UDGA 2H5XA 1FVIA 3RN5A 3PIOA 4L5SA 4BXXG 3G6EA 4IFDJ 2B63H 3CCRA 3JC66 4B3SQ 4RMFA 4LFBQ 1HZCA 2ATWA 1X55A 4DV0Q 4PZ6A 3A74A 1EUJA 3CC2A 1UE7A 4A3EG 3NBHB 2KHIA 4L5QA 2JJQA 2UUCQ 3EIVA 1S40A 1A0IA 4YCUA 4DV3L 3GTQH 3J81j 1EIYB 5IYCH 4LF7Q 1JB7A 4KLKA 2UUAQ 1U5KA 1DGSA 1IBLL 4J15A 1TWAH 3K8AA 5ELNA 1QUQB 4DR1L 4R4QA 5BR8L 4DV2L 1CKMA 4X64L 1MKHA 5LMNL 1IBKQ 2JA7H 1VQ6A 1I50H 1VCIA 2I5MX 2IY5B 4TQUS 4GS3A 3AEVA 1HNWL 1CKNA 4HIKA 2UUBL 4DUZL 5M3MH 3B6YA 3H0GG 4AYBG 1VQMA 3STBD 1JJGA 3PF4A 2MQHA 1X3GA 4OWTB 5GROA 3KF6A 3FKIH 1OXXK 5H1SE 3HOWG 2A1AA 4P71A 3UDFA 3L7ZC 2VQEQ 1N8RC 5M5YH 4JOIC 1YIJA 2ZM6Q 1I3QH 1EOVA 5LMUQ 2JA5H 2JQOA 3MEFA 4MTNA 4NB3A 1Q81C 1QVFA 3CPFA 3M3YH 4AH6A 3OW2A 1VQAA 5M3FG 4NXML 3ICEA 1CSQA 1LM0A 3PUVA 1BKBA 4JI6Q 2K4KA 4Y7NH 2E2IH 1YHAA 4UP7A 1YHQA 4DKAC 4UP9A 4K0KQ 4HIOA 3CCJA 1YITA 2BH2A 1Y14B 3J81i 1KQSA 1GKHA 4DR2Q 1Q8KA 1J5EL 2UXBL 1VQLA 2I5HA 4R1JA 1VQJA 2MFIA 2UU9L 2VZAA 2NVQH 2RCNA 4YY3L 3S1MH 1PYBA 4LUVA 1ASZA 1X56A 3GTOH 3M9BA 1N32Q 4OX9L 2EIFA 3ULPA 3S15H 4R4TA 4B3ML 1TWHH 1X54A 4A76A 1KHIA 1TXYA 4L5RC 4LFCQ 4IFDG 1L0WA 2R93G 3W1GA 2Q2HA 2F4VL 3HOZH 2K5NA 2NZOA 4GN4B 4A3EH 5FLXc 1EFWA 2UUAL 2HIXA 4A3CH 3I4NG 4JV5Q 4PMWA 4QL5A 3FP9A 3HKSA 4JBWA 4BY1G 1KRTA 4LNQA 4A3GH 4C2MH 4JI4Q 3K81C 4GNXC 3KF8B 3TS0A 2LXJA 2N49A 1I94L 1PH7A 3ZJYC 1PH1A 1PHJA 4X62L 4GKKQ 4WJ3M 4DUZQ 3KJOA 4DPGA 4Y52H 3KOJA 5J3BA 3KJPA 1EYGA 3NEMA 1G291 1WCMG 4HJ7A 3PIPA 4DV1L 3GTMH 3HOWH 5C4JH 3BU2A 1QZHA 1D7QA 4AQYL 3K80C 3MXNB 3PCOB 4IPHA 2Q2TA 3PO2H 4QY7A 4A3BH 3HOVG 2GVBA 1VQCA 5IYDH 3I56A 5HY6A 3GTPH 2OTJA 4UY8C 4KHPQ 3KLWA 3GTLH 4YCWA 1UE6A 3I55A 5M5XH 3CAMA 4JI5L 1YEZA 5M5WH 1GD7A 1VQKA 2K52A 2PI2E 1Q82C 1WJJA 1IBMQ 1V9PA 2VNUD 4K0KL 2NN6G 5AJ3Q 4IPCA 3VDYA 2MNAA 5M3FH 3GTGH 4TVAB 3AQQA 3DM3A 1N9WA 3PUYA 4JBJA 4WJ4A 5C3EG 1YI2A 2Y0SE 4OONA 3I4OA 4GNXA 2E8GA 4DR7L 1SRUA 1OTCA 2AKWB 2YTXA 4JG2A 4LF6L 4LF8L 2B63G 3M7NA 1RIPA 3CP0A 1HJPA 2K75A 4HJ8A 3CXCA 4A3KG 1KRSA 5JEAJ 4X66L 3CCVA 4JI3L 1P8LA 4DV6Q 3M4PA 4GLXA 2JA8G 1PFSA 1D8LA 3F2CA 1FJGQ 2IHFA 1XJVA 4LF9L 3TRZA 1V43A 1E3PA 4A4IA 4DV7Q 3HKZG 4DAYB 4JV5L 4ME3A 1G51A 1K9MC 4LFAQ 4JI8Q 2Q2UA 1BVSA 3RN2A 1E22A 1TWGH 3A0JA 1X9NA 2BH8A 3L0OA 1WCMH 1V1QA 2HHHQ 4QJFA 1PA6A 1YJNA 3S1RH 1UEBA 2JA5G 4A3DG 5IYBG 1HR0L 2UUCL 1N34L 1X6OA 2QGQA 4EQ5A 1O7IA 1SROA 3M85A 2YU9H 2UXDQ 1PH3A 1NMFA 3PUWA 4DR6L 5E7NA 4DR3L 1VQPA 1IYJB 1UWVA 3S1NH 4X64Q 4OWXB 4KHPL 4DV4Q 3AFPA 1K8AC 3RZOH 1VQOA 4YWLA 2VQFL 2UXCQ 2Z6KA 2JA7G 1S72A 3ER0A 1HZ9A 4JI0Q 2JA6H 4HIMA 3U4VA 1IBLQ 3S1QH 3KF6B 4YHHL 1M90C 4IOCA 1PYSB 1GO3E 2RF4A 1HNZL 4HJ9A 4C3IH 3GO5A 2E2JH 4DV5L 2IT1A 4XTCS 4JC0A 3CCEA 5GAGC 2UUBQ 3F2DA 3T1HL 2E5LQ 1JJCB 2KCMA 2K50A 3UDIA 1BBUA 3W1BA 4APVA 3GDEA 2LXKA 4GOPB 1T9HA 2AWNA 1W2BA 2NVXH 2KCTA 4A3LG 4JI3Q 3S2HH 2R7DA 3ULJA 4IPDA 4OWWB 1J6QA 3CF5A 3RNUA 4GN3B 1A8VA 4A93H 2AMCB 4LFBL 1YZ6A 2B29A 3K7AH 4HJ5A 2JEAI 1K83H 1SE8A 3CD6A 4P73A 1Y1VH 4JI8L 4LFAL 3I7FA 2UU9Q 2R92G 2VUMH 2PNHA 1SN8A 2ZJRA 4A3MH 1E24A 3S17H 3E9HA 3ULLA 1GVPA 1CUKA 2AWOA 4X65Q 4JI6L 4B3MQ 2JK8A 5C0XI 2R7ZG 1XNQQ 1N36Q 4R4IA 2NVYH 1OXSC 1VQ7A 2XTIA 2Z0SA 3F2BA 3HFZB 3RLFA 2UXBQ 3CCMA 3GD7A 1R9TH 2I0QA 2E2HH 3RLNA 3G4SA 4PG3A 4NXNL 4PZ7A 2ID0A 1HNWQ 1A63A 3HOXG 4DR3Q 2EQSA 4BBSG 1E1TA 1YVCA 5IP7G 4HJAA 4LFCL 3KDFA 4C3HH 1I94Q 2VQFQ 4B3RL 1VQFA 4JI1L 5IP9H 1Z9FA 1QUQA 1CKOA 1EIFA 5JJLA 3Q8DA 2JA8H 3W5OA 1C0AA 2VQEL 1Q1BA 4HIDA 3HKZE 1HR0W 4MNOA 3OTOL 1XMOL 3S2DH 4JOIA 2OTLA 4A3IG 2N3SA 5IWAL 2ES2A 5IT9c 2D62A 1SFOH 3J80i 3TQYA 3CPWA 5M3MG 5IYBH 4DR5Q 1HNZQ 1ASYA 4GKJL 1WI5A 1YJWA 2JE6I 4LF4L 3A5ZB 4GKKL 3BZKA 5C0XG 4DR4Q 4JI5Q 3H0GH 1XPRA 1P16A 4A3JG 2OCEA 4BBRH 3TEHB 1YJ9A 1VQGA 1TWCH 1OXVA 2YYZA 4O0AA 3U58A 1M1KC 3U50C 4KHZA 2QEXA 4A3FH 5FJ8G 1XMQL 2CKZB 2DUDA 4IJLA 1HNXL 4QGUA 3CC7A 3ERSX 1MIUA 4B3TL 5C44G 5BR8Q 1PH9A 4JBKA 4LF5L 2NN6I 2KBNA 3EBEA 5GQOA 1LYLA 2D0OA 2HIVA 2N8NA 2NZHA 2ZJQA 4DR7Q 4JI7Q 2VY3A 1G6PA 2YTVA 2RHSB 1XPUA 4A3DH 1N33Q 3I4MH 4JI2Q 1EQQA 4DK3C 1IBML 1VQ9A 1QVCA 1MJCA 4MZ9A 2VUMG 3T1YL 3PUZA 3F1ZA 4DV6L 3E0EA 1B70B 1QZGA 5IYCG 1Q46A 1PH8A 1B8AA 1L1OB 4GN5A 5C0XJ 1Q86C 2HT1A 1GM5A 2IX1A 4B3SL 1I5FA 3CCUA 1K8GA 2PMZE 4GNXB 2MO1A 2ZM6L 2BA0A 1YBYA 1Z47A 2RHQB 2PQAB 2HQLA 1OXUA 2ZJPA 2F52A 1YNXA 3GTJH 3CCSA 4A3LH 3PO3G 1U0LA 2AHOB 4YWKA 3KDFB 4A3KH 4X66Q 2CWAA 3JAMc 1VQDA 1XTDA 1W3SA 4A3CG 1N34Q 4BA2I 5DLQE 1C9OA 3AYHB 1LTLA 1FJGL 3OYYA 3OTOQ 1KL9A 4DV2Q 1XMOQ 4DV0L 1OXTA 1NJIC 3JAMi 3PF5A 4JCVE 1J5EQ 1XNRQ 1AE2A 4JYAQ 5GADC 5C4XG 2XGTA 2ALYB 1VQ8A 1VQEA 4YY3Q 1SR3A 1A62A 1X3FA 5FLMG 3BZCA 4DV3Q 4DR5L 2K5HA 1KD1C 4GKJQ 4OX9Q 4POGA 5FLMH 2DGYA 4UP8A 1Y1WG 1SMXA 4DV4L 4LF4Q 1EWIA 1TWFH 3KFUA 1HR0Q 1IL2A 2OWOA 2UXCL 4C3JH 4DR1Q 1Q1EA 3DLLA 2KENA 3M4OH 4NPSA 2R92H 1JE5A 5LMNQ 4IFDI 4YCVA 1SLJA 3D0FA 1IZ6A 2WP8J 2A8VA 1K3RA 2CWPA 2R6GA 3PGZA 3UDXA 4X6AH 1NMGA 3CQZH 4P75A 1NTGA 4LF6Q 2WAQE 2OQKA 3PV0A 4B3TQ 4LF5Q 5IY0A 1VQIA 3G71A 1PV4A 3F8TA 1Q12A 3PUXA 3H3VI 4BY7G 4JI7L 1PVOA 1JJ2A 2JEBI 3D31A 5LMNW 4ALPA 3BJUA 2ZTCA 1WFQA 2Q2IA 2GVAA 2WAQG 4JI2L 3WWVA 1KIXA 4DR2L 4DV7L 1I6HH 2MO0A 5GAEC 3T1YQ 1FGUA 3EN2A 4OXPA 1HH2P 3I2ZA 4P72A 3L2PA 4NXMQ 2B3GA 2CCZA 4P74A 1WOCA 4PZ8A 4IJHA 4QIWE 2A19A 2NVTH 4BBSH 5HGQA 4DV5Q 4AYBE 3FHWA 4GOPA 5EAYA 3J80c 1E1OA 2Z6KC 3KYHC 1L1OC 3HOYH 5JJIA 2V1CC 4GLVB 5IP7H 1PH6A 1HZBA 3FKIG 3HOYG 1JT8A 4A3IH 3J7A5 3S24A 1PH2A 2R7FA 2N78A 1VQNA 2PI2A 4R4OA 4YWMA 2UXDL 1KXLA 2F3IA 5C44H 4DR6Q 3H3VH 4DUYQ 1N32L 3SGIA 4A3JH 2LSSA 1XNRL 4JI4L 1VQBA 2Y0SG 2IHEA 4JYAL 1HZAA 1Y1VG 2GN5A 4BBRG 1UE5A 4X62Q 1YHBA 3J81c 1K73C 1VQ4A 2F4VQ 1L1OA 3AFQA 4X65L 1RL2A 2WFWA 3K7UC 1LUZA 4GOPC 3HOXH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSP A;  4A3M G;  3HOV H;  3PO3 H;  2R7Z H;  4BA1 I;  2EXD A;  2K14 A;  1N36 L;  3E9I A;  4YHH Q;  4BY7 H;  4B3R Q;  4JI1 Q;  2KHJ A;  3U4Z A;  2VW9 A;  2BA1 A;  4FDB A;  3CW2 C;  3CC4 A;  3TS2 A;  3NEN A;  2YTY A;  1X3E A;  4LWC A;  4NXN Q;  3CMA A;  3CCQ A;  4BXX H;  3HOU G;  3GTK H;  2C35 B;  3PO2 G;  3PSI A;  3CCL A;  3J7Z C;  3RLO A;  4DV1 Q;  1AH9 A;  3HOU H;  4POF A;  4LF7 L;  4A75 A;  2JA6 G;  1BBW A;  2YV5 A;  4AQY Q;  5IYD G;  3STB C;  3IRB A;  4OO1 I;  1VQ5 A;  5AJ3 L;  5JJK A;  4DR4 L;  4BY1 H;  1KAW A;  1EQR A;  1NBW A;  1MJE A;  1PH4 A;  2R93 H;  1PH5 A;  5IP9 G;  5ELO A;  4KI0 A;  5C3E H;  1IBK L;  1Q7Y C;  1JMC A;  1K0R A;  2WB1 G;  1X65 A;  2FXQ A;  2JA9 A;  2OQ0 A;  4A3G G;  5GAH C;  1L2F A;  5IWA Q;  3M4Q A;  1C7Y A;  2VL6 A;  1S3O A;  4EX5 A;  1WYD A;  1CKN B;  1HNX Q;  4LUO A;  3HOZ G;  3S16 H;  3I4N H;  4LUZ A;  5FJ8 H;  2L15 A;  4IPG A;  1XNQ L;  4A3F G;  4QQB X;  2D0P A;  4DNI A;  3UE1 A;  1B7Y B;  1E7Z A;  1KC8 C;  3UE0 A;  1AE3 A;  2IX0 A;  3G48 A;  1IXR A;  1VS0 A;  4UPA A;  3CME A;  4RG1 A;  4DAM A;  1NY4 A;  1VQH A;  4LW1 A;  4L5T A;  3RZD H;  1XPO A;  1Y1W H;  1N33 L;  3A5U A;  3LGJ A;  4JI0 L;  4JBM A;  4AIM A;  5LMU L;  4DUY L;  4DK6 C;  1QVG A;  2I5L X;  1XMQ Q;  1NE3 A;  2WB1 E;  3S14 H;  2QA4 A;  4H02 A;  3I4M G;  4OO1 G;  4IOA A;  4LF8 Q;  4A93 G;  1H95 A;  1UE1 A;  2HHH L;  3NEL A;  4O2D A;  4R4C A;  3H15 A;  4IO9 A;  4XIG S;  5C4X H;  2ASB A;  2VS1 A;  2CFM A;  4GLA C;  3K0X A;  1FL0 A;  2K5V A;  2ZTE A;  3TRE A;  3RR5 A;  3T1H Q;  2E5L L;  2PQA A;  4A3B G;  4LF9 Q;  5JEA G;  2ZTD A;  2CQO A;  5IE8 A;  5K36 G;  3UDG A;  2H5X A;  1FVI A;  3RN5 A;  3PIO A;  4L5S A;  4BXX G;  3G6E A;  4IFD J;  2B63 H;  3CCR A;  3JC6 6;  4B3S Q;  4RMF A;  4LFB Q;  1HZC A;  2ATW A;  1X55 A;  4DV0 Q;  4PZ6 A;  3A74 A;  1EUJ A;  3CC2 A;  1UE7 A;  4A3E G;  3NBH B;  2KHI A;  4L5Q A;  2JJQ A;  2UUC Q;  3EIV A;  1S40 A;  1A0I A;  4YCU A;  4DV3 L;  3GTQ H;  3J81 j;  1EIY B;  5IYC H;  4LF7 Q;  1JB7 A;  4KLK A;  2UUA Q;  1U5K A;  1DGS A;  1IBL L;  4J15 A;  1TWA H;  3K8A A;  5ELN A;  1QUQ B;  4DR1 L;  4R4Q A;  5BR8 L;  4DV2 L;  1CKM A;  4X64 L;  1MKH A;  5LMN L;  1IBK Q;  2JA7 H;  1VQ6 A;  1I50 H;  1VCI A;  2I5M X;  2IY5 B;  4TQU S;  4GS3 A;  3AEV A;  1HNW L;  1CKN A;  4HIK A;  2UUB L;  4DUZ L;  5M3M H;  3B6Y A;  3H0G G;  4AYB G;  1VQM A;  3STB D;  1JJG A;  3PF4 A;  2MQH A;  1X3G A;  4OWT B;  5GRO A;  3KF6 A;  3FKI H;  1OXX K;  5H1S E;  3HOW G;  2A1A A;  4P71 A;  3UDF A;  3L7Z C;  2VQE Q;  1N8R C;  5M5Y H;  4JOI C;  1YIJ A;  2ZM6 Q;  1I3Q H;  1EOV A;  5LMU Q;  2JA5 H;  2JQO A;  3MEF A;  4MTN A;  4NB3 A;  1Q81 C;  1QVF A;  3CPF A;  3M3Y H;  4AH6 A;  3OW2 A;  1VQA A;  5M3F G;  4NXM L;  3ICE A;  1CSQ A;  1LM0 A;  3PUV A;  1BKB A;  4JI6 Q;  2K4K A;  4Y7N H;  2E2I H;  1YHA A;  4UP7 A;  1YHQ A;  4DKA C;  4UP9 A;  4K0K Q;  4HIO A;  3CCJ A;  1YIT A;  2BH2 A;  1Y14 B;  3J81 i;  1KQS A;  1GKH A;  4DR2 Q;  1Q8K A;  1J5E L;  2UXB L;  1VQL A;  2I5H A;  4R1J A;  1VQJ A;  2MFI A;  2UU9 L;  2VZA A;  2NVQ H;  2RCN A;  4YY3 L;  3S1M H;  1PYB A;  4LUV A;  1ASZ A;  1X56 A;  3GTO H;  3M9B A;  1N32 Q;  4OX9 L;  2EIF A;  3ULP A;  3S15 H;  4R4T A;  4B3M L;  1TWH H;  1X54 A;  4A76 A;  1KHI A;  1TXY A;  4L5R C;  4LFC Q;  4IFD G;  1L0W A;  2R93 G;  3W1G A;  2Q2H A;  2F4V L;  3HOZ H;  2K5N A;  2NZO A;  4GN4 B;  4A3E H;  5FLX c;  1EFW A;  2UUA L;  2HIX A;  4A3C H;  3I4N G;  4JV5 Q;  4PMW A;  4QL5 A;  3FP9 A;  3HKS A;  4JBW A;  4BY1 G;  1KRT A;  4LNQ A;  4A3G H;  4C2M H;  4JI4 Q;  3K81 C;  4GNX C;  3KF8 B;  3TS0 A;  2LXJ A;  2N49 A;  1I94 L;  1PH7 A;  3ZJY C;  1PH1 A;  1PHJ A;  4X62 L;  4GKK Q;  4WJ3 M;  4DUZ Q;  3KJO A;  4DPG A;  4Y52 H;  3KOJ A;  5J3B A;  3KJP A;  1EYG A;  3NEM A;  1G29 1;  1WCM G;  4HJ7 A;  3PIP A;  4DV1 L;  3GTM H;  3HOW H;  5C4J H;  3BU2 A;  1QZH A;  1D7Q A;  4AQY L;  3K80 C;  3MXN B;  3PCO B;  4IPH A;  2Q2T A;  3PO2 H;  4QY7 A;  4A3B H;  3HOV G;  2GVB A;  1VQC A;  5IYD H;  3I56 A;  5HY6 A;  3GTP H;  2OTJ A;  4UY8 C;  4KHP Q;  3KLW A;  3GTL H;  4YCW A;  1UE6 A;  3I55 A;  5M5X H;  3CAM A;  4JI5 L;  1YEZ A;  5M5W H;  1GD7 A;  1VQK A;  2K52 A;  2PI2 E;  1Q82 C;  1WJJ A;  1IBM Q;  1V9P A;  2VNU D;  4K0K L;  2NN6 G;  5AJ3 Q;  4IPC A;  3VDY A;  2MNA A;  5M3F H;  3GTG H;  4TVA B;  3AQQ A;  3DM3 A;  1N9W A;  3PUY A;  4JBJ A;  4WJ4 A;  5C3E G;  1YI2 A;  2Y0S E;  4OON A;  3I4O A;  4GNX A;  2E8G A;  4DR7 L;  1SRU A;  1OTC A;  2AKW B;  2YTX A;  4JG2 A;  4LF6 L;  4LF8 L;  2B63 G;  3M7N A;  1RIP A;  3CP0 A;  1HJP A;  2K75 A;  4HJ8 A;  3CXC A;  4A3K G;  1KRS A;  5JEA J;  4X66 L;  3CCV A;  4JI3 L;  1P8L A;  4DV6 Q;  3M4P A;  4GLX A;  2JA8 G;  1PFS A;  1D8L A;  3F2C A;  1FJG Q;  2IHF A;  1XJV A;  4LF9 L;  3TRZ A;  1V43 A;  1E3P A;  4A4I A;  4DV7 Q;  3HKZ G;  4DAY B;  4JV5 L;  4ME3 A;  1G51 A;  1K9M C;  4LFA Q;  4JI8 Q;  2Q2U A;  1BVS A;  3RN2 A;  1E22 A;  1TWG H;  3A0J A;  1X9N A;  2BH8 A;  3L0O A;  1WCM H;  1V1Q A;  2HHH Q;  4QJF A;  1PA6 A;  1YJN A;  3S1R H;  1UEB A;  2JA5 G;  4A3D G;  5IYB G;  1HR0 L;  2UUC L;  1N34 L;  1X6O A;  2QGQ A;  4EQ5 A;  1O7I A;  1SRO A;  3M85 A;  2YU9 H;  2UXD Q;  1PH3 A;  1NMF A;  3PUW A;  4DR6 L;  5E7N A;  4DR3 L;  1VQP A;  1IYJ B;  1UWV A;  3S1N H;  4X64 Q;  4OWX B;  4KHP L;  4DV4 Q;  3AFP A;  1K8A C;  3RZO H;  1VQO A;  4YWL A;  2VQF L;  2UXC Q;  2Z6K A;  2JA7 G;  1S72 A;  3ER0 A;  1HZ9 A;  4JI0 Q;  2JA6 H;  4HIM A;  3U4V A;  1IBL Q;  3S1Q H;  3KF6 B;  4YHH L;  1M90 C;  4IOC A;  1PYS B;  1GO3 E;  2RF4 A;  1HNZ L;  4HJ9 A;  4C3I H;  3GO5 A;  2E2J H;  4DV5 L;  2IT1 A;  4XTC S;  4JC0 A;  3CCE A;  5GAG C;  2UUB Q;  3F2D A;  3T1H L;  2E5L Q;  1JJC B;  2KCM A;  2K50 A;  3UDI A;  1BBU A;  3W1B A;  4APV A;  3GDE A;  2LXK A;  4GOP B;  1T9H A;  2AWN A;  1W2B A;  2NVX H;  2KCT A;  4A3L G;  4JI3 Q;  3S2H H;  2R7D A;  3ULJ A;  4IPD A;  4OWW B;  1J6Q A;  3CF5 A;  3RNU A;  4GN3 B;  1A8V A;  4A93 H;  2AMC B;  4LFB L;  1YZ6 A;  2B29 A;  3K7A H;  4HJ5 A;  2JEA I;  1K83 H;  1SE8 A;  3CD6 A;  4P73 A;  1Y1V H;  4JI8 L;  4LFA L;  3I7F A;  2UU9 Q;  2R92 G;  2VUM H;  2PNH A;  1SN8 A;  2ZJR A;  4A3M H;  1E24 A;  3S17 H;  3E9H A;  3ULL A;  1GVP A;  1CUK A;  2AWO A;  4X65 Q;  4JI6 L;  4B3M Q;  2JK8 A;  5C0X I;  2R7Z G;  1XNQ Q;  1N36 Q;  4R4I A;  2NVY H;  1OXS C;  1VQ7 A;  2XTI A;  2Z0S A;  3F2B A;  3HFZ B;  3RLF A;  2UXB Q;  3CCM A;  3GD7 A;  1R9T H;  2I0Q A;  2E2H H;  3RLN A;  3G4S A;  4PG3 A;  4NXN L;  4PZ7 A;  2ID0 A;  1HNW Q;  1A63 A;  3HOX G;  4DR3 Q;  2EQS A;  4BBS G;  1E1T A;  1YVC A;  5IP7 G;  4HJA A;  4LFC L;  3KDF A;  4C3H H;  1I94 Q;  2VQF Q;  4B3R L;  1VQF A;  4JI1 L;  5IP9 H;  1Z9F A;  1QUQ A;  1CKO A;  1EIF A;  5JJL A;  3Q8D A;  2JA8 H;  3W5O A;  1C0A A;  2VQE L;  1Q1B A;  4HID A;  3HKZ E;  1HR0 W;  4MNO A;  3OTO L;  1XMO L;  3S2D H;  4JOI A;  2OTL A;  4A3I G;  2N3S A;  5IWA L;  2ES2 A;  5IT9 c;  2D62 A;  1SFO H;  3J80 i;  3TQY A;  3CPW A;  5M3M G;  5IYB H;  4DR5 Q;  1HNZ Q;  1ASY A;  4GKJ L;  1WI5 A;  1YJW A;  2JE6 I;  4LF4 L;  3A5Z B;  4GKK L;  3BZK A;  5C0X G;  4DR4 Q;  4JI5 Q;  3H0G H;  1XPR A;  1P16 A;  4A3J G;  2OCE A;  4BBR H;  3TEH B;  1YJ9 A;  1VQG A;  1TWC H;  1OXV A;  2YYZ A;  4O0A A;  3U58 A;  1M1K C;  3U50 C;  4KHZ A;  2QEX A;  4A3F H;  5FJ8 G;  1XMQ L;  2CKZ B;  2DUD A;  4IJL A;  1HNX L;  4QGU A;  3CC7 A;  3ERS X;  1MIU A;  4B3T L;  5C44 G;  5BR8 Q;  1PH9 A;  4JBK A;  4LF5 L;  2NN6 I;  2KBN A;  3EBE A;  5GQO A;  1LYL A;  2D0O A;  2HIV A;  2N8N A;  2NZH A;  2ZJQ A;  4DR7 Q;  4JI7 Q;  2VY3 A;  1G6P A;  2YTV A;  2RHS B;  1XPU A;  4A3D H;  1N33 Q;  3I4M H;  4JI2 Q;  1EQQ A;  4DK3 C;  1IBM L;  1VQ9 A;  1QVC A;  1MJC A;  4MZ9 A;  2VUM G;  3T1Y L;  3PUZ A;  3F1Z A;  4DV6 L;  3E0E A;  1B70 B;  1QZG A;  5IYC G;  1Q46 A;  1PH8 A;  1B8A A;  1L1O B;  4GN5 A;  5C0X J;  1Q86 C;  2HT1 A;  1GM5 A;  2IX1 A;  4B3S L;  1I5F A;  3CCU A;  1K8G A;  2PMZ E;  4GNX B;  2MO1 A;  2ZM6 L;  2BA0 A;  1YBY A;  1Z47 A;  2RHQ B;  2PQA B;  2HQL A;  1OXU A;  2ZJP A;  2F52 A;  1YNX A;  3GTJ H;  3CCS A;  4A3L H;  3PO3 G;  1U0L A;  2AHO B;  4YWK A;  3KDF B;  4A3K H;  4X66 Q;  2CWA A;  3JAM c;  1VQD A;  1XTD A;  1W3S A;  4A3C G;  1N34 Q;  4BA2 I;  5DLQ E;  1C9O A;  3AYH B;  1LTL A;  1FJG L;  3OYY A;  3OTO Q;  1KL9 A;  4DV2 Q;  1XMO Q;  4DV0 L;  1OXT A;  1NJI C;  3JAM i;  3PF5 A;  4JCV E;  1J5E Q;  1XNR Q;  1AE2 A;  4JYA Q;  5GAD C;  5C4X G;  2XGT A;  2ALY B;  1VQ8 A;  1VQE A;  4YY3 Q;  1SR3 A;  1A62 A;  1X3F A;  5FLM G;  3BZC A;  4DV3 Q;  4DR5 L;  2K5H A;  1KD1 C;  4GKJ Q;  4OX9 Q;  4POG A;  5FLM H;  2DGY A;  4UP8 A;  1Y1W G;  1SMX A;  4DV4 L;  4LF4 Q;  1EWI A;  1TWF H;  3KFU A;  1HR0 Q;  1IL2 A;  2OWO A;  2UXC L;  4C3J H;  4DR1 Q;  1Q1E A;  3DLL A;  2KEN A;  3M4O H;  4NPS A;  2R92 H;  1JE5 A;  5LMN Q;  4IFD I;  4YCV A;  1SLJ A;  3D0F A;  1IZ6 A;  2WP8 J;  2A8V A;  1K3R A;  2CWP A;  2R6G A;  3PGZ A;  3UDX A;  4X6A H;  1NMG A;  3CQZ H;  4P75 A;  1NTG A;  4LF6 Q;  2WAQ E;  2OQK A;  3PV0 A;  4B3T Q;  4LF5 Q;  5IY0 A;  1VQI A;  3G71 A;  1PV4 A;  3F8T A;  1Q12 A;  3PUX A;  3H3V I;  4BY7 G;  4JI7 L;  1PVO A;  1JJ2 A;  2JEB I;  3D31 A;  5LMN W;  4ALP A;  3BJU A;  2ZTC A;  1WFQ A;  2Q2I A;  2GVA A;  2WAQ G;  4JI2 L;  3WWV A;  1KIX A;  4DR2 L;  4DV7 L;  1I6H H;  2MO0 A;  5GAE C;  3T1Y Q;  1FGU A;  3EN2 A;  4OXP A;  1HH2 P;  3I2Z A;  4P72 A;  3L2P A;  4NXM Q;  2B3G A;  2CCZ A;  4P74 A;  1WOC A;  4PZ8 A;  4IJH A;  4QIW E;  2A19 A;  2NVT H;  4BBS H;  5HGQ A;  4DV5 Q;  4AYB E;  3FHW A;  4GOP A;  5EAY A;  3J80 c;  1E1O A;  2Z6K C;  3KYH C;  1L1O C;  3HOY H;  5JJI A;  2V1C C;  4GLV B;  5IP7 H;  1PH6 A;  1HZB A;  3FKI G;  3HOY G;  1JT8 A;  4A3I H;  3J7A 5;  3S24 A;  1PH2 A;  2R7F A;  2N78 A;  1VQN A;  2PI2 A;  4R4O A;  4YWM A;  2UXD L;  1KXL A;  2F3I A;  5C44 H;  4DR6 Q;  3H3V H;  4DUY Q;  1N32 L;  3SGI A;  4A3J H;  2LSS A;  1XNR L;  4JI4 L;  1VQB A;  2Y0S G;  2IHE A;  4JYA L;  1HZA A;  1Y1V G;  2GN5 A;  4BBR G;  1UE5 A;  4X62 Q;  1YHB A;  3J81 c;  1K73 C;  1VQ4 A;  2F4V Q;  1L1O A;  3AFQ A;  4X65 L;  1RL2 A;  2WFW A;  3K7U C;  1LUZ A;  4GOP C;  3HOX H; 
#chains in the Genus database with same CATH topology
 4A3G B;  5FLX L;  1ZYR C;  2K14 A;  1N36 L;  4AYB B;  1LTR D;  2KHJ A;  4K2K A;  1H9S B;  2E2I B;  2F0U A;  1EFI D;  2FFK B;  1PTO C;  3DM1 A;  4LWC A;  2P5Z X;  3LWE A;  2HCC A;  3CCQ A;  2F0N A;  1J8I A;  2CH4 A;  4DAV A;  2ZT9 C;  3GTK H;  2C35 B;  3PO2 G;  1AH9 A;  2V4D A;  5IIF A;  4LF7 L;  3STB C;  2F0M A;  3KLS A;  1M8A A;  3VR6 A;  4RH6 A;  4RFB A;  4CDE C;  2OQ0 A;  4A3G G;  1L0X B;  1CKN B;  2F0D A;  4DNI A;  2IX0 A;  4N9T A;  1IXR A;  1VS0 A;  4UPA A;  4RG1 A;  4XT3 B;  1VQH A;  4LW1 A;  1PRT B;  4L5T A;  5T1G A;  3A5U A;  4JI0 L;  1ILP A;  4Y7N B;  4AIM A;  5LMU L;  4KK7 A;  3T53 B;  2WB1 E;  4A93 G;  1QOH A;  4H02 A;  3HOY B;  4LF8 Q;  2HHH L;  4O2D A;  4R4C A;  2VS1 A;  1JOO A;  2CFM A;  4GLA C;  1FL0 A;  2LFN A;  4HMI A;  3T1H Q;  2K32 A;  2B2Y A;  1SNM A;  3UDG A;  2I07 B;  1FVI A;  5G3L D;  3TSS A;  4L5S A;  2WB1 B;  4DV0 Q;  4PZ6 A;  3A74 A;  1EUJ A;  3CC2 A;  1JIC A;  4A3E G;  1TWC B;  2EE1 A;  4H13 C;  2JJQ A;  1QCB D;  3IFT A;  5I9P A;  2UUC Q;  1VF5 C;  4IQZ A;  3GTQ H;  4K8J A;  3VYS A;  3J81 j;  1ONL A;  4KLK A;  1QIL A;  3M4O B;  2XSC A;  4J15 A;  1I4R A;  5LL6 X;  4DR1 L;  2L12 A;  5COY A;  4X64 L;  1MKH A;  5LMN L;  5JVG 3;  2JA7 H;  1VQ6 A;  1I50 H;  1VCI A;  2IY5 B;  4TQU S;  4HIK A;  4K8I A;  1MGS A;  1PFN A;  3EVQ A;  3STB D;  1A3T A;  2EYL A;  3PF4 A;  4OWT B;  1PZI D;  5C4X B;  3FKI H;  4P71 A;  3X3N A;  5M5Y H;  2EY5 A;  2JA5 H;  1PRT C;  4NDX A;  4DU9 A;  1JOR A;  1SNP A;  3CPF A;  4CJ1 B;  1EY5 A;  1V8Q A;  1F9R A;  1E0B A;  2O5J C;  1MD2 D;  1EY8 A;  2K4K A;  4ABN A;  2E2I H;  4UP7 A;  1RDP D;  2BCO A;  2BH2 A;  1Y14 B;  2Q8T A;  3DUZ A;  5DM6 3;  2EJF C;  1J5E L;  2MFI A;  4PQX A;  2VZA A;  3U9O A;  3HG9 A;  3A7A B;  2FMM A;  4LUV A;  1X56 A;  3GTO H;  3ONA B;  1ICF B;  3HKZ B;  1L0Y B;  1B4O A;  3M9B A;  1CK1 A;  3ULP A;  4R4T A;  4B3M L;  1TWH H;  1WTV A;  3PO3 B;  4A76 A;  2JA8 B;  5EKI A;  1RJT A;  4RWS C;  3HOZ H;  3SK6 A;  4QF4 A;  3CU7 A;  4A3E H;  3OHX C;  4A3C H;  4PMW A;  3FP9 A;  1EYA A;  1HCZ A;  3BYY B;  2N49 A;  1I94 L;  1GUT A;  3T56 B;  5J3B A;  1STY A;  3GTM H;  4DV1 L;  1K3B C;  1WD1 A;  1DD2 A;  5IGB A;  4RA8 A;  4AQY L;  3MXN B;  3PCO B;  4QY7 A;  4A3B H;  1H9K A;  3H6M A;  4C1N K;  5EKL A;  2OTJ A;  5C4Z A;  1UE6 A;  3QOJ A;  4DXG A;  4C56 C;  4O1N A;  2GA4 B;  1GXD C;  4BBS B;  2K52 A;  5CV9 A;  1WVL A;  1WD0 A;  2A69 D;  3VDY A;  4BS9 A;  2MNA A;  5M3F H;  3AQQ A;  1N9W A;  1NR4 A;  4ID6 A;  2R61 A;  3I70 A;  1XXG A;  2Y0S E;  3V96 A;  3I4O A;  1OO9 B;  3I3C A;  1OTC A;  2AKW B;  2YTX A;  4JG2 A;  1QE6 A;  5JPM C;  1A2T A;  1DZ1 A;  2B2W A;  2A69 C;  5IOC A;  1WTW A;  2ICE C;  4ZKC B;  4LF9 L;  3T4A C;  1V43 A;  1E3P A;  5C44 B;  4X3U A;  4ME3 A;  1K9M C;  2Q2U A;  2DNE A;  1BVS A;  3OIQ A;  1E22 A;  4HAE A;  2KCN A;  3A0J A;  1X9N A;  1G2T A;  2BH8 A;  2BE5 D;  1BNZ A;  1CA6 A;  1LTG D;  3HZX A;  4A3D G;  3VA5 A;  1HR0 L;  2PMZ B;  2H1E A;  4CBV A;  2QGQ A;  4EQ5 A;  2SEB D;  1TWF B;  1YNN C;  3JAM L;  1SRO A;  3M85 A;  3GTP B;  2YU9 H;  4C3H G;  2UXD Q;  4DR6 L;  5E7N A;  1IYJ B;  1RD9 D;  3QOL A;  4DV4 Q;  3AFP A;  2UXC Q;  1SYC A;  4KJO A;  1HZ9 A;  2M2L A;  4F8M A;  3U4V A;  3TP5 A;  2QIL A;  3CQZ B;  4C3I H;  4HTH A;  3GO5 A;  1K8O A;  1AZP A;  3CCE A;  3SXH A;  2K50 A;  3UDI A;  3GDE A;  1DOK A;  1T9H A;  3LWU A;  2KCT A;  3N52 A;  1GHJ A;  4KJN A;  1CA5 A;  4LK1 C;  1FYC A;  3TBI B;  1RTO A;  4GN3 B;  1BDO A;  1A3V A;  1YZ6 A;  2B29 A;  5IGC A;  1BBX C;  4LFA L;  3I7F A;  5J1Z A;  2KED A;  1SE4 A;  5I2Y A;  2R92 G;  2K33 A;  3ULL A;  4JI6 L;  4X65 Q;  2DY8 A;  2X6L A;  2JK8 A;  5C0X I;  2Y0S B;  1WTP A;  3NPP A;  3F2B A;  3HFZ B;  2D5D A;  1PZJ D;  3GD7 A;  3G4S A;  3MFY A;  2K05 A;  3HOX G;  4DR3 Q;  2RQX A;  4L8J A;  2F3V A;  2M9V A;  3BDC A;  5BN3 A;  1SMY C;  2EYP A;  2PQE A;  1CKO A;  1EIF A;  2JA8 H;  3W5O A;  3J80 L;  2VQE L;  3HOU B;  3OTO L;  3MZ5 A;  4IZ8 A;  1J9O A;  2SDF A;  1SAP A;  4A3I G;  3A55 A;  2AQ2 B;  5IWA L;  5IT9 c;  1SFO H;  3H3V C;  4N9P A;  5IYB H;  3S14 B;  1YJW A;  4LF4 L;  4KN4 C;  4FXD A;  4GKK L;  1W6J A;  3BZK A;  3H0G H;  1KTK A;  2ENB A;  2RSN A;  2EZV A;  5LL6 S;  1TWC H;  2YYZ A;  1Y1V B;  3AB9 A;  3U50 C;  4KHZ A;  5EJW A;  2QEX A;  5FJ8 G;  4KY7 A;  3S17 B;  3OSO A;  1D1I A;  5C44 G;  4HCE A;  5I6Y A;  2D0O A;  2HIV A;  1SYF A;  1PZK D;  2ZJQ A;  2NWG A;  3E3X A;  2VXW A;  1EY6 A;  1A3U A;  1EY0 A;  1EQQ A;  1IBM L;  1GUS A;  1QVC A;  4MZ9 A;  2VUM G;  2E2H B;  3F1Z A;  3MFG A;  1TS3 A;  1T5X D;  1I5F A;  4ME5 A;  1NAP A;  1B1Z A;  2FMC A;  2CVR A;  1S5B D;  2AHO B;  2F1M A;  3KDF B;  4X66 Q;  2CWA A;  1BCP F;  3JAM c;  5J39 A;  3MAQ A;  4IUQ A;  4KV6 A;  3OMC A;  4CDD C;  1FJG L;  1XMO Q;  5E1F A;  1ML0 D;  4DV0 L;  1OXT A;  3ERO A;  1J5E Q;  4JCV E;  1AE2 A;  5GAD C;  2XGT A;  2ALY B;  2NUC A;  1VQE A;  2A68 C;  1SR3 A;  4DR5 L;  4GKJ Q;  4ILW A;  5FLM H;  2DGY A;  2A73 B;  1B3Q A;  4L6T B;  2NZ1 D;  3MVV A;  4DR1 Q;  3DLL A;  2KEN A;  4WFN 3;  3O13 A;  5LMN Q;  4YCV A;  4IFD I;  1SLJ A;  2O2L D;  2WP8 J;  1K3R A;  4X6A H;  1VDZ A;  4P75 A;  3ND9 A;  2XVS A;  2WAQ E;  3PV0 A;  4LF5 Q;  2FIN B;  3S9W A;  1VQI A;  1TY2 A;  3F8T A;  1Q12 A;  1SNC A;  4BY7 G;  2LKV A;  3EA6 A;  4IUN A;  2CQA A;  4XT1 B;  1JJ2 A;  3D31 A;  4ALP A;  2B2T C;  3A7L A;  2GVA A;  4KKU A;  1ENF A;  4DR2 L;  2MO0 A;  4GZY C;  5ELE A;  5ELD A;  2EVB A;  3BVZ A;  3BVM A;  4IJH A;  4RCN A;  4DV5 Q;  1F2Y A;  1V1P A;  4AYB E;  4GOP A;  2Z6K C;  3KYH C;  1L1O C;  2V1C C;  2E75 C;  5IP7 H;  1PH2 A;  1STH A;  1ET6 A;  1KXL A;  5C44 H;  3NSW A;  5CYU A;  4A3J H;  2HCI A;  2Y0S G;  4JYA L;  2GN5 A;  3CKI B;  4A3F B;  4X62 Q;  1K73 C;  3AFQ A;  2K28 A;  2WFW A;  5IT9 L;  5I9O A;  1MSG A;  1LUZ A;  1CSP A;  2Z6B A;  1U9R A;  5JEA H;  2LY7 A;  4JI1 Q;  3U4Z A;  3BS1 A;  4K14 A;  3CC4 A;  3C1E A;  3K5L A;  1LT6 D;  2MUY A;  3CMA A;  2NBF A;  4BXX H;  4KMU C;  3CCL A;  3J7Z C;  4DV1 Q;  3DWA A;  5JVH 3;  4OO1 I;  2YV5 A;  1KAA A;  4AQY Q;  1SJH D;  4R9W A;  2IWH A;  2L9H A;  5AJ3 L;  4DR4 L;  5JJK A;  1S5C D;  1KAW A;  1EQR A;  1TS2 A;  5IGG A;  1AP0 A;  1Q7Y C;  1F77 A;  2WB1 G;  2JA9 A;  2CHB D;  1Q8I A;  2VL6 A;  1CZW A;  4FP5 D;  3RMH A;  1MI2 A;  3QO2 A;  1PYW D;  3VR3 A;  3UE0 A;  1NNX A;  4LJZ C;  4UDU C;  4DAM A;  1N33 L;  2L1B A;  1IHZ A;  4DUY L;  4DXF A;  1QVG A;  2F03 A;  2EYH A;  5DNF A;  5IT9 E;  2QA4 A;  3I4M G;  1QWY A;  5M5X B;  1EIH A;  4IO9 A;  4A3D B;  4G4K A;  5C4X H;  3VYU A;  1S5F D;  3K0X A;  2BE5 C;  3DWP A;  3TRE A;  3IFD A;  4LF9 Q;  1JWM D;  2ZTD A;  1WTQ A;  4RKB A;  1TWH B;  1XYI A;  3R8B A;  4IFD J;  4BXX G;  3G6E A;  4B3S Q;  2TMP A;  2ATW A;  3SR1 A;  4ZLT F;  3H91 A;  2KHI A;  4XYO A;  3D4R A;  2F0H A;  3EIV A;  1S40 A;  4DV3 L;  2NTS A;  4I65 A;  4DAY A;  1TY0 A;  5DM7 3;  4LF7 Q;  5A2Q L;  1LAC A;  1SE3 A;  1IBL L;  4J6H A;  3K8A A;  5ELN A;  1B3A A;  5I2X A;  5BR8 L;  4DF7 A;  3R93 A;  5AFW A;  2UUB L;  3B6Y A;  4AYB G;  1TR5 A;  3AMU A;  2NVQ B;  1OXX K;  1VMC A;  1Y69 U;  2A1A A;  3UDF A;  1DON A;  3L7Z C;  2VQE Q;  1N8R C;  1I3Q H;  5FO7 B;  2F0S A;  4LAA A;  1TVX A;  5LMU Q;  2JQO A;  4MTN A;  1Q81 C;  4J1M A;  3K5N A;  3M3Y H;  1GUW A;  3OW2 A;  4NXM L;  3D8G A;  1CSQ A;  1BKB A;  5C3X A;  1YHQ A;  4UP9 A;  4K0K Q;  2EY1 A;  3CCJ A;  1SFO B;  2B63 B;  1Q8K A;  1G8Z D;  1VQL A;  4QMG A;  1GOZ A;  1VQJ A;  3NBI A;  1ASZ A;  1V1O A;  3IAY A;  4OX9 L;  5E4X A;  1TXY A;  4LFC Q;  2EYF A;  4IFD G;  1BQQ T;  1L0W A;  1EZ6 A;  2R93 G;  3FEW X;  3NWS A;  2NZO A;  4GN4 B;  5FLX c;  3T51 B;  3NHH A;  1SMY D;  5M5W B;  3I4N G;  4JV5 Q;  3C1F A;  3GV6 A;  1DJR D;  2E74 C;  4JBW A;  3K81 C;  3VYR A;  3KF8 B;  3TS0 A;  1SYD A;  2X69 A;  2PNR C;  1PHJ A;  1STB A;  3C2P A;  4NKL A;  4WJ3 M;  4PMB A;  3KJO A;  4M1U B;  3NEM A;  3S1N B;  4HCS A;  3QR8 A;  2OF1 A;  3I72 A;  2DY7 A;  1Y8P B;  4KTA A;  3HOV G;  4DNR B;  2GVB A;  3Q6S A;  4UY8 C;  1AEX A;  1SND A;  2EJM A;  4YCW A;  4RGO S;  3CAM A;  1TII D;  2MPM A;  3SHL A;  3K59 A;  2NN6 H;  4OEM B;  1VQK A;  1Q82 C;  1WJJ A;  1V9P A;  5K5P A;  3WOF A;  2NN6 G;  2PZW A;  2BDO A;  3DEP A;  1O7L A;  2A68 D;  2Q8I B;  2D9U A;  2Z4H A;  3PIP 3;  3GTG H;  3NK9 A;  4WJ4 A;  1V1P B;  5CC4 A;  1C4Q A;  1H9M A;  1YI2 A;  3HEJ A;  3TME A;  2R7Z B;  3NE5 B;  4GNX A;  1HHV A;  4HJ8 A;  5JEA J;  2A5H A;  4JI3 L;  1LTT D;  4GLX A;  1B44 D;  2R93 B;  1SBB B;  1PFS A;  4QCL A;  3F2C A;  1B50 A;  2KEE A;  4DAY B;  1G51 A;  2J0T D;  4JI8 Q;  3J7A F;  3RN2 A;  1SYE A;  2F0J A;  4QJF A;  1UEB A;  1X6O A;  5EPL A;  1FD7 D;  1O7I A;  1PH3 A;  1I6H B;  1HQR D;  3S1N H;  3MXG A;  1K8A C;  3RZO H;  3P20 A;  1VQO A;  4XQN A;  4NP5 A;  2VQF L;  4A3J B;  3FPP A;  4F87 A;  3ER0 A;  4CDF C;  4H7B A;  3NTH A;  4RAU C;  3M3Y B;  4HJ9 A;  2R3Z A;  3D4D A;  1EYC A;  2F0K A;  2IT1 A;  4FF3 A;  2G9H D;  1HTL D;  4V0B A;  2AUJ D;  1JJC B;  2KCM A;  1UAP A;  1W2B A;  2AWN A;  2Z8L A;  3I4L A;  3S2H H;  4IPD A;  5FO9 B;  1EY9 A;  1NUC A;  1A8V A;  4A93 H;  2AMC B;  3FVQ A;  3L9A X;  3CD6 A;  1EY4 A;  1ZYR D;  3H94 A;  2PW7 A;  2VUM H;  4FO2 A;  1IL8 A;  2PNH A;  1SN8 A;  1ZXT A;  1PFM A;  4A3M H;  4QUC A;  3BYT B;  2AWO A;  5TSS A;  5IGF A;  2QDL A;  2XN9 C;  1HRJ A;  1N36 Q;  3KF8 A;  2ZXO A;  3GTJ B;  5L37 A;  1S5D D;  1LT4 D;  1STN A;  2UXB Q;  2I0Q A;  4PV1 C;  1DCZ A;  4PZ7 A;  2ID0 A;  5E4W C;  5EQ0 A;  4OGQ C;  3SDZ A;  2RSO A;  3KDF A;  1HFG A;  4C3H H;  4JI1 L;  5IP9 H;  5JJL A;  1Y8O B;  1PRT F;  1Q1B A;  3RUZ A;  5A35 A;  2JP1 A;  2L55 A;  1EEI D;  3S2D H;  2N3S A;  5CV4 A;  3CPW A;  3J81 L;  2JE6 I;  3A5Z B;  3W2D A;  4DR4 Q;  3DWQ A;  4JI5 Q;  3J80 E;  2B8F A;  4JVZ A;  2OCE A;  2K01 A;  1BCP B;  1BOS A;  3TEH B;  1YJ9 A;  4O0A A;  1TU2 B;  1LLR D;  5M9O A;  4E6I A;  4QGU A;  3ERS X;  3CC7 A;  2B2U A;  1MIU A;  4B3T L;  5BR8 Q;  4EQP A;  2KBN A;  3EBE A;  1IYV A;  2YU9 B;  2F0L A;  2NZH A;  4EQN A;  4JI7 Q;  3V05 A;  2VY3 A;  3FPU B;  1G6P A;  2RHS B;  3SEB A;  1N33 Q;  4JI2 Q;  4DK3 C;  2A6E C;  1VQ9 A;  1B70 B;  2SOB A;  1T5E A;  3SK8 A;  3EQL C;  3QB3 A;  3HRZ C;  2IX1 A;  1M4V A;  3QWN A;  2PMZ E;  2HD3 A;  3K0Y A;  2HQL A;  2EYJ A;  3DMU A;  2F52 A;  1YNX A;  3GTJ H;  2ZJP A;  5HUR A;  3CCS A;  1U0L A;  4YWK A;  2Z9H A;  4CJ0 B;  4XQJ A;  1W6K A;  1N34 Q;  5DLQ E;  1SEB D;  4ZKB B;  4Q5V A;  3OTO Q;  4TSS A;  3GQB A;  1XNR Q;  3JAM i;  3PF5 A;  2QF7 A;  1ESF A;  1KD1 C;  1X3F A;  1LT5 D;  3BZC A;  4DV3 Q;  4K5V A;  4OX9 Q;  1E2Z A;  1SXT A;  2BOS A;  5M3F B;  4LF4 Q;  1IL2 A;  2OWO A;  4A3I B;  4C3J H;  2K1B A;  2O4X A;  4I7Z C;  4C3J G;  2LS0 1;  1NCV A;  1X3Q A;  2A8V A;  2R6G A;  4ZK9 B;  3UDX A;  1NMG A;  3CQZ H;  5DEH A;  1NTG A;  4LF6 Q;  4YIJ A;  1EU4 A;  3T16 A;  5IY0 A;  1PV4 A;  3G71 A;  2NB0 A;  3H3V I;  5JOB A;  1PVO A;  2WAQ G;  3X3M A;  3K5O A;  1EIG A;  1FGU A;  3EN2 A;  3I2Z A;  2DJG C;  4BY1 B;  2O5I C;  4NXM Q;  1BR9 A;  2B3G A;  4BBS H;  4PZ8 A;  4FXG C;  2A19 A;  1JE4 A;  5EAY A;  1E1O A;  1II3 A;  5ELC A;  5JJI A;  1JT8 A;  3FKI G;  4A3I H;  2WIN B;  5C5L A;  2F3I A;  3H3V H;  5D14 A;  1HZA A;  3Q23 A;  1YHB A;  2N55 A;  2VUM B;  4ODG A;  3HOX H;  4A3M G;  3SK4 A;  5I4D A;  2R7Z H;  4BA1 I;  2EOT A;  5BN5 A;  3I8Z A;  2VW9 A;  4J8Q A;  4OEL B;  3CW2 C;  3U9S A;  1F2M A;  3NEN A;  1X3E A;  5KRU A;  1F2L A;  4NXN Q;  2RDF A;  3FRP B;  2MJ8 A;  2AQ3 B;  2Z4I A;  4POF A;  4A75 A;  3IL8 A;  1BBW A;  2JA6 G;  5IYD G;  3IRB A;  4U68 A;  1IKL A;  1SNO A;  4C3H B;  2C5C A;  1PH5 A;  5IP9 G;  5D3I B;  4KI0 A;  5C3E H;  1IBK L;  1JMC A;  1K0R A;  1X65 A;  1LT3 D;  2FXQ A;  4CKC A;  3M4Q A;  1JWS D;  3IKJ A;  1HNX Q;  3HOZ G;  4LUO A;  2JA7 B;  3I4N H;  4LUZ A;  2L15 A;  3UE1 A;  1B7Y B;  3CHB D;  1E7Z A;  2D2C C;  3QJY A;  4K5W A;  1I3Q B;  3NP8 A;  1XPO A;  1Y1W H;  3LGJ A;  4JBM A;  1VF7 A;  3W3A A;  2I5L X;  1XMQ Q;  1NE3 A;  4BWG B;  2LMC B;  2KA7 A;  4OO1 G;  1UUP A;  2WAC A;  3NEL A;  3H15 A;  1FNW A;  4XIG S;  2JA5 B;  1S4Z A;  2ASB A;  4ZUJ A;  2K5V A;  4A3B G;  2E2D C;  3S15 B;  1I50 B;  5JEA G;  2K5D A;  5ELF A;  5K36 G;  3A54 A;  2J4X A;  1JR0 D;  2WAQ B;  4HN7 A;  3CCR A;  1DOL A;  1HZC A;  1X55 A;  4XXE A;  1UE7 A;  4L5Q A;  4A3K B;  5KGU A;  3NXW A;  4YCU A;  5EBC A;  2J7Z A;  1EIY B;  3P7J A;  5IYC H;  2UUA Q;  1U5K A;  5CV7 A;  4OHJ A;  1TWA H;  4R4Q A;  4DV2 L;  1CKM A;  1MHW C;  4ZQ3 A;  3AEV A;  1PLF A;  2EYM A;  4DUZ L;  2JXM B;  3H0G G;  5M3M H;  1VQM A;  5EBD A;  1JJG A;  5GRO A;  2B2V C;  5JPN C;  3M7G A;  5HGT A;  4FVM A;  3HOW G;  4K2L A;  4O42 A;  4BBR B;  5K36 H;  4JOI C;  2ZM6 Q;  2IX3 A;  2PW5 A;  3MWY W;  5IGD A;  5KYL A;  5T1I A;  1B9N A;  1QVF A;  4AH6 A;  1CT1 D;  1VQA A;  5M3F G;  5FOB B;  3MC0 B;  3ICE A;  3PUV A;  3VYT A;  4JI6 Q;  1QNK A;  3NTI A;  1YHA A;  1CZG A;  4DKA C;  3K5M A;  1KQS A;  1GKH A;  5EGT A;  3S2D B;  2I5H A;  3TP8 A;  3S1M H;  3C46 A;  1N32 Q;  3S15 H;  1Q3L A;  1X54 A;  1X32 A;  3DHQ A;  5JJZ A;  2KOL A;  2Q2H A;  3W1G A;  4IAL A;  1DYQ A;  4ZAI A;  1KLU D;  1WTX A;  2HIX A;  3NTK A;  3OW7 A;  4QL5 A;  3BG3 A;  3HKS A;  5C6A A;  1R9T B;  4LNQ A;  3HOV B;  4JI4 Q;  4GNX C;  1PH1 A;  4GKK Q;  4Y52 H;  3KOJ A;  3KJP A;  1EYG A;  1WCM G;  1H9J A;  5C4J H;  1BCP C;  2EY6 A;  1D7Q A;  4IPH A;  2Q2T A;  2PO4 A;  1HXY D;  5C3W A;  2DNC A;  3I56 A;  3GTP H;  4HSV A;  4KHP Q;  3GTL H;  1CM9 A;  3I55 A;  4JI5 L;  2K7V A;  3TZU A;  2QKI C;  5COR A;  1GD7 A;  2PI2 E;  1IBM Q;  1HA6 A;  3CRL C;  2VNU D;  1B53 A;  1Y1W B;  4K0K L;  4MN3 A;  4X3K A;  4RGM A;  2XWJ B;  4U67 3;  3NUC A;  5ISR A;  5KNB A;  3PUY A;  4JBJ A;  2MHV A;  5C3E G;  2OXP A;  4OON A;  1RCV D;  2E8G A;  4LF6 L;  2C9O A;  2B63 G;  2N88 A;  1RIP A;  2XRS D;  2K75 A;  1KRS A;  2Z1C A;  4X66 L;  3CCV A;  1BF4 A;  1AFP A;  4DAP A;  1P8L A;  4G7O C;  4A93 B;  4I7A A;  2JA8 G;  2ICI A;  2L11 A;  2IHF A;  1FJG Q;  3QG1 A;  3TP7 A;  4A4I A;  3HKZ G;  4JV5 L;  2PYK A;  1CHP D;  3NWT A;  2CW0 C;  1HUM A;  3L0O A;  1WCM H;  1V1Q A;  2HHH Q;  5CR3 A;  1PA6 A;  3KUP A;  2EPB A;  1AN8 A;  1N34 L;  2QDB A;  1PTO F;  4CDC C;  3MXP A;  1VQP A;  1UWV A;  4F7X A;  1JB3 A;  4FXK C;  1ILQ A;  1EY7 A;  4X3T A;  3CRK C;  2RDH A;  4YWL A;  2Z6K A;  3J7A V;  1S72 A;  1BCP D;  1ENC A;  1QNU A;  2K04 A;  1IYU A;  5E3F A;  5KYI A;  3S1Q H;  3KF6 B;  4B9X A;  1PYS B;  1GO3 E;  1F2Z A;  2RF4 A;  1GUN A;  1HNZ L;  4B9W A;  2E2J H;  4DV5 L;  4HR7 B;  3ERQ A;  4C3I G;  3GTL B;  1FNV A;  2E5L Q;  1TWG B;  4ZYS A;  3PO3 H;  3W1B A;  4GOP B;  4APV A;  2LXK A;  2K5Q A;  2RBM A;  4JI3 Q;  2A6H C;  3ULJ A;  4IFD H;  3TZD A;  4OWW B;  1C48 A;  3CF5 A;  1IW7 C;  3MA2 B;  4LFB L;  3K7A H;  1VMP A;  4HJ5 A;  3ND8 A;  1I4P A;  1RHP A;  1Y1V H;  3L3O C;  4JI8 L;  2UU9 Q;  1BUV T;  1E24 A;  1GVP A;  2B39 A;  2A6H D;  1EZ8 A;  3OOC A;  2R7Z G;  3E0J A;  2NVY H;  1VQ7 A;  2XTI A;  1TQO A;  4FYD A;  1EU3 A;  2OT2 A;  4RHS A;  3RLF A;  2VB2 X;  1R9T H;  2E76 C;  4Q0F A;  3RLN A;  3AU7 A;  3E5S A;  1HNW Q;  3UI2 A;  4PMC A;  2RCF A;  5IP7 G;  4DK0 A;  3URY A;  4HJA A;  1PMR A;  2VQF Q;  3NBH A;  1Z9F A;  2CW0 D;  2MGS A;  2KVM A;  5FO8 B;  4HID A;  1HR0 W;  4UAI A;  4JOI A;  2OTL A;  5KIX A;  3I90 A;  5FK9 C;  3SE0 A;  2FHT A;  1G91 A;  5C0X G;  2EJG C;  3RZD B;  4TKO B;  1XPR A;  1P16 A;  5C0X H;  2WKD A;  1SDF A;  4BBR H;  1OXV A;  1PTO B;  1M1K C;  1PDQ A;  4IJL A;  1HNX L;  3V2T A;  1PH9 A;  2NN6 I;  1JCK B;  5GQO A;  1LYL A;  4DR7 Q;  2K6A A;  3GTO B;  3A56 A;  1XPU A;  4A3D H;  1EOT A;  3I4M H;  2G5D A;  1MJC A;  3T1Y L;  4DV6 L;  3E0E A;  3K58 A;  5IYC G;  1B8A A;  1L1O B;  1I4G A;  5IGE A;  1WTH A;  1Q86 C;  3GTK B;  2QCP X;  4B3S L;  3BDO A;  1LAB A;  2OEO A;  2MP1 A;  2MO1 A;  2ZM6 L;  2BA0 A;  1YBY A;  1Z47 A;  2JN4 A;  4QB4 A;  4A3L H;  1E2W A;  3S1Q B;  1CFM A;  2F0G A;  2PZU A;  5C5M A;  3MXU A;  4BY7 B;  1VQD A;  2KJX A;  1XTD A;  4A3C G;  2EXZ A;  4BA2 I;  1KL9 A;  1NJI C;  3TN2 A;  5C3E B;  4WJW A;  1VQ8 A;  4N8X 1;  3DXJ C;  5A2Q E;  3JAM E;  2K5H A;  4KHV A;  4UP8 A;  1PTO D;  1SMX A;  1Y1W G;  1WCM B;  5EPJ A;  1TWF H;  3KFU A;  3PMF A;  1HR0 Q;  1O78 A;  2XRQ D;  3M4Y A;  3VR4 A;  3M4O H;  4NPS A;  3Q0A A;  2NYZ D;  1IZ6 A;  2CWP A;  2OQK A;  4B3T Q;  1LTB D;  1KDB A;  1D2B A;  3R2I A;  3PUX A;  4FF1 A;  4JI7 L;  4F88 A;  2DJF C;  4KD4 A;  2JEB I;  4NW2 A;  5LMN W;  3S16 B;  4H0L C;  3BJU A;  2ZTC A;  1HUN A;  4JI2 L;  3WWV A;  1KIX A;  1TKW B;  4X3S A;  4DV7 L;  5DAU A;  5GAE C;  4QUF A;  4OXP A;  4P72 A;  4QIW E;  1DM0 B;  2NVT H;  4RCO A;  3DEO A;  3J80 c;  1KDA A;  2RVL A;  5D65 A;  3ZYY X;  2IPK D;  1EQV A;  1ZKO A;  3I4M B;  2B2V A;  3J7A 5;  2XNA C;  2N78 A;  1VQN A;  2PI2 A;  3P1H A;  1STG A;  1N32 L;  3D6C A;  2HDM A;  2LSS A;  1F9P A;  1XNR L;  1VQB A;  2IHE A;  1MSH A;  2HQE A;  1Y1V G;  4BBR G;  1A6X A;  4IUV A;  1D5Z C;  1UEA B;  1SE2 A;  3HOW B;  2L0C A;  2M00 A;  4X65 L;  2B8G A;  3OIP A;  5FJ8 H;  3HOV H;  4BY7 H;  2EXD A;  1QG7 A;  3H0G B;  3E9I A;  1LO5 D;  4YHH Q;  1WTO A;  4B3R Q;  3K6O A;  2BA1 A;  4FDB A;  1ET9 A;  3TS2 A;  2YTY A;  3A8I E;  4IUP A;  1HTP A;  2NVT B;  1IKM A;  3HOU G;  4HMJ A;  4RGN A;  3PSI A;  2WII B;  3RLO A;  4C3I B;  1Q90 A;  1U4L A;  3HOU H;  1DXM A;  5CV8 A;  1LV9 A;  1RTN A;  1VQ5 A;  1D1K A;  1NBW A;  4BY1 H;  1BXT A;  1MJE A;  1PH4 A;  5M3M B;  2R93 H;  5ELO A;  1AZQ A;  3HOX B;  4WRD A;  5GAH C;  1A2U A;  1L2F A;  5IWA Q;  1C7Y A;  1S3O A;  4EX5 A;  1WYD A;  3S16 H;  1FNU A;  4IPG A;  4QQB X;  1XNQ L;  4A3F G;  4EQO A;  2D0P A;  3WOE A;  1KC8 C;  1AE3 A;  3G48 A;  3CME A;  1K28 A;  1NY4 A;  3RZD H;  3I91 A;  4DK6 C;  2KHS A;  3S14 H;  1H9R A;  4HED A;  1H95 A;  4IOA A;  1XWE A;  3S1R B;  1K83 B;  1UE1 A;  3HS0 C;  4DK1 A;  2H4O A;  1XTC D;  1Z6H A;  2WV6 D;  1SJE D;  2ZTE A;  2PCF B;  3RR5 A;  2E5L L;  2PQA A;  4A3B B;  4ZCK A;  2CQO A;  5IE8 A;  1O80 A;  2X6G A;  3S1M B;  2H5X A;  3RN5 A;  3PIO A;  3R2T A;  5LHY 1;  2IL8 A;  2B63 H;  3JC6 6;  4NMZ A;  4RMF A;  4LFB Q;  1SSO A;  4M8A A;  5CV6 A;  3NBH B;  3VR5 A;  2WKC A;  4IUR A;  4FF2 A;  5F2D A;  2F4I A;  1A0I A;  1JOQ A;  2JA6 B;  2F0W A;  3NQT A;  4KN7 C;  2PPB C;  1JWU D;  1JB7 A;  1STE A;  1DGS A;  5C4H A;  3Q24 A;  1ESR A;  1TS4 A;  3HOZ B;  1QUQ B;  2KCC A;  2ZXR A;  1GUO A;  1R4P B;  1IBK Q;  1KAB A;  1ROD A;  2I5M X;  2F3W A;  4GS3 A;  5KEE A;  4K6L A;  4KY6 A;  1HNW L;  1CKN A;  1RF2 D;  5I6W A;  5D3D A;  1CQF A;  2MQH A;  1X3G A;  3GV3 A;  3KF6 A;  4CGY B;  3VA7 A;  1PTO H;  5H1S E;  4JK1 C;  1D5M C;  1D6E C;  3MEH A;  1YIJ A;  1EOV A;  2RKS A;  3MEF A;  4NB3 A;  4OIJ A;  2KEC A;  1CHQ D;  4KKT A;  3T13 A;  1LM0 A;  1JOK A;  4Y7N H;  1FR3 A;  1KLG D;  3BVG A;  4A3M B;  2AUK A;  4L63 B;  4HIO A;  3NQI A;  3KBG A;  1YIT A;  1G2S A;  3J81 i;  3OWF A;  2QEJ C;  4DR2 Q;  3R3O A;  5CBA E;  2UXB L;  4R1J A;  2UU9 L;  2NVQ H;  2RCN A;  4YY3 L;  1PYB A;  2F0T A;  2A74 C;  5NUC A;  2EIF A;  4HSP A;  4XDX A;  4WOR A;  1KHI A;  4L5R C;  4FF4 A;  1TWA B;  4OIK A;  2F4V L;  3N6R A;  4CKB A;  1Y8N B;  2K5N A;  4OO1 H;  1EFW A;  2UUA L;  1SNQ A;  1GHK A;  2B2W C;  4UHV A;  5CBE E;  4BY1 G;  1KRT A;  4A3G H;  1H9S A;  4C2M H;  1K0S A;  2LXJ A;  1PH7 A;  1F9Q A;  3ZJY C;  4LMQ D;  5KND A;  4X62 L;  4DUZ Q;  4DPG A;  1U4P A;  1G29 1;  4HJ7 A;  3PIP A;  3HOW H;  1QB5 D;  1CI3 M;  2HDL A;  3BU2 A;  1QZH A;  3K80 C;  3KLS X;  3J81 E;  3P75 A;  3ITP A;  3PO2 H;  1I4X A;  2PZT A;  1VQC A;  5IYD H;  2A6E D;  5HY6 A;  1X3P A;  1B9M A;  3KLW A;  4JW0 A;  5M5X H;  4KD3 A;  1R4Q B;  1YEZ A;  5M5W H;  3PIO 3;  5ELB A;  2EDG A;  3S2H B;  3K57 A;  3PQI A;  1ZEQ X;  2NVX B;  2TSS A;  3G6J B;  1O7Z A;  4H44 C;  3SK5 A;  1CQV A;  5AJ3 Q;  4IPC A;  4EVO A;  4TVA B;  3DM3 A;  3KBX A;  2K5W A;  4DNT B;  2B2U C;  4DR7 L;  1SRU A;  1XX8 A;  3F2U A;  1E2V A;  4LF8 L;  3M7N A;  3CP0 A;  1HJP A;  3CXC A;  4A3K G;  4ULL A;  4DV6 Q;  3C3L A;  3M4P A;  1U4R A;  2IJ0 A;  1D8L A;  5IOD A;  3TRZ A;  3RZO B;  1XJV A;  4DV7 Q;  4CHT B;  4LFA Q;  3TP6 A;  4DA2 A;  4R8N A;  1TWG H;  4MHE A;  2E2J B;  4R8I A;  4MTK A;  1YJN A;  3S1R H;  5FLX E;  2JA5 G;  2NTT A;  2F0Q A;  5IYB G;  2R92 B;  2UUC L;  1EWH A;  2VB3 X;  1HQM C;  1JQY D;  3E6Z X;  2CH4 W;  2AQ1 B;  1NMF A;  1TS5 A;  3PUW A;  4DR3 L;  4S3S A;  4X64 Q;  4OWX B;  4KHP L;  3D4W A;  2JA7 G;  1MBY A;  3MXN A;  3SVM A;  1I4H A;  1QJO A;  3GTG B;  2XWB B;  4JI0 Q;  2JA6 H;  2F0V A;  3A8K E;  4HIM A;  1IBL Q;  3HP3 A;  4YHH L;  1M90 C;  4IOC A;  4IUU A;  1TT2 A;  3G7L A;  3LNN A;  4FNF A;  1ENA A;  1EYD A;  4XTC S;  4JC0 A;  3A8J E;  5GAG C;  2UUB Q;  3F2D A;  3T1H L;  2ZXP A;  1BBU A;  1EL0 A;  4CKE A;  2NVX H;  3J7Y W;  4A3L G;  4ZRZ A;  2R7D A;  4DFA A;  1KNA A;  5BN4 A;  2BDN A;  1J6Q A;  3RNU A;  1RKN A;  2EY2 A;  1S5E D;  1SYB A;  2JEA I;  2F0I A;  1K83 H;  1SE8 A;  4P73 A;  5C4J B;  4IUT A;  1BO0 A;  2ZJR A;  2F0P A;  3S17 H;  3E9H A;  4KKS A;  1CUK A;  4B3M Q;  2L4N A;  5FKA C;  1KDC A;  1XNQ Q;  4N8F A;  4R4I A;  4QIW B;  1OXS C;  2Z0S A;  1I6V C;  2B2Y C;  4ZUI A;  4DGZ A;  4JPB W;  3CCM A;  2E2H H;  2B2T A;  4PG3 A;  5EKK A;  4P2C B;  4NXN L;  5M5Y B;  1A63 A;  2RA4 A;  3FKI B;  2EQS A;  4BBS G;  1E1T A;  2F0O A;  1G6Z A;  3WDN A;  1YVC A;  4K5X A;  1C8C A;  3K7A B;  1PRT D;  4LFC L;  1JC7 A;  1I94 Q;  4B3R L;  1VQF A;  1QUQ A;  2G9D A;  2FJ2 A;  3Q8D A;  3PO2 B;  1C0A A;  3HKZ E;  1FGB D;  4K6D A;  4MNO A;  1XMO L;  2K03 A;  1HA5 A;  3HGB A;  1DOM A;  2NVY B;  5CGK A;  3BZD B;  1HNZ Q;  2D62 A;  2ES2 A;  3J80 i;  3TQY A;  1ASY A;  5M3M G;  4DR5 Q;  4GKJ L;  1WI5 A;  3OMG A;  1EEF D;  4TRD A;  4C2M B;  4XQQ A;  4A3J G;  1GUG A;  1VQG A;  3U58 A;  4C3J B;  4A3F H;  1XMQ L;  2CKZ B;  2DUD A;  2RDG A;  2JYO A;  2JSO A;  4JBK A;  4LF5 L;  3OWE B;  3H09 A;  2N8N A;  5CV5 A;  2YTV A;  1NR2 A;  5JAV A;  3PUZ A;  1QZG A;  1PH8 A;  3GP7 A;  1Q46 A;  4GN5 A;  5C0X J;  2HT1 A;  1B2T A;  1EQT A;  1GM5 A;  4RHR A;  4C1N I;  3CCU A;  1K8G A;  3EJI A;  4GNX B;  3I73 A;  2RHQ B;  5EPK A;  2PQA B;  3GTQ B;  1OXU A;  3PO3 G;  4G7Z C;  1LTA D;  4A3K H;  1GJX A;  1O7Y A;  2IW3 A;  1EWC A;  2QW7 A;  1W3S A;  5G3L F;  3OPO A;  4Z9C B;  1C9O A;  1D5X C;  3AYH B;  1LTL A;  3OYY A;  4KY5 A;  4DV2 Q;  3EFX D;  1PFB A;  1U4M A;  5C4X G;  4JYA Q;  2I46 A;  3RD4 A;  4RGT A;  3D6W A;  4YY3 Q;  5FLM G;  1A62 A;  4B08 A;  2F0E A;  4POG A;  2Q8R E;  1UNS A;  1LTS D;  4DV4 L;  2EYO A;  1YNN D;  1A15 A;  1EWI A;  1IW7 D;  2UXC L;  4IN3 A;  4G7H C;  1Q1E A;  4G57 A;  3TDQ A;  2R92 H;  1JE5 A;  5CMD A;  3D0F A;  4V19 0;  1Z7T A;  3FDT A;  2XIW A;  3PGZ A;  3Q22 A;  5KNC A;  1YNJ D;  3I4N B;  4PNY A;  2HUG A;  3QIA A;  4OL7 A;  3MTS A;  3KLR A;  1AW7 A;  3FMC A;  2Q2I A;  1WFQ A;  2SNS A;  4CJ2 C;  1SYG A;  1I6H H;  3T1Y Q;  2SNM A;  3KK7 A;  1WTR A;  1YNJ C;  1HH2 P;  2KUM A;  3BDL A;  3L2P A;  5J22 A;  1I4Q A;  2CCZ A;  4P74 A;  1HPC A;  1WOC A;  1HFN A;  4EGV A;  5HGQ A;  1F9S A;  3FHW A;  3D3R A;  3HOY H;  4A3E B;  1STA A;  4GLV B;  1PH6 A;  1HZB A;  3HOY G;  3S24 A;  2R7F A;  2L5T A;  4R4O A;  4YWM A;  1NSN S;  2UXD L;  1CTM A;  1K8M A;  4DR6 Q;  1LTI D;  2DN8 A;  4DUY Q;  2F0F A;  1PXU A;  2KQ3 A;  4MIU A;  3SGI A;  4JI4 L;  3VR2 A;  4RKL A;  1KNE A;  3MHB A;  1UE5 A;  3GTM B;  3J81 c;  1VQ4 A;  1ICW A;  2F4V Q;  1L1O A;  1RL2 A;  3K7U C;  4XYQ A;  4GOP C;  4DN4 M;  3LX0 A; 
#chains in the Genus database with same CATH homology
 1CSP A;  4A3M G;  3HOV H;  3PO3 H;  2R7Z H;  4BA1 I;  2EXD A;  2K14 A;  1N36 L;  3E9I A;  4YHH Q;  4BY7 H;  4B3R Q;  4JI1 Q;  2KHJ A;  3U4Z A;  2VW9 A;  2BA1 A;  4FDB A;  3CW2 C;  3CC4 A;  3TS2 A;  3NEN A;  2YTY A;  1X3E A;  4LWC A;  4NXN Q;  3CMA A;  3CCQ A;  4BXX H;  3HOU G;  3GTK H;  2C35 B;  3PO2 G;  3PSI A;  3CCL A;  3J7Z C;  3RLO A;  4DV1 Q;  1AH9 A;  3HOU H;  4POF A;  4LF7 L;  4A75 A;  2JA6 G;  1BBW A;  2YV5 A;  4AQY Q;  5IYD G;  3STB C;  3IRB A;  4OO1 I;  1VQ5 A;  5AJ3 L;  5JJK A;  4DR4 L;  4BY1 H;  1KAW A;  1EQR A;  1NBW A;  1MJE A;  1PH4 A;  2R93 H;  1PH5 A;  5IP9 G;  5ELO A;  4KI0 A;  5C3E H;  1IBK L;  1Q7Y C;  1JMC A;  1K0R A;  2WB1 G;  1X65 A;  2FXQ A;  2JA9 A;  2OQ0 A;  4A3G G;  5GAH C;  1L2F A;  5IWA Q;  3M4Q A;  1C7Y A;  2VL6 A;  1S3O A;  4EX5 A;  1WYD A;  1CKN B;  1HNX Q;  4LUO A;  3HOZ G;  3S16 H;  3I4N H;  4LUZ A;  5FJ8 H;  2L15 A;  4IPG A;  1XNQ L;  4A3F G;  4QQB X;  2D0P A;  4DNI A;  3UE1 A;  1B7Y B;  1E7Z A;  1KC8 C;  3UE0 A;  1AE3 A;  2IX0 A;  3G48 A;  1IXR A;  1VS0 A;  4UPA A;  3CME A;  4RG1 A;  4DAM A;  1NY4 A;  1VQH A;  4LW1 A;  4L5T A;  3RZD H;  1XPO A;  1Y1W H;  1N33 L;  3A5U A;  3LGJ A;  4JI0 L;  4JBM A;  4AIM A;  5LMU L;  4DUY L;  4DK6 C;  1QVG A;  2I5L X;  1XMQ Q;  1NE3 A;  2WB1 E;  3S14 H;  2QA4 A;  4H02 A;  3I4M G;  4OO1 G;  4IOA A;  4LF8 Q;  4A93 G;  1H95 A;  1UE1 A;  2HHH L;  3NEL A;  4O2D A;  4R4C A;  3H15 A;  4IO9 A;  4XIG S;  5C4X H;  2ASB A;  2VS1 A;  2CFM A;  4GLA C;  3K0X A;  1FL0 A;  2K5V A;  2ZTE A;  3TRE A;  3RR5 A;  3T1H Q;  2E5L L;  2PQA A;  4A3B G;  4LF9 Q;  5JEA G;  2ZTD A;  2CQO A;  5IE8 A;  5K36 G;  3UDG A;  2H5X A;  1FVI A;  3RN5 A;  3PIO A;  4L5S A;  4BXX G;  3G6E A;  4IFD J;  2B63 H;  3CCR A;  3JC6 6;  4B3S Q;  4RMF A;  4LFB Q;  1HZC A;  2ATW A;  1X55 A;  4DV0 Q;  4PZ6 A;  3A74 A;  1EUJ A;  3CC2 A;  1UE7 A;  4A3E G;  3NBH B;  2KHI A;  4L5Q A;  2JJQ A;  2UUC Q;  3EIV A;  1S40 A;  1A0I A;  4YCU A;  4DV3 L;  3GTQ H;  3J81 j;  1EIY B;  5IYC H;  4LF7 Q;  1JB7 A;  4KLK A;  2UUA Q;  1U5K A;  1DGS A;  1IBL L;  4J15 A;  1TWA H;  3K8A A;  5ELN A;  1QUQ B;  4DR1 L;  4R4Q A;  5BR8 L;  4DV2 L;  1CKM A;  4X64 L;  1MKH A;  5LMN L;  1IBK Q;  2JA7 H;  1VQ6 A;  1I50 H;  1VCI A;  2I5M X;  2IY5 B;  4TQU S;  4GS3 A;  3AEV A;  1HNW L;  1CKN A;  4HIK A;  2UUB L;  4DUZ L;  5M3M H;  3B6Y A;  3H0G G;  4AYB G;  1VQM A;  3STB D;  1JJG A;  3PF4 A;  2MQH A;  1X3G A;  4OWT B;  5GRO A;  3KF6 A;  3FKI H;  1OXX K;  5H1S E;  3HOW G;  2A1A A;  4P71 A;  3UDF A;  3L7Z C;  2VQE Q;  1N8R C;  5M5Y H;  4JOI C;  1YIJ A;  2ZM6 Q;  1I3Q H;  1EOV A;  5LMU Q;  2JA5 H;  2JQO A;  3MEF A;  4MTN A;  4NB3 A;  1Q81 C;  1QVF A;  3CPF A;  3M3Y H;  4AH6 A;  3OW2 A;  1VQA A;  5M3F G;  4NXM L;  3ICE A;  1CSQ A;  1LM0 A;  3PUV A;  1BKB A;  4JI6 Q;  2K4K A;  4Y7N H;  2E2I H;  1YHA A;  4UP7 A;  1YHQ A;  4DKA C;  4UP9 A;  4K0K Q;  4HIO A;  3CCJ A;  1YIT A;  2BH2 A;  1Y14 B;  3J81 i;  1KQS A;  1GKH A;  4DR2 Q;  1Q8K A;  1J5E L;  2UXB L;  1VQL A;  2I5H A;  4R1J A;  1VQJ A;  2MFI A;  2UU9 L;  2VZA A;  2NVQ H;  2RCN A;  4YY3 L;  3S1M H;  1PYB A;  4LUV A;  1ASZ A;  1X56 A;  3GTO H;  3M9B A;  1N32 Q;  4OX9 L;  2EIF A;  3ULP A;  3S15 H;  4R4T A;  4B3M L;  1TWH H;  1X54 A;  4A76 A;  1KHI A;  1TXY A;  4L5R C;  4LFC Q;  4IFD G;  1L0W A;  2R93 G;  3W1G A;  2Q2H A;  2F4V L;  3HOZ H;  2K5N A;  2NZO A;  4GN4 B;  4A3E H;  5FLX c;  1EFW A;  2UUA L;  2HIX A;  4A3C H;  3I4N G;  4JV5 Q;  4PMW A;  4QL5 A;  3FP9 A;  3HKS A;  4JBW A;  4BY1 G;  1KRT A;  4LNQ A;  4A3G H;  4C2M H;  4JI4 Q;  3K81 C;  4GNX C;  3KF8 B;  3TS0 A;  2LXJ A;  2N49 A;  1I94 L;  1PH7 A;  3ZJY C;  1PH1 A;  1PHJ A;  4X62 L;  4GKK Q;  4WJ3 M;  4DUZ Q;  3KJO A;  4DPG A;  4Y52 H;  3KOJ A;  5J3B A;  3KJP A;  1EYG A;  3NEM A;  1G29 1;  1WCM G;  4HJ7 A;  3PIP A;  4DV1 L;  3GTM H;  3HOW H;  5C4J H;  3BU2 A;  1QZH A;  1D7Q A;  4AQY L;  3K80 C;  3MXN B;  3PCO B;  4IPH A;  2Q2T A;  3PO2 H;  4QY7 A;  4A3B H;  3HOV G;  2GVB A;  1VQC A;  5IYD H;  3I56 A;  5HY6 A;  3GTP H;  2OTJ A;  4UY8 C;  4KHP Q;  3KLW A;  3GTL H;  4YCW A;  1UE6 A;  3I55 A;  5M5X H;  3CAM A;  4JI5 L;  1YEZ A;  5M5W H;  1GD7 A;  1VQK A;  2K52 A;  2PI2 E;  1Q82 C;  1WJJ A;  1IBM Q;  1V9P A;  2VNU D;  4K0K L;  2NN6 G;  5AJ3 Q;  4IPC A;  3VDY A;  2MNA A;  5M3F H;  3GTG H;  4TVA B;  3AQQ A;  3DM3 A;  1N9W A;  3PUY A;  4JBJ A;  4WJ4 A;  5C3E G;  1YI2 A;  2Y0S E;  4OON A;  3I4O A;  4GNX A;  2E8G A;  4DR7 L;  1SRU A;  1OTC A;  2AKW B;  2YTX A;  4JG2 A;  4LF6 L;  4LF8 L;  2B63 G;  3M7N A;  1RIP A;  3CP0 A;  1HJP A;  2K75 A;  4HJ8 A;  3CXC A;  4A3K G;  1KRS A;  5JEA J;  4X66 L;  3CCV A;  4JI3 L;  1P8L A;  4DV6 Q;  3M4P A;  4GLX A;  2JA8 G;  1PFS A;  1D8L A;  3F2C A;  1FJG Q;  2IHF A;  1XJV A;  4LF9 L;  3TRZ A;  1V43 A;  1E3P A;  4A4I A;  4DV7 Q;  3HKZ G;  4DAY B;  4JV5 L;  4ME3 A;  1G51 A;  1K9M C;  4LFA Q;  4JI8 Q;  2Q2U A;  1BVS A;  3RN2 A;  1E22 A;  1TWG H;  3A0J A;  1X9N A;  2BH8 A;  3L0O A;  1WCM H;  1V1Q A;  2HHH Q;  4QJF A;  1PA6 A;  1YJN A;  3S1R H;  1UEB A;  2JA5 G;  4A3D G;  5IYB G;  1HR0 L;  2UUC L;  1N34 L;  1X6O A;  2QGQ A;  4EQ5 A;  1O7I A;  1SRO A;  3M85 A;  2YU9 H;  2UXD Q;  1PH3 A;  1NMF A;  3PUW A;  4DR6 L;  5E7N A;  4DR3 L;  1VQP A;  1IYJ B;  1UWV A;  3S1N H;  4X64 Q;  4OWX B;  4KHP L;  4DV4 Q;  3AFP A;  1K8A C;  3RZO H;  1VQO A;  4YWL A;  2VQF L;  2UXC Q;  2Z6K A;  2JA7 G;  1S72 A;  3ER0 A;  1HZ9 A;  4JI0 Q;  2JA6 H;  4HIM A;  3U4V A;  1IBL Q;  3S1Q H;  3KF6 B;  4YHH L;  1M90 C;  4IOC A;  1PYS B;  1GO3 E;  2RF4 A;  1HNZ L;  4HJ9 A;  4C3I H;  3GO5 A;  2E2J H;  4DV5 L;  2IT1 A;  4XTC S;  4JC0 A;  3CCE A;  5GAG C;  2UUB Q;  3F2D A;  3T1H L;  2E5L Q;  1JJC B;  2KCM A;  2K50 A;  3UDI A;  1BBU A;  3W1B A;  4APV A;  3GDE A;  2LXK A;  4GOP B;  1T9H A;  2AWN A;  1W2B A;  2NVX H;  2KCT A;  4A3L G;  4JI3 Q;  3S2H H;  2R7D A;  3ULJ A;  4IPD A;  4OWW B;  1J6Q A;  3CF5 A;  3RNU A;  4GN3 B;  1A8V A;  4A93 H;  2AMC B;  4LFB L;  1YZ6 A;  2B29 A;  3K7A H;  4HJ5 A;  2JEA I;  1K83 H;  1SE8 A;  3CD6 A;  4P73 A;  1Y1V H;  4JI8 L;  4LFA L;  3I7F A;  2UU9 Q;  2R92 G;  2VUM H;  2PNH A;  1SN8 A;  2ZJR A;  4A3M H;  1E24 A;  3S17 H;  3E9H A;  3ULL A;  1GVP A;  1CUK A;  2AWO A;  4X65 Q;  4JI6 L;  4B3M Q;  2JK8 A;  5C0X I;  2R7Z G;  1XNQ Q;  1N36 Q;  4R4I A;  2NVY H;  1OXS C;  1VQ7 A;  2XTI A;  2Z0S A;  3F2B A;  3HFZ B;  3RLF A;  2UXB Q;  3CCM A;  3GD7 A;  1R9T H;  2I0Q A;  2E2H H;  3RLN A;  3G4S A;  4PG3 A;  4NXN L;  4PZ7 A;  2ID0 A;  1HNW Q;  1A63 A;  3HOX G;  4DR3 Q;  2EQS A;  4BBS G;  1E1T A;  1YVC A;  5IP7 G;  4HJA A;  4LFC L;  3KDF A;  4C3H H;  1I94 Q;  2VQF Q;  4B3R L;  1VQF A;  4JI1 L;  5IP9 H;  1Z9F A;  1QUQ A;  1CKO A;  1EIF A;  5JJL A;  3Q8D A;  2JA8 H;  3W5O A;  1C0A A;  2VQE L;  1Q1B A;  4HID A;  3HKZ E;  1HR0 W;  4MNO A;  3OTO L;  1XMO L;  3S2D H;  4JOI A;  2OTL A;  4A3I G;  2N3S A;  5IWA L;  2ES2 A;  5IT9 c;  2D62 A;  1SFO H;  3J80 i;  3TQY A;  3CPW A;  5M3M G;  5IYB H;  4DR5 Q;  1HNZ Q;  1ASY A;  4GKJ L;  1WI5 A;  1YJW A;  2JE6 I;  4LF4 L;  3A5Z B;  4GKK L;  3BZK A;  5C0X G;  4DR4 Q;  4JI5 Q;  3H0G H;  1XPR A;  1P16 A;  4A3J G;  2OCE A;  4BBR H;  3TEH B;  1YJ9 A;  1VQG A;  1TWC H;  1OXV A;  2YYZ A;  4O0A A;  3U58 A;  1M1K C;  3U50 C;  4KHZ A;  2QEX A;  4A3F H;  5FJ8 G;  1XMQ L;  2CKZ B;  2DUD A;  4IJL A;  1HNX L;  4QGU A;  3CC7 A;  3ERS X;  1MIU A;  4B3T L;  5C44 G;  5BR8 Q;  1PH9 A;  4JBK A;  4LF5 L;  2NN6 I;  2KBN A;  3EBE A;  5GQO A;  1LYL A;  2D0O A;  2HIV A;  2N8N A;  2NZH A;  2ZJQ A;  4DR7 Q;  4JI7 Q;  2VY3 A;  1G6P A;  2YTV A;  2RHS B;  1XPU A;  4A3D H;  1N33 Q;  3I4M H;  4JI2 Q;  1EQQ A;  4DK3 C;  1IBM L;  1VQ9 A;  1QVC A;  1MJC A;  4MZ9 A;  2VUM G;  3T1Y L;  3PUZ A;  3F1Z A;  4DV6 L;  3E0E A;  1B70 B;  1QZG A;  5IYC G;  1Q46 A;  1PH8 A;  1B8A A;  1L1O B;  4GN5 A;  5C0X J;  1Q86 C;  2HT1 A;  1GM5 A;  2IX1 A;  4B3S L;  1I5F A;  3CCU A;  1K8G A;  2PMZ E;  4GNX B;  2MO1 A;  2ZM6 L;  2BA0 A;  1YBY A;  1Z47 A;  2RHQ B;  2PQA B;  2HQL A;  1OXU A;  2ZJP A;  2F52 A;  1YNX A;  3GTJ H;  3CCS A;  4A3L H;  3PO3 G;  1U0L A;  2AHO B;  4YWK A;  3KDF B;  4A3K H;  4X66 Q;  2CWA A;  3JAM c;  1VQD A;  1XTD A;  1W3S A;  4A3C G;  1N34 Q;  4BA2 I;  5DLQ E;  1C9O A;  3AYH B;  1LTL A;  1FJG L;  3OYY A;  3OTO Q;  1KL9 A;  4DV2 Q;  1XMO Q;  4DV0 L;  1OXT A;  1NJI C;  3JAM i;  3PF5 A;  4JCV E;  1J5E Q;  1XNR Q;  1AE2 A;  4JYA Q;  5GAD C;  5C4X G;  2XGT A;  2ALY B;  1VQ8 A;  1VQE A;  4YY3 Q;  1SR3 A;  1A62 A;  1X3F A;  5FLM G;  3BZC A;  4DV3 Q;  4DR5 L;  2K5H A;  1KD1 C;  4GKJ Q;  4OX9 Q;  4POG A;  5FLM H;  2DGY A;  4UP8 A;  1Y1W G;  1SMX A;  4DV4 L;  4LF4 Q;  1EWI A;  1TWF H;  3KFU A;  1HR0 Q;  1IL2 A;  2OWO A;  2UXC L;  4C3J H;  4DR1 Q;  1Q1E A;  3DLL A;  2KEN A;  3M4O H;  4NPS A;  2R92 H;  1JE5 A;  5LMN Q;  4IFD I;  4YCV A;  1SLJ A;  3D0F A;  1IZ6 A;  2WP8 J;  2A8V A;  1K3R A;  2CWP A;  2R6G A;  3PGZ A;  3UDX A;  4X6A H;  1NMG A;  3CQZ H;  4P75 A;  1NTG A;  4LF6 Q;  2WAQ E;  2OQK A;  3PV0 A;  4B3T Q;  4LF5 Q;  5IY0 A;  1VQI A;  3G71 A;  1PV4 A;  3F8T A;  1Q12 A;  3PUX A;  3H3V I;  4BY7 G;  4JI7 L;  1PVO A;  1JJ2 A;  2JEB I;  3D31 A;  5LMN W;  4ALP A;  3BJU A;  2ZTC A;  1WFQ A;  2Q2I A;  2GVA A;  2WAQ G;  4JI2 L;  3WWV A;  1KIX A;  4DR2 L;  4DV7 L;  1I6H H;  2MO0 A;  5GAE C;  3T1Y Q;  1FGU A;  3EN2 A;  4OXP A;  1HH2 P;  3I2Z A;  4P72 A;  3L2P A;  4NXM Q;  2B3G A;  2CCZ A;  4P74 A;  1WOC A;  4PZ8 A;  4IJH A;  4QIW E;  2A19 A;  2NVT H;  4BBS H;  5HGQ A;  4DV5 Q;  4AYB E;  3FHW A;  4GOP A;  5EAY A;  3J80 c;  1E1O A;  2Z6K C;  3KYH C;  1L1O C;  3HOY H;  5JJI A;  2V1C C;  4GLV B;  5IP7 H;  1PH6 A;  1HZB A;  3FKI G;  3HOY G;  1JT8 A;  4A3I H;  3J7A 5;  3S24 A;  1PH2 A;  2R7F A;  2N78 A;  1VQN A;  2PI2 A;  4R4O A;  4YWM A;  2UXD L;  1KXL A;  2F3I A;  5C44 H;  4DR6 Q;  3H3V H;  4DUY Q;  1N32 L;  3SGI A;  4A3J H;  2LSS A;  1XNR L;  4JI4 L;  1VQB A;  2Y0S G;  2IHE A;  4JYA L;  1HZA A;  1Y1V G;  2GN5 A;  4BBR G;  1UE5 A;  4X62 Q;  1YHB A;  3J81 c;  1K73 C;  1VQ4 A;  2F4V Q;  1L1O A;  3AFQ A;  4X65 L;  1RL2 A;  2WFW A;  3K7U C;  1LUZ A;  4GOP C;  3HOX H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...