2KHVA

Solution nmr structure of protein nmul_a0922 from nitrosospira multiformis. northeast structural genomics consortium target nmr38b.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
MTFSECAALYIKAHRSSWKNTKHADQWTNTIKTYCGPVIGPLSVQDVDTKLIMKVLDPIWEQKPETASRLRGRIESVLDWATVRGYREGDNPARWRGYLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of protein Nmul_A0922 from Nitrosospira multiformis. Northeast Structural Genomics Consortium target NmR38B.
rcsb
source organism Nitrosospira multiformis atcc 25196
molecule tags Structural genomics, unknown function
molecule keywords Phage integrase
total genus 34
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2khvA01
4CRXA 2KD1A 2KEYA 1CRXA 3CRXA 2KHQA 1KBUA 4A8EA 2KKVA 1XNSA 3C29A 1P7DA 1DRGA 1F44A 1Z19A 2KIWA 1XO0A 2KJ5A 1PVQA 3C28A 2KJ8A 1Z1BA 1MA7A 1PVRA 1A0PA 2KKPA 4ACOA 2HOFA 2KOBA 3MGVA 2CRXA 3LYSA 1Q3VA 5CRXA 2A3VA 2HOIA 1NZBA 2OXOA 1PVPA 1OUQA 2KHVA 1Q3UA 2KJ9A 3NRWA
chains in the Genus database with same CATH superfamily
3HPOA 4M9JA 4F71A 5AICA 4J9KA 4IR9A 1KBUA 3LWMA 2VIXA 3PW0A 4OCZA 4ECWA 2R18A 4UQGA 1A0PA 5L1LA 4Q45A 3NGDA 1ZQNA 2CRXA 4PHDA 5ALUA 2HOIA 3RRHA 9ICIA 1MQ3A 2K4PA 5J0QA 2ASJA 2P35A 5ALFA 4NLNA 2YQEA 2E8OA 5AM0A 2Z7JA 1KEJA 3PSFA 3C2LA 4DFMA 1L3VA 1WWUA 3N7SC 4I28A 4PGQA 5IIMA 4K4HA 4ED3A 2BCQA 3QZ8A 3WKAA 1PVPA 4DLGA 4F3OA 1ZQKA 5KFEA 1SIJA 1KLNA 4UB8U 5AM5A 1S97A 4PH5A 4OD0A 1HJPA 5EOZA 3AMZA 2PI5A 2KIWA 2W04A 1T94A 5KFAA 2LPEA 1PK3A 2IA6A 1ZQXA 5KNIA 3HT3A 4I2IA 3E58A 1WCNA 4U7CA 3OSNA 3HILA 4EBDA 3UXNA 4DFJA 3KZXA 3TFRA 2YMLA 4DLEA 2KSOA 2JHDA 4GC7A 1ZQFA 3TACB 5AM3A 1ZQZA 1J2NA 4OJPA 4PZOA 4QWCA 2XICA 4F2RA 3V6JA 2BR0A 1Q8KA 4YR2A 1B4FA 2ZG6A 2HMXA 1KQQA 3ZD9A 2GOLA 4NLBA 4KITB 4QZ8A 1RXVA 4B9MA 4CDGA 4EX6A 4M9GA 5AM4A 4PHPA 2KVSA 5HNKA 2ZUBA 2C2DA 3SMVA 4B9LA 2FJ6A 2W9CA 2A1JA 3RAQA 2ZIWB 4TQSA 3OTQA 2ZIVB 2PMZC 1ZYQA 7ICGA 2L5YA 1S0NA 2JGAA 2IHMA 2RLTA 1N61A 2NRTA 5KFQA 3L5KA 4GXKA 1CRXA 1LKYA 2JEIA 2WF7A 4OJLA 3JPQA 3E2EA 3PR4A 2BQRA 5J2DA 3ZDDA 2HOFA 4QZIA 4R8UB 3SQIA 5EE3A 2ODGA 2PFNA 1A76A 1X9MA 2J6UA 3WKBA 9ICRA 4KLUA 1NJZA 3C1ZA 5L1KA 1UHUA 5ALRA 5J0RA 5KT5A 5A0LA 2PFOA 4B9VA 4XUSA 2OWOA 2BPGA 1ZQMA 1JI7A 3QYPA 3IG8A 3JPOA 4X5VA 1RQNA 2Y0SC 1L7PA 3PV8A 3WK7A 4DSKA 7ICSA 4GXJA 2VJ5A 8ICUA 3PW7A 3ONNA 2GWSA 4IRKA 3MC1A 1IM4A 4C7YA 1ZQPA 4TUSA 3RB0A 1ZQTA 2FMQA 4BWJA 1PVRA 3GV7B 3RJHA 7ICLA 4I2FA 5CWRA 1S0VA 1KL9A 5AK5A 3PO5A 2AQ4A 3RFAA 4QIWF 3GIMA 3WKEA 4RNNA 3KKAA 2ESEA 9ICMA 2PFPA 1QLNA 1JX4A 4DSLA 1DRGA 4NLGA 3MDCA 2K8CB 1Z3EB 1COOA 1L3SA 1WG8A 3F53A 4Y2TA 4J9SA 4DOCA 1CI4A 1UT5A 2HBMA 2ZIXA 1NJWA 3OJUA 3K1ZA 2WAQC 7ICQA 3F2CA 4KMOB 2K4EA 5KFRA 2W8LA 4P4PA 3ED5A 2K8AA 2KVCA 4PL2A 3MR2A 2F76X 3WK4A 4DS4A 1AQ6A 2B21A 4KTQA 2W9CB 1HUOA 5ALZA 4XRHA 4BGDA 5D46A 1QTMA 2XVTA 1U9LA 5DLGA 3QUCA 4HAIA 4Z6CA 3D2SA 8ICFA 1IV8A 4ED6A 5AI0A 2QARB 4ED7A 2HHWA 2W43A 2XY6A 2BCRA 2JEFA 3ZDAA 2MA1A 5AIBA 5J8YC 8ICQA 2DWQA 5KG1A 1V85A 5J0SA 2KIVA 1T3QA 3M6KA 5ALNA 1ZD3A 4KLTA 5KFWA 2GLEA 8ICGA 2BCSA 1QQ7A 4YVZA 2FPMA 4QWAA 9ICHA 3M8RA 2RQ5A 4E0DA 5BOMA 2J6TA 2K89A 4ED1A 2ASDA 4OJOA 4M0AA 3BZCA 3U26A 4F2SA 3C2KA 2N1RA 3EYZA 1X6IA 3QU2A 2DPJA 2E1EA 4YQWA 3FDSA 2HHXA 4KLIA 5J2AA 4ECVA 4J9MA 1ZQYA 2ZXHA 1BPYA 1U4BA 2F8KA 5HHIA 4KLOA 4RQ0A 5AKEA 3IRUA 1ZQAA 1ZQRA 3KFUF 4R64A 5KL8B 2V4QA 4CGZA 1T3NA 3HWTA 9ICAA 1SV4A 3WKDA 2OYYA 4EYHB 4FS1A 4RQ1A 4MF8A 3QEBZ 5EE1A 1WWVA 4M6WB 2G07A 4KMUA 9ICOA 3H0LB 1Q3UA 1F44A 1D9DA 4C80A 1IIPA 4O0IA 3UXPA 4RQ4A 5AK6A 2VA3A 7ICKA 4EX7A 4UB6U 4RQ3A 1XU4A 5KTQA 4C8KA 1PK1B 2BGWA 3LDAA 1ZQIA 4DL2A 4F4ZA 5CEHA 2HHTA 3C5GA 4RQMA 1N5XA 2YTUA 3HW8A 5AKZA 2EAOA 2C28A 1JXEA 4DQQA 3KTQA 1L8LA 3ZD8A 1TK8A 5KG7A 1Z4OA 2C2EA 2W9MA 5ALGA 2Q0ZX 4TUPA 1K5OA 4DF8A 1RYSA 4UBBA 8ICVA 1V9PA 2IOHA 4FE3A 2KNJA 5F9NA 5DGBA 2D3DA 3EPIA 4PZNA 3PMLA 5ALJA 1D8YA 3KD3A 3SYZA 3PNCA 8ICRA 4GC6A 9ICSA 4IQTA 2FLPA 1X9SA 4KLGA 2W11A 2EDUA 3MGIA 5ALEA 5DG9A 4YD2A 2MUTA 4DFDA 5KFTA 3RH6A 4UB5A 8ICTA 5J0PA 4FZNA 7ICFA 2ZUDA 4US8A 1N5WA 2HI0A 5CA7A 1U45A 4Y2PA 5AKLA 5DG7A 3H8WA 5KFIA 3RB6A 3KOOA 5KFBA 2OEHA 4F50A 2KJ9A 2MRLA 4F8RA 4B9UA 3ICXA 3CNHA 2W54A 4QWEA 5F3XB 2ASLA 4I29A 1D8BA 4C8OA 1DGSA 1JN3A 2IHNA 3H0MB 3T5KA 2KN7A 3JPTA 9ICBA 4Y2VA 5AI8A 4DL3A 1S0MA 2IOFK 4G3IA 2G08A 4LZGA 4BDPA 3SENA 3THVA 4P2HA 2QB0A 4O5EA 2UVWA 2K60A 5J2BA 2F77X 4UAWA 8ICEA 1SKRA 4RNMA 8ICJA 3IV6A 5DQIA 1XO1A 4BX9C 1XO0A 3H8MA 9ICWA 2LYBA 4KLMA 3Q8KA 4CF5A 4F92B 1V38A 1PK1A 5JUMA 1NK8A 1NK4A 1L7MA 3BQ7A 3NUQA 4C8NA 4QZGA 3CW2C 3RBEA 5AI9A 3BJYA 1ZQCA 1SWVA 4IQWA 1QSYA 4IC9A 2W03A 5IILA 4O3SA 2NO4A 2HOQA 1N2XA 4ED0A 1TV9A 8ICIA 4Y2UA 7ICPA 2G5IB 3RR8A 3TFSA 4QZ9A 2W9BA 5AM2A 4DS5A 5KFJA 5ALSA 3V7LA 2W55A 1BNPA 2KSOB 1BNOA 3ZI4A 5JTIA 1ZQQA 3AEVA 4CRXA 3AUOA 2Y9UA 2GH1A 3GV5B 5G5HA 1JRPA 1RYUA 1X9XA 4M9LA 2NV3A 1X42A 5J2FA 2KKPA 2ISOA 5J2IA 1KDHA 2V9WA 2R8JA 3QXGA 5EE9A 2AXTU 4IQVA 1U49A 3QU4A 3JPRA 1FIQA 2I6XA 5CR0A 1DK2A 5ALVA 1XSPA 2CXYA 1TAMA 3T3FA 5D49A 4DOBA 3RB4A 4BXOB 5L1IA 4TUQA 1XNSA 4JV2A 3QUBA 2K4IA 4FZMA 4QW9A 3GILA 3N7PD 2FLLA 1ZD5A 2LM4A 2XI9A 2DF4B 9ICJA 2PI4A 7ICVA 2FPLA 4YCXA 4DL6A 9ICLA 1Q46A 3Q8SB 4BJQA 5AK4A 1RQLA 4KLDA 5HR6A 4Y2QA 2WAQF 3H0RB 2KKVA 3H7IA 4JMUA 5KG2A 4O3QA 7ICJA 2AH5A 2YMMA 3E0FA 2MUTB 4P4OA 1DGJA 3C2MA 5ALYA 2KHVA 3A0HU 4I2BA 1L3UA 4KLSA 2BQUA 3PY8A 4NLCA 3HX0A 2QB1A 2P6UA 3NVWA 5DKWA 2KFNA 3S6JA 1PUZA 3MR6A 4YMMA 3RH5A 4O3NA 1U48A 1O08A 3FM9A 2YX8A 5EWGA 2HSZA 2H5XA 4FS2A 3NRWA 3BS5B 3TADA 1QH9A 9ICXA 1IXRA 3T5HA 3OHAA 1Z00B 4RQ5A 3V72A 4BUGA 5HP4A 2F2AB 1ZJMA 5DLFA 4I2DA 3K1RB 2HVHA 4B9SA 4JV0A 2VKQA 4RNOA 5H2FU 2I1QA 5IIOA 3TANA 5DG8A 2HHVA 3AQFA 7ICHA 4RPXA 4F93B 3HP6A 4QZAA 5DGAA 4TQRA 4G9BA 2DKXA 3M9OB 1WYGA 2KICA 2OXOA 2HBLA 3QX7A 2BCVA 1FEZA 4DO9A 3QE9Y 3QZ7A 1B0XA 5AI6A 1D9FA 4PL1A 4LJXA 2ZJAA 4BWMA 2G09A 1A77A 4IRDA 5AKHA 5AKIA 5JU5A 3GV8B 3V6KA 3GIJA 1ZQEA 3IM1A 2XY7A 3GFKB 1SB3C 2LKYA 1UCVA 3NVZA 3SEIA 2NRWA 1CUKA 1SXEA 5KFPA 1BPEA 4NL9A 3ALRA 2FLNA 2EZXA 4GLXA 1UPHA 5AK3A 1O03A 3AQEA 2Y1IA 1N62A 3AU2A 4KLQA 3H4DA 2WTFA 4Y2JA 3ZDBA 3N28A 4B6JA 3G6YA 2ZTDA 2BHNA 4O9MA 4DFKA 1L5UA 4P0QB 2JEJA 4QWBA 3WK8A 1SL2A 3RR7A 4J9PA 8ICAA 4AYBF 1NKEA 3HRDD 2XC9A 1U47A 2F1HA 5B5EU 3TAPA 5KT6A 2QB0B 3SAFA 5KFNA 3UQ2A 8ICNA 4RPZA 8ICKA 4NLKA 1HEKA 3RJIA 2VA8A 4UW9A 1ZQDA 3BZKA 1XC9A 3GQCA 4DSJA 5J2JA 5ALDA 1L7OA 4NM1A 2ATLA 2P66A 4EZ9A 4ECYA 7ICUA 1S9FA 2H3FA 1ZQSA 3KHGA 8ICHA 1DK3A 1K1SA 5CB1A 4DQSA 1A6SA 1UA1A 3R9KA 5ALHA 3JPNA 2IBKA 3MGVA 4Z6DA 2DBYA 1Q3VA 3NTUA 5DBBA 5E79U 1KW4A 3UQ0A 3PVXA 1RXWA 4KLHA 5IINA 4ECQA 3DEEA 8ICCA 5HR7A 4I2HA 3J81j 2E5SA 1BPZA 2KZMA 2EQYA 2G06A 2ZJ5A 3K75D 3WKCA 3PMNA 1ECWA 5KFXA 2JV3A 5AIAA 2JH7A 3RJFA 1ZQ1C 3WK5A 1ZRMA 1ZQJA 3IN5A 3KZIU 2XCAA 2AHOB 5KG3A 5CP2A 1PZNA 5J2GA 2H3VA 3MABA 4KLLA 9ICFA 3LWLA 5KFVA 2H3IA 4DSIA 8ICBA 4J03A 9ICEA 2VA2A 3PX4A 4RT2A 5DQHA 1BPBA 4R8UA 3BS7A 4KLEA 1ZJNA 1X40A 4JV1A 2VANA 1YZ6A 3FC4A 2QLTA 3H4BA 3C21A 2UVRA 2A1JB 4C0ZA 1F0MA 1L6NA 3N7RC 2ZIVA 3GU3A 4DEZA 3VCBA 2MU2A 3DDHA 8ICSA 2DPIA 3IG5A 2PXIA 3K4GA 2C2RA 1Z4NA 4Z6FA 1WCLA 2KP7A 3EZ5A 2DGZA 3T5JA 1LKYB 1ZQWA 2R8IA 4MFFA 3JPSA 2KV2A 4C4SA 3MDAA 2BQ3A 2YMQA 4UAUA 5KFZA 1S8OA 4ED2A 1MQ2A 4J9NA 3PO4A 4M04A 1N63A 4KX5A 3Q8MA 1MC8A 2EANA 3QU9A 4QWDA 4NL9C 1H38A 1TAUA 4JK1A 1QQ6A 2WF8A 2D6FC 2GO7A 4RQNA 1SKSA 5CHGA 3RJJA 1CEZA 5J0UA 9ICTA 4UB1A 3C28A 4P4MA 1ZQVA 2I9GA 1KFTA 2AGOA 4YMOA 3I28A 1DOQA 4Y2RA 4Q8EA 3D2QA 1N60A 3NASA 1SXDA 2ZIXB 4O3RA 8ICOA 2G0AA 4UARA 3EUB2 2Y1JA 3GZFA 4RUCA 4JWNA 4A8EA 1P7DA 5JRTA 3JPPA 9ICQA 1SV0C 3TKAA 7ICTA 2E3TA 5ALTA 2EH9A 3B0YA 2NRVA 4ZOHC 4QZCA 3RRGA 1RYRA 4P0PB 2I5HA 4FBTA 2HHUA 4UB4A 1JIHA 3M7DA 3T79A 4DL5A 3Q8RB 2O6KA 3PW4A 1RZTA 1MA7A 4LVSA 3H8JA 2LM1A 4KN4A 2IMWP 4YD1A 3SI8A 1OW5A 1EXNA 3RTVA 3EWAA 2FDRA 1ZQOA 4CF3A 1KSPA 1VJ5A 5KG0A 2KTQA 5GTHU 3MR5A 3OJSA 5EWFA 2KOBA 2FPKA 5ALPA 1SV0A 1S10A 4DQPA 2LI6A 5AKYA 4DFPA 4J9OA 4O3PA 5DB8A 4UBCA 2XCPA 5KG6A 5DB7A 3TAQA 2BPCA 1SZHA 3KHHA 2VJ4A 5K4LA 5J2CA 2ZIWA 1ZQUA 1DXSA 4P0QA 2Y0SF 2JRZA 4Y2YA 4PGYA 8ICYA 1KN5A 3OPXA 3GDXA 3HJEA 4ECUA 3LVWA 7ICEA 5KAFU 5J0YA 3BQTA 5DDYA 3UM9A 1NNLA 5J2HA 1NKCA 1URJA 2WHEA 1C20A 2BZFA 4DL4A 3V7JA 2QKQA 2JEGA 4I2EA 4IRCA 2LYHA 3C5FA 2F1IA 4MEXA 1K1QA 1XS9D 4J9QA 1Z1BA 4F72A 3OGUA 1ZETA 5TZVA 1FFUA 1QSLA 4O3MA 4QNLA 2LHTA 2R8GA 2Q4TA 2FMPA 2M0NA 1SZPA 5J2EA 2FMSA 3A0BU 5IIJA 4EEKA 4YR3A 3MBYA 1KTQA 4RQ7A 4F4KA 1X66A 4I2AA 2NRXA 2CPRA 1ZXIA 3SAGA 4GIBA 3BQ0A 4UAZA 3N97B 1UA0A 3CYMA 1QCKA 2PKEA 3CP8A 5ALXA 4DQRA 1X2IA 9ICUA 4F4WA 5KL1B 4IS7A 4O3OA 2XIDA 3ISCA 2F44A 3ETRA 3C1YA 1NJYA 2H3ZA 3LYSA 5ALOA 4F5PA 5GTIU 3LK9A 4F5QA 5AKGA 1OUQA 3NVYA 1ZD4A 4NM2A 3I1YA 9ICPA 5FP0A 4DL7A 1COKA 5ALLA 4RZRA 3C29A 2DQNB 1B22A 4KN7A 3PSTA 3F2BA 2KK0A 1ZQLA 8ICMA 4QZEA 4EEYA 1OXJA 2HHQA 3IDWA 2K4HA 3SD7A 5AM1A 3V6HA 4OO1J 5CJ7A 1NKBA 4MF2A 4XQ8A 4C8LA 1LVHA 5L9XA 2JR5A 3Q8LA 4RQ6A 1Z19A 2A19A 1L3TA 4AYBC 1RM6C 4FO6A 3SV3A 3PSIA 5HMLA 2UVVA 2YB1A 4EBEA 3TQ1A 2NRZA 4AP9A 3QU7A 2W9AA 3L3FX 2XGPA 2WB1C 7ICOA 1S5LU 5KFGA 2PFQA 3F5EA 2XO7A 4C7ZA 4DSEA 3ISDA 2AGQA 3T5LA 1AROP 2WFAA 3PZPA 4Z6EA 3LVVA 3QEAZ 1X6JA 3M8SA 5KFMA 2AU0A 4ECXA 5KT7A 3L4PA 3SAHA 1NK0A 1LV5A 4PGXA 1X9WA 3H8SA 1SGGA 4ELTA 8ICPA 5KFKA 4UATA 3G6VA 3Q8QB 4J9LA 2W3RA 9ICNA 3GIKA 2WB1F 2KZZA 3D6JA 2B6GA 2LMRA 2KMDA 3C23A 1L7NA 5KFDA 1ZQGA 4YXJA 5CRXA 4PPXA 4PHEA 3TADC 3B0XA 5G5GA 5TISU 2KFZA 4MFAA 5AKKA 8ICXA 2JMGA 1TK0A 1FFVA 3FYHA 1VDVA 1UQVA 1RG6A 1JXLA 3RB3A 4I27A 2XGQA 1MN8A 5KT2A 4RQ8A 2F8LA 4IQUA 4LZDA 2HW3A 1TVAA 5J0TA 1MSWD 2PMZF 4DOAA 1SKWA 3RJKA 5J29A 2BCUA 2YN4A 4UB3A 4R65A 2W3SA 5AHXA 2OH2A 2K8BB 3AL0B 3BS5A 3SV4A 7ICIA 5L1JA 2E1FA 2EAPA 1HIWA 4PHAA 4EELA 5DQGA 4I2JA 4M6WA 5KFOA 4UB2A 3H40A 5HMMA 3M1YA 5KFHA 2MAXA 5J0OA 2ZIUB 3KHLA 3TI0A 7ICMA 4BXOA 2Y9TA 1JUDA 4NWIA 3WK6A 4M47A 5IIKA 4U6PA 5DBCA 4Y2XA 5KAIU 3EW9A 2KZ3A 5KFCA 2ZIUA 4ELUA 4KX3A 1Y88A 2ES6A 5ALIA 4YG2A 4UAVA 2KJ8A 2W7PA 4EBCA 1ZQHA 2D8CA 4F91B 3OSPA 2JH1A 4R66A 8ICZA 2BKEA 5KT3A 4K4GA 2F1JA 4DWIA 5KFSA 3M9NB 5KFYA 4YMNA 3RAXA 4YFKA 3KBBA 2KG5A 5KFLA 2DFLA 1FO4A 4QZHA 2R8HA 2ZTCA 4MFCA 1C7YA 1ZOLA 3F5AA 3KKAC 4NXZA 3V7KA 4I2GA 3HKZC 3ORYA 5DBAA 1D8LA 4NLZA 4C8MA 2IOFA 2WF6A 5J2KA 2UVUA 4OJ6A 1ZRNA 2ALZA 4Q44A 3UMBA 4TURA 3FAHA 2G5HB 2E8MA 2EZZA 3BDPA 1SL0A 4DQIA 3MR3A 3F2DA 2HVIA 1B43A 3ISBA 1VLBA 2JZBA 5HHHA 3O0FA 2ZJ8A 5ALKA 5KG4A 2JXJA 4JUZA 4HYKA 2P6RA 2WF5A 2ZUCA 5DDMA 2B0CA 1Z00A 5L1MA 2F3NA 4MEYA 5IIIA 1XSNA 3NRZA 4RU9A 4ED8A 1YZ7A 1ZQBA 4XA5A 2KE7A 1Z1VA 4QW8A 9ICGA 9ICVA 4JB3A 4FZLA 2J6SA 4QIWC 3UMGA 1BVSA 1KFDA 3M6ZA 3GIIA 4NY8A 1NK6A 3PW5A 4CE6A 4F4YA 3G6XA 1JALA 5ALQA 1T4GA 3UXOA 1N48A 2W8KA 1NJXA 2E8PA 5AKXA 5BPCA 3QU5A 2LBOA 2KEYA 3NVVA 4YR0A 4F4XA 2CN1A 2KHQA 4IL6U 2EZYA 4UAYA 1TAQA 4RQ2A 4ECSA 3NS1A 4EZ6A 2EAMA 1N56A 1UT8A 5D4BA 4CCHA 4P0PA 4WJ3B 5AI4A 3KHRA 4DSFA 3Q8PB 4M9HA 1J2MA 4RUAA 3PX0A 4C4RA 1S76D 3PR5B 3WK9A 1S77D 3AN1A 1V97A 1NK9A 4JWMA 3SR6A 5AI5A 1NOMA 2OM6A 3OHBA 2YB4A 3PW2A 2QARA 3RH4A 7ICRA 3EPGA 5B66U 1IG6A 4YN4A 1QSSA 2WF9A 1NZBA 2AJQA 4CF4A 8ICWA 2NYVA 2RDJA 4R63A 3RF9A 4GXIA 3SZ2A 2RP5A 3RBDA 3PX6A 1PVQA 3UMCA 2ZTEA 2A1AA 1XSLA 2HBKA 5J0WA 3IP4B 5DB9A 4KLJA 1BPXA 1KRPA 1LB2B 4NJ8A 1JMSA 3M9MB 2KJ5A 4ECRA 3QUTA 4QZBA 1XWLA 2M9NA 4GFJA 4NV0A 5KFFA 1M6YA 2RDIA 1ZD2P 3RJGA 3ZDEA 3BQ1A 2A3VA 4F5RA 3ZDCA 5AKJA 1NK5A 3HKZF 1HUZA 2H3QA 5EE0A 1TK5A 1GO3F 5KFUA 1T7PA 1KFSA 5F9LA 4DCCA 4OJ5A 4EYIB 2DL0A 3UPQA 4ELVA 8ICLA 4B9TA 3ETLA 2RHFA 5ALWA 2ZXIA 3VC8A 4ICAA 4DF4A 1S0OA 3CRXA 2JZBB 2LYAA 4B9NA 5KG5A 5J0XA 1TKDA 4I2CA 5BOLA 2V4RA 4FBUA 2HBJA 2FE9A 2RRDA 4YP3A 2BDPA 4ACOA 4USAA 5C5JA 5KT4A 2XY5A 4UASA 3MGHA 3WU2U 2AQ0A 4QZDA 2W9BB 4YXMA 1T8EA 2BPFA 4C4TA 1SWWA 3RJEA 1JROA 1YT3A 4O5CA 1WUDA 2KD1A 2AGPA 2OHFA 1RDFA 4PJ0U 3B9JA 4QJFB 1L8OA 1KKXA 4F5NA 3I76A 4Q8FA 4Q43A 2YY6A 5EWEA 3QNMA 4M9NA 4O5KA 1RPLA 1BGXT 3IHQB 1NK7A 2DKZA 3DV9A 2MSNA 1F5SA 4QZFA 1BPDA 4ECTA 4ZH4A 7ICNA 5DB6A 2NO5A 1NI3A 5J8YA 4RT3A 2ISPA 2HCFA 4IR1A 9ICKA 9ICCA 1TE2A 2YMPA 2BDUA 3D2NA 2HHSA 3MFIA 3QUQA 5T14A 1NZPA 2E8NA 4K4IA 3PSPA 4KLFA 3BQ2A 4M2YA 1QQ5A 3AM9A 1J97A 4RPYA 4CNQA 4FFDA 4EENA 2C22A 2OCEA 5ALMA 4J9RA 3TARA 1ED1A 5C0YA 2DUYA 2HDOA 2W7OA 4F5OA 2FI1A 4ECZA 3AU6A 2R8KA 4MHVA 1TFRA 4Y2SA 4US9A 1SL1A 3MFHA 3N4MB
chains in the Genus database with same CATH topology
4IC9A 2K89A 2W03A 2E5SA 4CDGA 3CRXA 2D6FC 4OJOA 2HOQA 4NLCA 2LYAA 2G06A 2JMGA 1KBUA 1DRGA 3C29A 2DQNB 2VIXA 4OO1J 2K8CB 3F5AA 3SMVA 2G5IB 1ECWA 1SZHA 2OM6A 2VJ4A 3PSTA 3C28A 2JH7A 2HBJA 3F2BA 2N1RA 2RRDA 2ZIWA 2YB4A 2R18A 3F53A 1A0PA 3HKZC 4P0QA 2F8LA 4ACOA 3ALRA 2Y0SF 2ZIWB 1ZQ1C 2E1EA 2ZIVB 2PMZC 2CRXA 2HBMA 2YX8A 2PMZF 3D2QA 3OPXA 1UPHA 2ZIXA 3DEEA 4OJ6A 2K4HA 2HOIA 3LVWA 3IN5A 1NZBA 2ZIXB 2JGAA 2G5HB 3K1ZA 2WAQC 3AQEA 1URJA 1YT3A 3NRWA 3F2CA 2ZXHA 2G0AA 1WUDA 2OH2A 2KD1A 1CRXA 4CRXA 2K8BB 4FZNA 3GZFA 4KMOB 2K4EA 3RF9A 3AL0B 2GH1A 2Z7JA 2H3VA 3F2DA 4OJLA 3PSFA 4A8EA 1P7DA 2RP5A 2E1FA 3KFUF 1HIWA 2H3IA 1Z19A 5KL8B 4AYBC 3O0FA 2K8AA 4QJFB 2KVCA 1PVQA 1Z1BA 4P0QB 4PL2A 2NV3A 4CGZA 2F76X 2KKPA 3N7SC 4AYBF 2HOFA 2HBKA 2OYYA 3PSIA 3SQIA 3IP4B 4O3MA 4P0PB 4QNLA 2LHTA 4BUGA 2Q4TA 2YB1A 2G07A 2XVTA 1PVPA 2M0NA 2F2AB 3H0LB 3M7DA 1Q3UA 2KJ9A 2MRLA 3T79A 1F44A 1IIPA 1TAMA 2VKQA 4FZLA 3ICXA 3SAFA 2ZIUB 3L3FX 4QIWC 2WB1C 3D2SA 3M6ZA 1D8BA 1XNSA 3AQFA 3H0MB 1HEKA 5A0LA 2KIWA 3F5EA 2K4IA 2W04A 2KJ5A 1T94A 4FZMA 4NWIA 3N7PD 2CPRA 4C0ZA 3PZPA 1MA7A 1L6NA 2XI9A 3LVVA 3N7RC 2DF4B 2ZIVA 3GU3A 4GFJA 2MA1A 4NV0A 3IG8A 3VCBA 3SAGA 3IG5A 4U6PA 2G08A 4U7CA 3SAHA 2A3VA 2KICA 2BDUA 2Y0SC 3D2NA 2OXOA 3CYMA 2HBLA 2DGZA 3KZXA 2VJ5A 3HKZF 4BJQA 2ZIUA 2LBOA 5T14A 3ONNA 2H3QA 3PSPA 2JHDA 2KEYA 3CP8A 5HR6A 4KX3A 2F77X 2WAQF 2H3FA 3H0RB 2CN1A 2KHQA 4PL1A 5KL1B 1GO3F 2KKVA 2KV2A 4OJPA 2XIDA 2WB1F 4JMUA 4BX9C 1XO0A 2G09A 3M6KA 1A6SA 2LYBA 2KJ8A 2W7PA 2XICA 1ED1A 4OJ5A 5C0YA 1PVRA 2W7OA 2JH1A 3E0FA 3VC8A 4P0PA 2KOBA 2ZG6A 4WJ3B 2HMXA 3MGVA 3NUQA 2H3ZA 3LYSA 4KX5A 1Q3VA 5CRXA 2LKYA 4NLBA 4FE3A 1OUQA 2KHVA 2RHFA 3RFAA 2KNJA 4QIWF 2ZXIA 2GOLA 4ICAA 5HR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CRX A;  2KD1 A;  2KEY A;  1CRX A;  3CRX A;  2KHQ A;  1KBU A;  4A8E A;  2KKV A;  1XNS A;  3C29 A;  1P7D A;  1DRG A;  1F44 A;  1Z19 A;  2KIW A;  1XO0 A;  2KJ5 A;  1PVQ A;  3C28 A;  2KJ8 A;  1Z1B A;  1MA7 A;  1PVR A;  1A0P A;  2KKP A;  4ACO A;  2HOF A;  2KOB A;  3MGV A;  2CRX A;  3LYS A;  1Q3V A;  5CRX A;  2A3V A;  2HOI A;  1NZB A;  2OXO A;  1PVP A;  1OUQ A;  2KHV A;  1Q3U A;  2KJ9 A;  3NRW A; 
#chains in the Genus database with same CATH topology
 3HPO A;  4M9J A;  4F71 A;  5AIC A;  4J9K A;  4IR9 A;  1KBU A;  3LWM A;  2VIX A;  3PW0 A;  4OCZ A;  4ECW A;  2R18 A;  4UQG A;  1A0P A;  5L1L A;  4Q45 A;  3NGD A;  1ZQN A;  2CRX A;  4PHD A;  5ALU A;  2HOI A;  3RRH A;  9ICI A;  1MQ3 A;  2K4P A;  5J0Q A;  2ASJ A;  2P35 A;  5ALF A;  4NLN A;  2YQE A;  2E8O A;  5AM0 A;  2Z7J A;  1KEJ A;  3PSF A;  3C2L A;  4DFM A;  1L3V A;  1WWU A;  3N7S C;  4I28 A;  4PGQ A;  5IIM A;  4K4H A;  4ED3 A;  2BCQ A;  3QZ8 A;  3WKA A;  1PVP A;  4DLG A;  4F3O A;  1ZQK A;  5KFE A;  1SIJ A;  1KLN A;  4UB8 U;  5AM5 A;  1S97 A;  4PH5 A;  4OD0 A;  1HJP A;  5EOZ A;  3AMZ A;  2PI5 A;  2KIW A;  2W04 A;  1T94 A;  5KFA A;  2LPE A;  1PK3 A;  2IA6 A;  1ZQX A;  5KNI A;  3HT3 A;  4I2I A;  3E58 A;  1WCN A;  4U7C A;  3OSN A;  3HIL A;  4EBD A;  3UXN A;  4DFJ A;  3KZX A;  3TFR A;  2YML A;  4DLE A;  2KSO A;  2JHD A;  4GC7 A;  1ZQF A;  3TAC B;  5AM3 A;  1ZQZ A;  1J2N A;  4OJP A;  4PZO A;  4QWC A;  2XIC A;  4F2R A;  3V6J A;  2BR0 A;  1Q8K A;  4YR2 A;  1B4F A;  2ZG6 A;  2HMX A;  1KQQ A;  3ZD9 A;  2GOL A;  4NLB A;  4KIT B;  4QZ8 A;  1RXV A;  4B9M A;  4CDG A;  4EX6 A;  4M9G A;  5AM4 A;  4PHP A;  2KVS A;  5HNK A;  2ZUB A;  2C2D A;  3SMV A;  4B9L A;  2FJ6 A;  2W9C A;  2A1J A;  3RAQ A;  2ZIW B;  4TQS A;  3OTQ A;  2ZIV B;  2PMZ C;  1ZYQ A;  7ICG A;  2L5Y A;  1S0N A;  2JGA A;  2IHM A;  2RLT A;  1N61 A;  2NRT A;  5KFQ A;  3L5K A;  4GXK A;  1CRX A;  1LKY A;  2JEI A;  2WF7 A;  4OJL A;  3JPQ A;  3E2E A;  3PR4 A;  2BQR A;  5J2D A;  3ZDD A;  2HOF A;  4QZI A;  4R8U B;  3SQI A;  5EE3 A;  2ODG A;  2PFN A;  1A76 A;  1X9M A;  2J6U A;  3WKB A;  9ICR A;  4KLU A;  1NJZ A;  3C1Z A;  5L1K A;  1UHU A;  5ALR A;  5J0R A;  5KT5 A;  5A0L A;  2PFO A;  4B9V A;  4XUS A;  2OWO A;  2BPG A;  1ZQM A;  1JI7 A;  3QYP A;  3IG8 A;  3JPO A;  4X5V A;  1RQN A;  2Y0S C;  1L7P A;  3PV8 A;  3WK7 A;  4DSK A;  7ICS A;  4GXJ A;  2VJ5 A;  8ICU A;  3PW7 A;  3ONN A;  2GWS A;  4IRK A;  3MC1 A;  1IM4 A;  4C7Y A;  1ZQP A;  4TUS A;  3RB0 A;  1ZQT A;  2FMQ A;  4BWJ A;  1PVR A;  3GV7 B;  3RJH A;  7ICL A;  4I2F A;  5CWR A;  1S0V A;  1KL9 A;  5AK5 A;  3PO5 A;  2AQ4 A;  3RFA A;  4QIW F;  3GIM A;  3WKE A;  4RNN A;  3KKA A;  2ESE A;  9ICM A;  2PFP A;  1QLN A;  1JX4 A;  4DSL A;  1DRG A;  4NLG A;  3MDC A;  2K8C B;  1Z3E B;  1COO A;  1L3S A;  1WG8 A;  3F53 A;  4Y2T A;  4J9S A;  4DOC A;  1CI4 A;  1UT5 A;  2HBM A;  2ZIX A;  1NJW A;  3OJU A;  3K1Z A;  2WAQ C;  7ICQ A;  3F2C A;  4KMO B;  2K4E A;  5KFR A;  2W8L A;  4P4P A;  3ED5 A;  2K8A A;  2KVC A;  4PL2 A;  3MR2 A;  2F76 X;  3WK4 A;  4DS4 A;  1AQ6 A;  2B21 A;  4KTQ A;  2W9C B;  1HUO A;  5ALZ A;  4XRH A;  4BGD A;  5D46 A;  1QTM A;  2XVT A;  1U9L A;  5DLG A;  3QUC A;  4HAI A;  4Z6C A;  3D2S A;  8ICF A;  1IV8 A;  4ED6 A;  5AI0 A;  2QAR B;  4ED7 A;  2HHW A;  2W43 A;  2XY6 A;  2BCR A;  2JEF A;  3ZDA A;  2MA1 A;  5AIB A;  5J8Y C;  8ICQ A;  2DWQ A;  5KG1 A;  1V85 A;  5J0S A;  2KIV A;  1T3Q A;  3M6K A;  5ALN A;  1ZD3 A;  4KLT A;  5KFW A;  2GLE A;  8ICG A;  2BCS A;  1QQ7 A;  4YVZ A;  2FPM A;  4QWA A;  9ICH A;  3M8R A;  2RQ5 A;  4E0D A;  5BOM A;  2J6T A;  2K89 A;  4ED1 A;  2ASD A;  4OJO A;  4M0A A;  3BZC A;  3U26 A;  4F2S A;  3C2K A;  2N1R A;  3EYZ A;  1X6I A;  3QU2 A;  2DPJ A;  2E1E A;  4YQW A;  3FDS A;  2HHX A;  4KLI A;  5J2A A;  4ECV A;  4J9M A;  1ZQY A;  2ZXH A;  1BPY A;  1U4B A;  2F8K A;  5HHI A;  4KLO A;  4RQ0 A;  5AKE A;  3IRU A;  1ZQA A;  1ZQR A;  3KFU F;  4R64 A;  5KL8 B;  2V4Q A;  4CGZ A;  1T3N A;  3HWT A;  9ICA A;  1SV4 A;  3WKD A;  2OYY A;  4EYH B;  4FS1 A;  4RQ1 A;  4MF8 A;  3QEB Z;  5EE1 A;  1WWV A;  4M6W B;  2G07 A;  4KMU A;  9ICO A;  3H0L B;  1Q3U A;  1F44 A;  1D9D A;  4C80 A;  1IIP A;  4O0I A;  3UXP A;  4RQ4 A;  5AK6 A;  2VA3 A;  7ICK A;  4EX7 A;  4UB6 U;  4RQ3 A;  1XU4 A;  5KTQ A;  4C8K A;  1PK1 B;  2BGW A;  3LDA A;  1ZQI A;  4DL2 A;  4F4Z A;  5CEH A;  2HHT A;  3C5G A;  4RQM A;  1N5X A;  2YTU A;  3HW8 A;  5AKZ A;  2EAO A;  2C28 A;  1JXE A;  4DQQ A;  3KTQ A;  1L8L A;  3ZD8 A;  1TK8 A;  5KG7 A;  1Z4O A;  2C2E A;  2W9M A;  5ALG A;  2Q0Z X;  4TUP A;  1K5O A;  4DF8 A;  1RYS A;  4UBB A;  8ICV A;  1V9P A;  2IOH A;  4FE3 A;  2KNJ A;  5F9N A;  5DGB A;  2D3D A;  3EPI A;  4PZN A;  3PML A;  5ALJ A;  1D8Y A;  3KD3 A;  3SYZ A;  3PNC A;  8ICR A;  4GC6 A;  9ICS A;  4IQT A;  2FLP A;  1X9S A;  4KLG A;  2W11 A;  2EDU A;  3MGI A;  5ALE A;  5DG9 A;  4YD2 A;  2MUT A;  4DFD A;  5KFT A;  3RH6 A;  4UB5 A;  8ICT A;  5J0P A;  4FZN A;  7ICF A;  2ZUD A;  4US8 A;  1N5W A;  2HI0 A;  5CA7 A;  1U45 A;  4Y2P A;  5AKL A;  5DG7 A;  3H8W A;  5KFI A;  3RB6 A;  3KOO A;  5KFB A;  2OEH A;  4F50 A;  2KJ9 A;  2MRL A;  4F8R A;  4B9U A;  3ICX A;  3CNH A;  2W54 A;  4QWE A;  5F3X B;  2ASL A;  4I29 A;  1D8B A;  4C8O A;  1DGS A;  1JN3 A;  2IHN A;  3H0M B;  3T5K A;  2KN7 A;  3JPT A;  9ICB A;  4Y2V A;  5AI8 A;  4DL3 A;  1S0M A;  2IOF K;  4G3I A;  2G08 A;  4LZG A;  4BDP A;  3SEN A;  3THV A;  4P2H A;  2QB0 A;  4O5E A;  2UVW A;  2K60 A;  5J2B A;  2F77 X;  4UAW A;  8ICE A;  1SKR A;  4RNM A;  8ICJ A;  3IV6 A;  5DQI A;  1XO1 A;  4BX9 C;  1XO0 A;  3H8M A;  9ICW A;  2LYB A;  4KLM A;  3Q8K A;  4CF5 A;  4F92 B;  1V38 A;  1PK1 A;  5JUM A;  1NK8 A;  1NK4 A;  1L7M A;  3BQ7 A;  3NUQ A;  4C8N A;  4QZG A;  3CW2 C;  3RBE A;  5AI9 A;  3BJY A;  1ZQC A;  1SWV A;  4IQW A;  1QSY A;  4IC9 A;  2W03 A;  5IIL A;  4O3S A;  2NO4 A;  2HOQ A;  1N2X A;  4ED0 A;  1TV9 A;  8ICI A;  4Y2U A;  7ICP A;  2G5I B;  3RR8 A;  3TFS A;  4QZ9 A;  2W9B A;  5AM2 A;  4DS5 A;  5KFJ A;  5ALS A;  3V7L A;  2W55 A;  1BNP A;  2KSO B;  1BNO A;  3ZI4 A;  5JTI A;  1ZQQ A;  3AEV A;  4CRX A;  3AUO A;  2Y9U A;  2GH1 A;  3GV5 B;  5G5H A;  1JRP A;  1RYU A;  1X9X A;  4M9L A;  2NV3 A;  1X42 A;  5J2F A;  2KKP A;  2ISO A;  5J2I A;  1KDH A;  2V9W A;  2R8J A;  3QXG A;  5EE9 A;  2AXT U;  4IQV A;  1U49 A;  3QU4 A;  3JPR A;  1FIQ A;  2I6X A;  5CR0 A;  1DK2 A;  5ALV A;  1XSP A;  2CXY A;  1TAM A;  3T3F A;  5D49 A;  4DOB A;  3RB4 A;  4BXO B;  5L1I A;  4TUQ A;  1XNS A;  4JV2 A;  3QUB A;  2K4I A;  4FZM A;  4QW9 A;  3GIL A;  3N7P D;  2FLL A;  1ZD5 A;  2LM4 A;  2XI9 A;  2DF4 B;  9ICJ A;  2PI4 A;  7ICV A;  2FPL A;  4YCX A;  4DL6 A;  9ICL A;  1Q46 A;  3Q8S B;  4BJQ A;  5AK4 A;  1RQL A;  4KLD A;  5HR6 A;  4Y2Q A;  2WAQ F;  3H0R B;  2KKV A;  3H7I A;  4JMU A;  5KG2 A;  4O3Q A;  7ICJ A;  2AH5 A;  2YMM A;  3E0F A;  2MUT B;  4P4O A;  1DGJ A;  3C2M A;  5ALY A;  2KHV A;  3A0H U;  4I2B A;  1L3U A;  4KLS A;  2BQU A;  3PY8 A;  4NLC A;  3HX0 A;  2QB1 A;  2P6U A;  3NVW A;  5DKW A;  2KFN A;  3S6J A;  1PUZ A;  3MR6 A;  4YMM A;  3RH5 A;  4O3N A;  1U48 A;  1O08 A;  3FM9 A;  2YX8 A;  5EWG A;  2HSZ A;  2H5X A;  4FS2 A;  3NRW A;  3BS5 B;  3TAD A;  1QH9 A;  9ICX A;  1IXR A;  3T5H A;  3OHA A;  1Z00 B;  4RQ5 A;  3V72 A;  4BUG A;  5HP4 A;  2F2A B;  1ZJM A;  5DLF A;  4I2D A;  3K1R B;  2HVH A;  4B9S A;  4JV0 A;  2VKQ A;  4RNO A;  5H2F U;  2I1Q A;  5IIO A;  3TAN A;  5DG8 A;  2HHV A;  3AQF A;  7ICH A;  4RPX A;  4F93 B;  3HP6 A;  4QZA A;  5DGA A;  4TQR A;  4G9B A;  2DKX A;  3M9O B;  1WYG A;  2KIC A;  2OXO A;  2HBL A;  3QX7 A;  2BCV A;  1FEZ A;  4DO9 A;  3QE9 Y;  3QZ7 A;  1B0X A;  5AI6 A;  1D9F A;  4PL1 A;  4LJX A;  2ZJA A;  4BWM A;  2G09 A;  1A77 A;  4IRD A;  5AKH A;  5AKI A;  5JU5 A;  3GV8 B;  3V6K A;  3GIJ A;  1ZQE A;  3IM1 A;  2XY7 A;  3GFK B;  1SB3 C;  2LKY A;  1UCV A;  3NVZ A;  3SEI A;  2NRW A;  1CUK A;  1SXE A;  5KFP A;  1BPE A;  4NL9 A;  3ALR A;  2FLN A;  2EZX A;  4GLX A;  1UPH A;  5AK3 A;  1O03 A;  3AQE A;  2Y1I A;  1N62 A;  3AU2 A;  4KLQ A;  3H4D A;  2WTF A;  4Y2J A;  3ZDB A;  3N28 A;  4B6J A;  3G6Y A;  2ZTD A;  2BHN A;  4O9M A;  4DFK A;  1L5U A;  4P0Q B;  2JEJ A;  4QWB A;  3WK8 A;  1SL2 A;  3RR7 A;  4J9P A;  8ICA A;  4AYB F;  1NKE A;  3HRD D;  2XC9 A;  1U47 A;  2F1H A;  5B5E U;  3TAP A;  5KT6 A;  2QB0 B;  3SAF A;  5KFN A;  3UQ2 A;  8ICN A;  4RPZ A;  8ICK A;  4NLK A;  1HEK A;  3RJI A;  2VA8 A;  4UW9 A;  1ZQD A;  3BZK A;  1XC9 A;  3GQC A;  4DSJ A;  5J2J A;  5ALD A;  1L7O A;  4NM1 A;  2ATL A;  2P66 A;  4EZ9 A;  4ECY A;  7ICU A;  1S9F A;  2H3F A;  1ZQS A;  3KHG A;  8ICH A;  1DK3 A;  1K1S A;  5CB1 A;  4DQS A;  1A6S A;  1UA1 A;  3R9K A;  5ALH A;  3JPN A;  2IBK A;  3MGV A;  4Z6D A;  2DBY A;  1Q3V A;  3NTU A;  5DBB A;  5E79 U;  1KW4 A;  3UQ0 A;  3PVX A;  1RXW A;  4KLH A;  5IIN A;  4ECQ A;  3DEE A;  8ICC A;  5HR7 A;  4I2H A;  3J81 j;  2E5S A;  1BPZ A;  2KZM A;  2EQY A;  2G06 A;  2ZJ5 A;  3K75 D;  3WKC A;  3PMN A;  1ECW A;  5KFX A;  2JV3 A;  5AIA A;  2JH7 A;  3RJF A;  1ZQ1 C;  3WK5 A;  1ZRM A;  1ZQJ A;  3IN5 A;  3KZI U;  2XCA A;  2AHO B;  5KG3 A;  5CP2 A;  1PZN A;  5J2G A;  2H3V A;  3MAB A;  4KLL A;  9ICF A;  3LWL A;  5KFV A;  2H3I A;  4DSI A;  8ICB A;  4J03 A;  9ICE A;  2VA2 A;  3PX4 A;  4RT2 A;  5DQH A;  1BPB A;  4R8U A;  3BS7 A;  4KLE A;  1ZJN A;  1X40 A;  4JV1 A;  2VAN A;  1YZ6 A;  3FC4 A;  2QLT A;  3H4B A;  3C21 A;  2UVR A;  2A1J B;  4C0Z A;  1F0M A;  1L6N A;  3N7R C;  2ZIV A;  3GU3 A;  4DEZ A;  3VCB A;  2MU2 A;  3DDH A;  8ICS A;  2DPI A;  3IG5 A;  2PXI A;  3K4G A;  2C2R A;  1Z4N A;  4Z6F A;  1WCL A;  2KP7 A;  3EZ5 A;  2DGZ A;  3T5J A;  1LKY B;  1ZQW A;  2R8I A;  4MFF A;  3JPS A;  2KV2 A;  4C4S A;  3MDA A;  2BQ3 A;  2YMQ A;  4UAU A;  5KFZ A;  1S8O A;  4ED2 A;  1MQ2 A;  4J9N A;  3PO4 A;  4M04 A;  1N63 A;  4KX5 A;  3Q8M A;  1MC8 A;  2EAN A;  3QU9 A;  4QWD A;  4NL9 C;  1H38 A;  1TAU A;  4JK1 A;  1QQ6 A;  2WF8 A;  2D6F C;  2GO7 A;  4RQN A;  1SKS A;  5CHG A;  3RJJ A;  1CEZ A;  5J0U A;  9ICT A;  4UB1 A;  3C28 A;  4P4M A;  1ZQV A;  2I9G A;  1KFT A;  2AGO A;  4YMO A;  3I28 A;  1DOQ A;  4Y2R A;  4Q8E A;  3D2Q A;  1N60 A;  3NAS A;  1SXD A;  2ZIX B;  4O3R A;  8ICO A;  2G0A A;  4UAR A;  3EUB 2;  2Y1J A;  3GZF A;  4RUC A;  4JWN A;  4A8E A;  1P7D A;  5JRT A;  3JPP A;  9ICQ A;  1SV0 C;  3TKA A;  7ICT A;  2E3T A;  5ALT A;  2EH9 A;  3B0Y A;  2NRV A;  4ZOH C;  4QZC A;  3RRG A;  1RYR A;  4P0P B;  2I5H A;  4FBT A;  2HHU A;  4UB4 A;  1JIH A;  3M7D A;  3T79 A;  4DL5 A;  3Q8R B;  2O6K A;  3PW4 A;  1RZT A;  1MA7 A;  4LVS A;  3H8J A;  2LM1 A;  4KN4 A;  2IMW P;  4YD1 A;  3SI8 A;  1OW5 A;  1EXN A;  3RTV A;  3EWA A;  2FDR A;  1ZQO A;  4CF3 A;  1KSP A;  1VJ5 A;  5KG0 A;  2KTQ A;  5GTH U;  3MR5 A;  3OJS A;  5EWF A;  2KOB A;  2FPK A;  5ALP A;  1SV0 A;  1S10 A;  4DQP A;  2LI6 A;  5AKY A;  4DFP A;  4J9O A;  4O3P A;  5DB8 A;  4UBC A;  2XCP A;  5KG6 A;  5DB7 A;  3TAQ A;  2BPC A;  1SZH A;  3KHH A;  2VJ4 A;  5K4L A;  5J2C A;  2ZIW A;  1ZQU A;  1DXS A;  4P0Q A;  2Y0S F;  2JRZ A;  4Y2Y A;  4PGY A;  8ICY A;  1KN5 A;  3OPX A;  3GDX A;  3HJE A;  4ECU A;  3LVW A;  7ICE A;  5KAF U;  5J0Y A;  3BQT A;  5DDY A;  3UM9 A;  1NNL A;  5J2H A;  1NKC A;  1URJ A;  2WHE A;  1C20 A;  2BZF A;  4DL4 A;  3V7J A;  2QKQ A;  2JEG A;  4I2E A;  4IRC A;  2LYH A;  3C5F A;  2F1I A;  4MEX A;  1K1Q A;  1XS9 D;  4J9Q A;  1Z1B A;  4F72 A;  3OGU A;  1ZET A;  5TZV A;  1FFU A;  1QSL A;  4O3M A;  4QNL A;  2LHT A;  2R8G A;  2Q4T A;  2FMP A;  2M0N A;  1SZP A;  5J2E A;  2FMS A;  3A0B U;  5IIJ A;  4EEK A;  4YR3 A;  3MBY A;  1KTQ A;  4RQ7 A;  4F4K A;  1X66 A;  4I2A A;  2NRX A;  2CPR A;  1ZXI A;  3SAG A;  4GIB A;  3BQ0 A;  4UAZ A;  3N97 B;  1UA0 A;  3CYM A;  1QCK A;  2PKE A;  3CP8 A;  5ALX A;  4DQR A;  1X2I A;  9ICU A;  4F4W A;  5KL1 B;  4IS7 A;  4O3O A;  2XID A;  3ISC A;  2F44 A;  3ETR A;  3C1Y A;  1NJY A;  2H3Z A;  3LYS A;  5ALO A;  4F5P A;  5GTI U;  3LK9 A;  4F5Q A;  5AKG A;  1OUQ A;  3NVY A;  1ZD4 A;  4NM2 A;  3I1Y A;  9ICP A;  5FP0 A;  4DL7 A;  1COK A;  5ALL A;  4RZR A;  3C29 A;  2DQN B;  1B22 A;  4KN7 A;  3PST A;  3F2B A;  2KK0 A;  1ZQL A;  8ICM A;  4QZE A;  4EEY A;  1OXJ A;  2HHQ A;  3IDW A;  2K4H A;  3SD7 A;  5AM1 A;  3V6H A;  4OO1 J;  5CJ7 A;  1NKB A;  4MF2 A;  4XQ8 A;  4C8L A;  1LVH A;  5L9X A;  2JR5 A;  3Q8L A;  4RQ6 A;  1Z19 A;  2A19 A;  1L3T A;  4AYB C;  1RM6 C;  4FO6 A;  3SV3 A;  3PSI A;  5HML A;  2UVV A;  2YB1 A;  4EBE A;  3TQ1 A;  2NRZ A;  4AP9 A;  3QU7 A;  2W9A A;  3L3F X;  2XGP A;  2WB1 C;  7ICO A;  1S5L U;  5KFG A;  2PFQ A;  3F5E A;  2XO7 A;  4C7Z A;  4DSE A;  3ISD A;  2AGQ A;  3T5L A;  1ARO P;  2WFA A;  3PZP A;  4Z6E A;  3LVV A;  3QEA Z;  1X6J A;  3M8S A;  5KFM A;  2AU0 A;  4ECX A;  5KT7 A;  3L4P A;  3SAH A;  1NK0 A;  1LV5 A;  4PGX A;  1X9W A;  3H8S A;  1SGG A;  4ELT A;  8ICP A;  5KFK A;  4UAT A;  3G6V A;  3Q8Q B;  4J9L A;  2W3R A;  9ICN A;  3GIK A;  2WB1 F;  2KZZ A;  3D6J A;  2B6G A;  2LMR A;  2KMD A;  3C23 A;  1L7N A;  5KFD A;  1ZQG A;  4YXJ A;  5CRX A;  4PPX A;  4PHE A;  3TAD C;  3B0X A;  5G5G A;  5TIS U;  2KFZ A;  4MFA A;  5AKK A;  8ICX A;  2JMG A;  1TK0 A;  1FFV A;  3FYH A;  1VDV A;  1UQV A;  1RG6 A;  1JXL A;  3RB3 A;  4I27 A;  2XGQ A;  1MN8 A;  5KT2 A;  4RQ8 A;  2F8L A;  4IQU A;  4LZD A;  2HW3 A;  1TVA A;  5J0T A;  1MSW D;  2PMZ F;  4DOA A;  1SKW A;  3RJK A;  5J29 A;  2BCU A;  2YN4 A;  4UB3 A;  4R65 A;  2W3S A;  5AHX A;  2OH2 A;  2K8B B;  3AL0 B;  3BS5 A;  3SV4 A;  7ICI A;  5L1J A;  2E1F A;  2EAP A;  1HIW A;  4PHA A;  4EEL A;  5DQG A;  4I2J A;  4M6W A;  5KFO A;  4UB2 A;  3H40 A;  5HMM A;  3M1Y A;  5KFH A;  2MAX A;  5J0O A;  2ZIU B;  3KHL A;  3TI0 A;  7ICM A;  4BXO A;  2Y9T A;  1JUD A;  4NWI A;  3WK6 A;  4M47 A;  5IIK A;  4U6P A;  5DBC A;  4Y2X A;  5KAI U;  3EW9 A;  2KZ3 A;  5KFC A;  2ZIU A;  4ELU A;  4KX3 A;  1Y88 A;  2ES6 A;  5ALI A;  4YG2 A;  4UAV A;  2KJ8 A;  2W7P A;  4EBC A;  1ZQH A;  2D8C A;  4F91 B;  3OSP A;  2JH1 A;  4R66 A;  8ICZ A;  2BKE A;  5KT3 A;  4K4G A;  2F1J A;  4DWI A;  5KFS A;  3M9N B;  5KFY A;  4YMN A;  3RAX A;  4YFK A;  3KBB A;  2KG5 A;  5KFL A;  2DFL A;  1FO4 A;  4QZH A;  2R8H A;  2ZTC A;  4MFC A;  1C7Y A;  1ZOL A;  3F5A A;  3KKA C;  4NXZ A;  3V7K A;  4I2G A;  3HKZ C;  3ORY A;  5DBA A;  1D8L A;  4NLZ A;  4C8M A;  2IOF A;  2WF6 A;  5J2K A;  2UVU A;  4OJ6 A;  1ZRN A;  2ALZ A;  4Q44 A;  3UMB A;  4TUR A;  3FAH A;  2G5H B;  2E8M A;  2EZZ A;  3BDP A;  1SL0 A;  4DQI A;  3MR3 A;  3F2D A;  2HVI A;  1B43 A;  3ISB A;  1VLB A;  2JZB A;  5HHH A;  3O0F A;  2ZJ8 A;  5ALK A;  5KG4 A;  2JXJ A;  4JUZ A;  4HYK A;  2P6R A;  2WF5 A;  2ZUC A;  5DDM A;  2B0C A;  1Z00 A;  5L1M A;  2F3N A;  4MEY A;  5III A;  1XSN A;  3NRZ A;  4RU9 A;  4ED8 A;  1YZ7 A;  1ZQB A;  4XA5 A;  2KE7 A;  1Z1V A;  4QW8 A;  9ICG A;  9ICV A;  4JB3 A;  4FZL A;  2J6S A;  4QIW C;  3UMG A;  1BVS A;  1KFD A;  3M6Z A;  3GII A;  4NY8 A;  1NK6 A;  3PW5 A;  4CE6 A;  4F4Y A;  3G6X A;  1JAL A;  5ALQ A;  1T4G A;  3UXO A;  1N48 A;  2W8K A;  1NJX A;  2E8P A;  5AKX A;  5BPC A;  3QU5 A;  2LBO A;  2KEY A;  3NVV A;  4YR0 A;  4F4X A;  2CN1 A;  2KHQ A;  4IL6 U;  2EZY A;  4UAY A;  1TAQ A;  4RQ2 A;  4ECS A;  3NS1 A;  4EZ6 A;  2EAM A;  1N56 A;  1UT8 A;  5D4B A;  4CCH A;  4P0P A;  4WJ3 B;  5AI4 A;  3KHR A;  4DSF A;  3Q8P B;  4M9H A;  1J2M A;  4RUA A;  3PX0 A;  4C4R A;  1S76 D;  3PR5 B;  3WK9 A;  1S77 D;  3AN1 A;  1V97 A;  1NK9 A;  4JWM A;  3SR6 A;  5AI5 A;  1NOM A;  2OM6 A;  3OHB A;  2YB4 A;  3PW2 A;  2QAR A;  3RH4 A;  7ICR A;  3EPG A;  5B66 U;  1IG6 A;  4YN4 A;  1QSS A;  2WF9 A;  1NZB A;  2AJQ A;  4CF4 A;  8ICW A;  2NYV A;  2RDJ A;  4R63 A;  3RF9 A;  4GXI A;  3SZ2 A;  2RP5 A;  3RBD A;  3PX6 A;  1PVQ A;  3UMC A;  2ZTE A;  2A1A A;  1XSL A;  2HBK A;  5J0W A;  3IP4 B;  5DB9 A;  4KLJ A;  1BPX A;  1KRP A;  1LB2 B;  4NJ8 A;  1JMS A;  3M9M B;  2KJ5 A;  4ECR A;  3QUT A;  4QZB A;  1XWL A;  2M9N A;  4GFJ A;  4NV0 A;  5KFF A;  1M6Y A;  2RDI A;  1ZD2 P;  3RJG A;  3ZDE A;  3BQ1 A;  2A3V A;  4F5R A;  3ZDC A;  5AKJ A;  1NK5 A;  3HKZ F;  1HUZ A;  2H3Q A;  5EE0 A;  1TK5 A;  1GO3 F;  5KFU A;  1T7P A;  1KFS A;  5F9L A;  4DCC A;  4OJ5 A;  4EYI B;  2DL0 A;  3UPQ A;  4ELV A;  8ICL A;  4B9T A;  3ETL A;  2RHF A;  5ALW A;  2ZXI A;  3VC8 A;  4ICA A;  4DF4 A;  1S0O A;  3CRX A;  2JZB B;  2LYA A;  4B9N A;  5KG5 A;  5J0X A;  1TKD A;  4I2C A;  5BOL A;  2V4R A;  4FBU A;  2HBJ A;  2FE9 A;  2RRD A;  4YP3 A;  2BDP A;  4ACO A;  4USA A;  5C5J A;  5KT4 A;  2XY5 A;  4UAS A;  3MGH A;  3WU2 U;  2AQ0 A;  4QZD A;  2W9B B;  4YXM A;  1T8E A;  2BPF A;  4C4T A;  1SWW A;  3RJE A;  1JRO A;  1YT3 A;  4O5C A;  1WUD A;  2KD1 A;  2AGP A;  2OHF A;  1RDF A;  4PJ0 U;  3B9J A;  4QJF B;  1L8O A;  1KKX A;  4F5N A;  3I76 A;  4Q8F A;  4Q43 A;  2YY6 A;  5EWE A;  3QNM A;  4M9N A;  4O5K A;  1RPL A;  1BGX T;  3IHQ B;  1NK7 A;  2DKZ A;  3DV9 A;  2MSN A;  1F5S A;  4QZF A;  1BPD A;  4ECT A;  4ZH4 A;  7ICN A;  5DB6 A;  2NO5 A;  1NI3 A;  5J8Y A;  4RT3 A;  2ISP A;  2HCF A;  4IR1 A;  9ICK A;  9ICC A;  1TE2 A;  2YMP A;  2BDU A;  3D2N A;  2HHS A;  3MFI A;  3QUQ A;  5T14 A;  1NZP A;  2E8N A;  4K4I A;  3PSP A;  4KLF A;  3BQ2 A;  4M2Y A;  1QQ5 A;  3AM9 A;  1J97 A;  4RPY A;  4CNQ A;  4FFD A;  4EEN A;  2C22 A;  2OCE A;  5ALM A;  4J9R A;  3TAR A;  1ED1 A;  5C0Y A;  2DUY A;  2HDO A;  2W7O A;  4F5O A;  2FI1 A;  4ECZ A;  3AU6 A;  2R8K A;  4MHV A;  1TFR A;  4Y2S A;  4US9 A;  1SL1 A;  3MFH A;  3N4M B; 
#chains in the Genus database with same CATH homology
 4IC9 A;  2K89 A;  2W03 A;  2E5S A;  4CDG A;  3CRX A;  2D6F C;  4OJO A;  2HOQ A;  4NLC A;  2LYA A;  2G06 A;  2JMG A;  1KBU A;  1DRG A;  3C29 A;  2DQN B;  2VIX A;  4OO1 J;  2K8C B;  3F5A A;  3SMV A;  2G5I B;  1ECW A;  1SZH A;  2OM6 A;  2VJ4 A;  3PST A;  3C28 A;  2JH7 A;  2HBJ A;  3F2B A;  2N1R A;  2RRD A;  2ZIW A;  2YB4 A;  2R18 A;  3F53 A;  1A0P A;  3HKZ C;  4P0Q A;  2F8L A;  4ACO A;  3ALR A;  2Y0S F;  2ZIW B;  1ZQ1 C;  2E1E A;  2ZIV B;  2PMZ C;  2CRX A;  2HBM A;  2YX8 A;  2PMZ F;  3D2Q A;  3OPX A;  1UPH A;  2ZIX A;  3DEE A;  4OJ6 A;  2K4H A;  2HOI A;  3LVW A;  3IN5 A;  1NZB A;  2ZIX B;  2JGA A;  2G5H B;  3K1Z A;  2WAQ C;  3AQE A;  1URJ A;  1YT3 A;  3NRW A;  3F2C A;  2ZXH A;  2G0A A;  1WUD A;  2OH2 A;  2KD1 A;  1CRX A;  4CRX A;  2K8B B;  4FZN A;  3GZF A;  4KMO B;  2K4E A;  3RF9 A;  3AL0 B;  2GH1 A;  2Z7J A;  2H3V A;  3F2D A;  4OJL A;  3PSF A;  4A8E A;  1P7D A;  2RP5 A;  2E1F A;  3KFU F;  1HIW A;  2H3I A;  1Z19 A;  5KL8 B;  4AYB C;  3O0F A;  2K8A A;  4QJF B;  2KVC A;  1PVQ A;  1Z1B A;  4P0Q B;  4PL2 A;  2NV3 A;  4CGZ A;  2F76 X;  2KKP A;  3N7S C;  4AYB F;  2HOF A;  2HBK A;  2OYY A;  3PSI A;  3SQI A;  3IP4 B;  4O3M A;  4P0P B;  4QNL A;  2LHT A;  4BUG A;  2Q4T A;  2YB1 A;  2G07 A;  2XVT A;  1PVP A;  2M0N A;  2F2A B;  3H0L B;  3M7D A;  1Q3U A;  2KJ9 A;  2MRL A;  3T79 A;  1F44 A;  1IIP A;  1TAM A;  2VKQ A;  4FZL A;  3ICX A;  3SAF A;  2ZIU B;  3L3F X;  4QIW C;  2WB1 C;  3D2S A;  3M6Z A;  1D8B A;  1XNS A;  3AQF A;  3H0M B;  1HEK A;  5A0L A;  2KIW A;  3F5E A;  2K4I A;  2W04 A;  2KJ5 A;  1T94 A;  4FZM A;  4NWI A;  3N7P D;  2CPR A;  4C0Z A;  3PZP A;  1MA7 A;  1L6N A;  2XI9 A;  3LVV A;  3N7R C;  2DF4 B;  2ZIV A;  3GU3 A;  4GFJ A;  2MA1 A;  4NV0 A;  3IG8 A;  3VCB A;  3SAG A;  3IG5 A;  4U6P A;  2G08 A;  4U7C A;  3SAH A;  2A3V A;  2KIC A;  2BDU A;  2Y0S C;  3D2N A;  2OXO A;  3CYM A;  2HBL A;  2DGZ A;  3KZX A;  2VJ5 A;  3HKZ F;  4BJQ A;  2ZIU A;  2LBO A;  5T14 A;  3ONN A;  2H3Q A;  3PSP A;  2JHD A;  2KEY A;  3CP8 A;  5HR6 A;  4KX3 A;  2F77 X;  2WAQ F;  2H3F A;  3H0R B;  2CN1 A;  2KHQ A;  4PL1 A;  5KL1 B;  1GO3 F;  2KKV A;  2KV2 A;  4OJP A;  2XID A;  2WB1 F;  4JMU A;  4BX9 C;  1XO0 A;  2G09 A;  3M6K A;  1A6S A;  2LYB A;  2KJ8 A;  2W7P A;  2XIC A;  1ED1 A;  4OJ5 A;  5C0Y A;  1PVR A;  2W7O A;  2JH1 A;  3E0F A;  3VC8 A;  4P0P A;  2KOB A;  2ZG6 A;  4WJ3 B;  2HMX A;  3MGV A;  3NUQ A;  2H3Z A;  3LYS A;  4KX5 A;  1Q3V A;  5CRX A;  2LKY A;  4NLB A;  4FE3 A;  1OUQ A;  2KHV A;  2RHF A;  3RFA A;  2KNJ A;  4QIW F;  2ZXI A;  2GOL A;  4ICA A;  5HR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...