2KHVA

Solution nmr structure of protein nmul_a0922 from nitrosospira multiformis. northeast structural genomics consortium target nmr38b.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
MTFSECAALYIKAHRSSWKNTKHADQWTNTIKTYCGPVIGPLSVQDVDTKLIMKVLDPIWEQKPETASRLRGRIESVLDWATVRGYREGDNPARWRGYLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phage integrase
publication title Solution NMR structure of protein Nmul_A0922 from Nitrosospira multiformis. Northeast Structural Genomics Consortium target NmR38B.
rcsb
source organism Nitrosospira multiformis atcc 25196
molecule tags Structural genomics, unknown function
total genus 34
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2khvA01
2KKVA 1OUQA 3C29A 1Z1BA 1F44A 4A8EA 2HOFA 2HOIA 1XNSA 1Q3UA 1Q3VA 1KBUA 2KOBA 2KIWA 3NRWA 1XO0A 1CRXA 1MA7A 3CRXA 2KEYA 2KHQA 4ACOA 2CRXA 2KJ9A 2KKPA 1P7DA 3MGVA 1PVQA 1PVRA 1DRGA 2OXOA 1NZBA 5CRXA 3LYSA 2KD1A 1A0PA 2KJ8A 2A3VA 1PVPA 1Z19A 2KHVA 4CRXA 3C28A 2KJ5A
chains in the Genus database with same CATH superfamily
4F5NA 3KFUF 1KFDA 4RQ1A 1L5UA 3EWAA 5F9NA 8ICGA 5ALIA 1Z1VA 3EPIA 4R63A 7ICVA 2H3VA 2YX8A 8ICVA 5ALWA 3HP6A 4KLSA 1A6SA 1X9SA 5AI8A 2BCQA 2VJ4A 3GU3A 4FE3A 3H7IA 1WG8A 1UCVA 1ECWA 1XO1A 3TFRA 3HILA 3FAHA 4KX3A 5KT3A 5AI5A 4P0PA 2A3VA 4J9NA 2W9BA 8ICSA 3KHRA 2BKEA 3RH6A 2IHNA 2Y9UA 2HSZA 4O9MA 4PHAA 4PL2A 1Z00B 2KJ9A 8ICAA 4FZNA 3PX0A 1X2IA 1IIPA 5EE1A 5ALQA 3OJSA 4I2BA 5DQHA 3JPPA 4QZ8A 2IOFA 5J2IA 4MF8A 4UASA 4M0AA 3QXGA 9ICJA 1Q3VA 2IA6A 2FJ6A 1A77A 2KOBA 8ICNA 4DQQA 3G6XA 4TUQA 3RFAA 5DLGA 5DDYA 2OM6A 2D3DA 4QIWF 2WF8A 2ATLA 1DOQA 4J9MA 3B0YA 3ZDBA 1PK1B 4DQIA 2RRDA 1KFTA 4KITB 2JEJA 3PR4A 1AQ6A 3RF9A 2QARB 1MA7A 3SMVA 1MC8A 4IQVA 5KFOA 4QZAA 5J2DA 3A0HU 4I2DA 4DSJA 4G9BA 5GTIU 2NRXA 4ZOHC 4ECYA 1TAQA 2R18A 4LZDA 5KG3A 1Z1BA 4UB5A 4GIBA 1K5OA 5CJ7A 4NLCA 4UW9A 2W9CA 4O3MA 3V7JA 1ZQIA 1ZQAA 4IRDA 1D8LA 1JROA 2ZUDA 5DG7A 2YMQA 1BNPA 3H0RB 1FO4A 2AQ0A 4O3QA 2IHMA 3M7DA 4B9NA 2W7PA 3RB0A 2EAPA 4BWJA 5KFRA 4NM2A 4KLEA 2HHVA 3TARA 4IQWA 2JHDA 9ICRA 4Y2SA 1NK0A 5AKHA 3C2MA 1ZRMA 2EAMA 2E8MA 1ZQYA 5K4LA 9ICVA 3F2DA 2ZIWA 1ZQUA 1IM4A 1N48A 5H2FU 1URJA 4QW8A 3VC8A 4RQ4A 4KLQA 2QB0A 2K60A 3G6YA 1ZYQA 1S10A 2VJ5A 2BZFA 4ECRA 3MDCA 2Y0SF 2DBYA 3M9MB 4MEYA 4F4KA 2RQ5A 4DOCA 4PL1A 5EWFA 8ICYA 1ZQRA 1TFRA 1SB3C 2BCUA 2FPLA 4JUZA 4DFJA 2LBOA 2C2RA 3BQTA 1ZQMA 1NK9A 3C5GA 4ED0A 1QLNA 2C2EA 1RXVA 5KFHA 2KD1A 2MUTA 5AKIA 2KV2A 4PH5A 2ZJ8A 2E8OA 2RDIA 1Z19A 3H0MB 3U26A 5KFNA 1NNLA 3HW8A 7ICPA 1JXLA 4PZNA 9ICLA 3UXOA 4J9KA 2JZBB 5AM4A 1TK0A 3QUTA 2W3RA 2DF4B 3V6KA 2KZ3A 3JPTA 3I76A 5J2KA 1KEJA 5KT4A 3WKBA 1ZD5A 3ETLA 4GXKA 4ED6A 1WWVA 3ALRA 4CNQA 3TFSA 3B0XA 4DOBA 5KT2A 4QZIA 4KN7A 9ICWA 4P4PA 2MU2A 3ZD8A 2PMZF 2BQRA 3K75D 3PSIA 2Y1JA 4PJ0U 4F93B 3HRDD 1BPXA 2A1JB 3CNHA 4OCZA 1UT5A 4BDPA 1SZPA 7ICEA 4UAWA 1X9XA 5T14A 2WF7A 3NASA 1NOMA 2H3FA 2VA2A 1Z4OA 4X5VA 3PW0A 2DPJA 4DF4A 3F5AA 3C1YA 4R66A 2EDUA 5HMLA 3QU7A 3AUOA 5CA7A 3PSPA 3PMLA 1C20A 2C28A 3F53A 2DFLA 1OUQA 9ICTA 5ALMA 2LM4A 5AM1A 3UMGA 4F5QA 1NJXA 9ICBA 4WJ3B 4MFFA 3H0LB 4US8A 2BPFA 2BR0A 1Z4NA 2HW3A 1GO3F 4NM1A 3T5KA 4ECSA 2BPGA 3LVVA 3F5EA 5TISU 4RPXA 7ICKA 2HHWA 3N7RC 2HMXA 3KOOA 4MF2A 2BCRA 1KTQA 5EWEA 5KFLA 2ZUBA 2ESEA 2FLNA 3L3FX 4F91B 3PW7A 2R8GA 4Q43A 1DGJA 4KMUA 1J2NA 5AM5A 4O3NA 4KLDA 1JN3A 4F71A 4UQGA 1JMSA 1A76A 3SQIA 3Q8LA 4ECTA 3PV8A 3H4DA 4PPXA 5KG1A 4ECZA 9ICSA 4YR0A 9ICGA 5AM2A 1Z00A 4OJOA 5KG0A 4I29A 4IL6U 3T79A 2P35A 2FMSA 4RQ3A 3MGIA 4TUSA 5G5HA 4R8UB 3GQCA 2WF5A 4O5KA 3QUCA 2KFZA 3CP8A 1MSWD 2QB1A 1NK6A 3GV5B 3KKAA 3RBDA 5EOZA 2CRXA 1QCKA 3QEBZ 9ICPA 2ASJA 2A1AA 1ZQ1C 3WK5A 1S76D 2FI1A 5KTQA 2OH2A 3TANA 1PK1A 2G0AA 2VANA 1RDFA 4R65A 1U45A 2QARA 5L1MA 1NKEA 1RG6A 3TKAA 5CR0A 4DLGA 2ZTEA 3PW5A 2EZZA 1NZBA 1IXRA 3E2EA 2OEHA 4AP9A 3KD3A 3JPSA 2EZYA 3SAFA 5DBBA 7ICSA 3QU9A 8ICXA 4RUAA 5L9XA 3EW9A 5AKYA 4I28A 1YZ6A 1JXEA 4DFPA 4CF5A 2UVUA 3OJUA 3SAHA 3E58A 4MFAA 1DK3A 3Q8SB 3FC4A 4KLLA 2ZIXB 3L5KA 1Q46A 4QW9A 3SD7A 1DRGA 5AKJA 4O0IA 1XU4A 2FPMA 2KK0A 2XICA 4OJ5A 5J0TA 5AHXA 1ZRNA 1HIWA 4C7ZA 4RUCA 2QLTA 8ICCA 2QKQA 5KG6A 3N4MB 2ZTDA 5J0OA 4JK1A 5J2FA 2VKQA 4M6WB 4J9QA 4F4ZA 2WAQF 2Z7JA 7ICUA 4J9PA 4EELA 2KTQA 4C8LA 1Y88A 1N5WA 1NK7A 4F3OA 3QU2A 4XRHA 4EBEA 4RPYA 2YY6A 2ALZA 4KLGA 2G09A 3OTQA 1U47A 4YP3A 4Z6CA 1N63A 3K1ZA 2PI5A 2W03A 2G5HB 3K1RB 5DB7A 1QQ6A 2P6RA 4OJ6A 1ZQVA 5JTIA 2NO4A 4Y2XA 1U4BA 3NVVA 3T5LA 2ES6A 3OSPA 1RQLA 4A8EA 1CUKA 2HHXA 1VJ5A 9ICFA 2JH7A 4FZMA 4ACOA 2FLLA 2RLTA 2KVCA 1NKBA 2AQ4A 2BDPA 2W3SA 3PNCA 5KFFA 5AIBA 4KLTA 1SIJA 2KN7A 3UMCA 5ALUA 1H38A 4F2SA 4RZRA 2BPCA 2V4QA 4C4SA 1ZQJA 2JZBA 4YQWA 2DGZA 4Z6DA 5JUMA 3V7KA 3PY8A 2C2DA 3NRZA 4CCHA 3J81j 2F2AB 3D2QA 3UXPA 4C80A 4BXOB 2E1EA 7ICTA 2E3TA 3WU2U 5IIOA 3ONNA 3PR5B 2I6XA 4I27A 1X6JA 4O3SA 1V38A 4YXMA 4DSFA 1YZ7A 1KDHA 5D46A 4P0QB 4PHDA 4KLIA 5CB1A 2JV3A 5IIJA 3RB4A 5AI9A 4QZGA 4K4HA 3SV3A 1TVAA 1TV9A 5KFSA 5AK6A 3WK8A 1KL9A 2A1JA 3GV8B 1U48A 1QQ5A 4UAZA 3IRUA 2NV3A 1SKSA 3QU4A 4NLKA 4KLHA 4M9JA 5IIMA 3IV6A 2AXTU 1JRPA 1DK2A 2KJ8A 4NWIA 3CW2C 4C8OA 2JEIA 4C8KA 2NRWA 2W43A 5BPCA 2W8LA 5KAIU 1D8YA 4RQ7A 1T3QA 2AJQA 4DFMA 2Q0ZX 2BDUA 3SEIA 2FDRA 4KLJA 2KHQA 3GDXA 2MRLA 2ZIVB 5AM0A 2YB4A 4ICAA 1SXEA 5KT7A 4BUGA 3LWMA 1ZQTA 1ZQLA 4DS5A 3LDAA 2RHFA 2VA3A 3KKAC 4YR3A 3C29A 1ZQHA 4GC6A 4I2GA 3IDWA 1KRPA 4EENA 2HDOA 3BQ0A 1N62A 4K4GA 1FFVA 1PVRA 1L7NA 2NRVA 5J2JA 2DKZA 3OHAA 2PFNA 4RNOA 4DS4A 4KMOB 2P66A 5BOMA 5ALDA 2LPEA 2AH5A 4C4RA 2XY6A 4Y2YA 2KG5A 2PFQA 4USAA 4Y2QA 1SWVA 4Y2JA 3AL0B 3N97B 4GXJA 2JXJA 3OPXA 1T3NA 2E8PA 3BS5A 5KL1B 4YMNA 1O03A 3FYHA 3QYPA 4CF3A 4O5EA 2HOQA 2UVRA 2B0CA 8ICQA 1BPDA 5DLFA 1NJZA 3V6JA 5AKGA 4AYBF 2IOFK 3UQ2A 5KFTA 2BCSA 1SWWA 5DQGA 2H3IA 5ALEA 9ICKA 4PGQA 3RR8A 1KN5A 2DWQA 2ZJAA 2PFOA 1S77D 1N56A 4DQRA 1D9FA 2DUYA 2AGOA 4JV1A 4DSKA 3JPQA 2MSNA 5KFBA 5KNIA 2Y0SC 4FFDA 2F1JA 5KAFU 3QZ8A 2I1QA 1ZQDA 4Y2RA 2ISPA 1Z3EB 5J2CA 1RXWA 5ALXA 1S0MA 3CRXA 4PGYA 2DQNB 1JI7A 4O5CA 5KFZA 2LHTA 2ZIXA 4B9UA 1S8OA 2LKYA 1D8BA 2HVHA 3EUB2 3OHBA 4DQPA 5KFDA 1FIQA 3BJYA 1WUDA 2DPIA 4UB6U 5C5JA 4NLGA 3ZD9A 2B6GA 4ELTA 4Y2UA 4RT3A 5KFUA 3H8WA 8ICWA 2F1IA 4B9VA 9ICQA 3JPRA 5AKLA 5CRXA 3SYZA 4C8MA 1L8LA 4EYIB 3VCBA 2KIVA 4NLZA 4DL7A 2KJ5A 3CYMA 4DOAA 2R8JA 4J9LA 3M9OB 5AIAA 4YN4A 4GFJA 2JH1A 1T7PA 3AM9A 2FLPA 4PHPA 1S0OA 3ETRA 4DEZA 2PMZC 9ICHA 3C2LA 2YB1A 2W54A 4Y2PA 2L5YA 1RYSA 2NRTA 2IMWP 2HBLA 5ALGA 2AGPA 3MR3A 3PMNA 3PO4A 2BQUA 4JWMA 3QE9Y 2KEYA 3M6ZA 1JALA 1ZQSA 1QSLA 5KFQA 2I9GA 3F2CA 2GOLA 3EZ5A 1QQ7A 4QWDA 2F3NA 2H5XA 2W9BB 4UAVA 3S6JA 5DBAA 2E8NA 4MFCA 1DGSA 4ZH4A 2GO7A 5KG7A 2C22A 4KX5A 2K4EA 1ZQXA 3Q8RB 4R64A 5CHGA 4C4TA 2XGPA 5KG2A 1CEZA 5D4BA 5HHHA 2LYAA 1HUZA 5J8YA 3DV9A 5AK4A 4C8NA 4BXOA 4YMMA 3MC1A 8ICUA 3HJEA 4NJ8A 4M9HA 1XO0A 3AEVA 2EQYA 2K89A 1T8EA 3RTVA 3UXNA 3PW2A 4UARA 4EBDA 1P7DA 3MR6A 3N7SC 3D2NA 3B9JA 5IIIA 5HR6A 4Y2VA 5ALLA 3IP4B 1OXJA 3ICXA 4DQSA 3ISDA 4F4XA 2Q4TA 5JRTA 4TURA 7ICHA 4QWCA 3TAQA 2J6TA 2M9NA 4ED1A 4EZ6A 4KTQA 4CGZA 3PSFA 3LYSA 3K4GA 4OJPA 3EPGA 4YXJA 4XUSA 4IR9A 4ED2A 5EWGA 3BZKA 5KFWA 1NK4A 1X9WA 3BQ2A 3WKCA 3SI8A 3RH4A 3HX0A 5J2GA 4CE6A 1SKRA 3OSNA 2DL0A 1KKXA 2KZZA 2HHTA 1X9MA 1TK8A 1HJPA 2ZIVA 3QUBA 3KZIU 3I1YA 4YCXA 3RB6A 1JX4A 3RJGA 1SV4A 3SAGA 4RQ5A 3SZ2A 2VIXA 2IOHA 4KN4A 3HWTA 2XY5A 4F72A 4PGXA 8ICTA 2K8CB 3NS1A 2XC9A 4I2IA 5KG5A 3M9NB 4IQUA 2HVIA 2BCVA 3Q8QB 4UB2A 4B9MA 4RPZA 3H8JA 1RZTA 1SZHA 1RPLA 2EAOA 4BX9C 2CPRA 2K4PA 1N5XA 3ZDDA 1LKYB 4QZ9A 2ASLA 9ICXA 1RQNA 2YQEA 4I2CA 2QB0B 3BZCA 2KSOB 2MA1A 2GWSA 5HP4A 2KE7A 1KFSA 1BNOA 5J2BA 3QZ7A 5FP0A 4US9A 2RDJA 1UA0A 2XI9A 9ICNA 4YFKA 4IQTA 1B43A 1T4GA 4FBTA 4CRXA 3H8MA 5ALOA 1F44A 2YTUA 2YMMA 1XSNA 3AQFA 4C0ZA 3GIKA 1XSLA 5D49A 2WB1F 2WAQC 2JMGA 1X6IA 1SXDA 4HAIA 3ISCA 7ICIA 5J2HA 5C0YA 5JU5A 2XCPA 5KFCA 2XY7A 1HUOA 3MGHA 4DL6A 1V85A 5KFVA 2HOIA 4KLFA 3TACB 4DL2A 3HKZF 2W9AA 7ICLA 9ICEA 2BGWA 1COOA 3KHHA 3C5FA 2ZIUB 2UVWA 7ICMA 9ICOA 3NVYA 4I2FA 5KFAA 4DSEA 8ICBA 2JEFA 5KFEA 3AU2A 1U9LA 8ICHA 4KLOA 2LI6A 2ASDA 1ZQWA 1CRXA 1ED1A 4J9RA 8ICLA 3WKEA 5G5GA 5IILA 2VA8A 1ZJMA 4Q8EA 1O08A 5DKWA 2W04A 4DF8A 3H8SA 3JPNA 3SENA 1UA1A 2W7OA 2K8BB 5KFGA 2F44A 5AK5A 1ZQOA 2LMRA 1HEKA 2E1FA 4JMUA 1BPYA 2ODGA 3UQ0A 4DL4A 5A0LA 5J0YA 2R8HA 2D8CA 3GZFA 5AI4A 3ED5A 3KBBA 4OD0A 5DG9A 3RRGA 1RYUA 4JB3A 5EE0A 4OJLA 1F5SA 2PKEA 2F76X 1Q3UA 3O0FA 4C7YA 4M04A 4ECWA 3HPOA 5E79U 4DL5A 2EH9A 4IRKA 1WCLA 2XIDA 3Q8MA 3N7PD 4EX6A 3C1ZA 5J8YC 1L6NA 2KP7A 4EEYA 1L3SA 5J0QA 1LVHA 5F3XB 3F2BA 3FDSA 4YD2A 2KNJA 2BHNA 4Z6EA 1K1QA 3QNMA 3EYZA 4RU9A 3TAPA 4DSIA 4EYHB 1ZJNA 3WKAA 3BQ7A 5J2AA 3M6KA 4F5OA 1LV5A 4Q44A 4F92B 2F77X 3RJHA 4TQRA 4RNNA 2J6UA 4BWMA 3RH5A 3MGVA 5HNKA 5HMMA 8ICMA 4IS7A 4Q8FA 4HYKA 4P2HA 4TUPA 3GFKB 2UVVA 3IHQB 3MABA 4Z6FA 3PSTA 2XCAA 1KW4A 5DB8A 1XNSA 1DXSA 3ISBA 3WK9A 5DBCA 3BS7A 5AM3A 1L7PA 3RAQA 3FM9A 5DB6A 2DKXA 1NK8A 4BGDA 3RB3A 2F8KA 1SGGA 5KFYA 4QIWC 3NVWA 3C21A 5KFJA 7ICOA 4DSLA 3C2KA 1NKCA 1B4FA 3ZDEA 1ZQCA 2LYHA 1PUZA 1TE2A 1ZQPA 2KIWA 1TAUA 2WF9A 2HBMA 4DLEA 2KKPA 1BPEA 2WFAA 4ECXA 2PI4A 7ICQA 4M9GA 2N1RA 4M9LA 4FBUA 1COKA 4B6JA 4QZHA 3MBYA 1RM6C 4F4YA 2PFPA 5L1KA 5ALFA 5KL8B 4NXZA 3WK4A 4I2AA 3PVXA 2Y9TA 1U49A 2ISOA 4IC9A 5J0UA 3R9KA 5ALTA 4B9SA 2EANA 3WK7A 5KFIA 2KICA 3NTUA 4CF4A 3JPOA 1XS9D 4OO1J 4FZLA 7ICGA 1C7YA 1ZQQA 1ZQNA 5AKZA 3RRHA 4DCCA 3NVZA 2OHFA 3D2SA 1J97A 7ICNA 4UATA 1BGXT 1SKWA 1PK3A 3Q8KA 4YR2A 2F1HA 4F2RA 3H40A 4R8UA 3SV4A 4NLBA 1IV8A 4RNMA 4F8RA 2I5HA 4UB8U 2H3ZA 4AYBC 3GIIA 2JR5A 4B9LA 2HHQA 4CDGA 2OYYA 1ZQFA 1VLBA 1X42A 1MN8A 5EE9A 3RBEA 3ZDAA 1S0NA 2ZG6A 1J2MA 2K4IA 4QNLA 3TADA 1QSSA 4NL9A 3IN5A 4LVSA 1M6YA 5BOLA 2G07A 1SL0A 3IM1A 4F5PA 1ZQZA 2G08A 5KG4A 2HBJA 4BJQA 3C28A 3MR5A 1LKYA 5DG8A 8ICZA 2R8IA 3RAXA 2KSOA 2D6FC 4RQ0A 3QU5A 5IINA 1PVQA 1UQVA 2K8AA 4YG2A 1UPHA 3MR2A 1UT8A 4Q45A 4NY8A 3AN1A 1JIHA 3N28A 2V9WA 3T5JA 2HCFA 1YT3A 2JEGA 1MQ3A 2E5SA 3RR7A 5ALYA 2A19A 2WHEA 4ECQA 5AK3A 4UAYA 1S97A 2KMDA 2PXIA 2YMLA 4RQ8A 4U7CA 4M6WA 4DFDA 3KHGA 3HT3A 4QZDA 5B5EU 2CXYA 2HHUA 2OXOA 3MFHA 5GTHU 4DFKA 1BPZA 1V97A 3KHLA 4QWEA 5ALSA 2BQ3A 3M1YA 4FS2A 2HBKA 4F50A 2W11A 4G3IA 4ELUA 3Q8PB 5IIKA 5ALPA 1L3VA 4DWIA 4ECVA 1WWUA 2G06A 5KT5A 2ZIUA 2R8KA 1F0MA 4U6PA 5CEHA 1B22A 8ICOA 3RJKA 2MAXA 4JV2A 5AKKA 8ICFA 2HOFA 4ED3A 4RT2A 2YMPA 1UHUA 5J0RA 2H3QA 5J29A 4QWAA 4QWBA 3G6VA 5L1IA 4NLNA 2F8LA 1L8OA 1S5LU 2W55A 2LM1A 1FFUA 3DEEA 8ICKA 3PX4A 1KSPA 5AKEA 4P0PB 1VDVA 1L7MA 2WF6A 1L7OA 5F9LA 5KT6A 3NUQA 1BVSA 2KZMA 4LJXA 1X66A 5DQIA 2KVSA 3E0FA 1XSPA 2G5IB 1SV0A 1B0XA 1QTMA 1FEZA 4QZBA 2JRZA 1ZOLA 4M2YA 8ICPA 1SL1A 1SL2A 4QZFA 4ED7A 4E0DA 2NRZA 5J2EA 2W8KA 4NV0A 1CI4A 2V4RA 4YVZA 3AQEA 4XQ8A 3M8SA 1KLNA 8ICRA 3M8RA 2KKVA 5KFXA 4PZOA 3TQ1A 4I2HA 4UB4A 3GIMA 3T5HA 1NJYA 1T94A 3DDHA 4FS1A 7ICFA 1PZNA 4QZCA 5DB9A 1N61A 4P0QA 3QX7A 4QJFB 5AI6A 1KQQA 4UBBA 5KFMA 3GIJA 1S0VA 5B66U 4K4IA 2O6KA 2W9MA 3IG5A 3MFIA 4UBCA 1S9FA 2ZXIA 1RYRA 3TI0A 4ED8A 3UPQA 2IBKA 1Q8KA 4P4OA 5ALHA 3UMBA 4EEKA 2FMPA 4IR1A 3V72A 1ZQKA 1OW5A 3WKDA 5ALRA 3IG8A 3WK6A 1L3UA 5ALNA 3QEAZ 3NGDA 1NI3A 2AU0A 3NRWA 3GILA 1EXNA 1ZQGA 2ZJ5A 2W9CB 3RJJA 5KFPA 3C23A 2OCEA 2NO5A 4B9TA 4UB1A 3RJIA 4QZEA 1WCNA 4O3OA 1TAMA 4J03A 3THVA 4EX7A 1ZD3A 3ORYA 1ZQEA 4J9SA 5J0SA 4GC7A 3BS5B 4DL3A 2XO7A 4RQ6A 2RP5A 5ALZA 2WTFA 1XWLA 8ICIA 1LB2B 3BDPA 4J9OA 4M9NA 2B21A 1WYGA 3MDAA 2K4HA 1A0PA 2ZXHA 4RQ2A 1PVPA 2XGQA 1N2XA 3OGUA 3TADC 3I28A 2ZIWB 5AI0A 1AROP 4I2EA 4KLUA 4NL9C 2HI0A 3LVWA 4IRCA 7ICJA 1BPBA 5ALJA 2EZXA 5ALKA 3LK9A 1N60A 2AHOB 4RQMA 5L1LA 3PZPA 3RJEA 4YMOA 1V9PA 2FPKA 1ZD4A 2KFNA 4GXIA 1D9DA 4YD1A 1K1SA 3T3FA 2YN4A 5AKXA 8ICEA 2P6UA 4F4WA 4ECUA 2FE9A 1XC9A 8ICJA 5ALVA 1KBUA 4F5RA 3AU6A 3PO5A 1NZPA 4GLXA 2WB1C 1NK5A 4EZ9A 3L4PA 1MQ2A 3H4BA 3A0BU 2MUTB 4JV0A 5KFKA 5AICA 3ZDCA 5HHIA 5J0WA 1TKDA 3PX6A 4MEXA 7ICRA 5DGBA 4ELVA 2NYVA 1QSYA 3HKZC 2AGQA 5CP2A 2GH1A 3SR6A 9ICUA 2ZTCA 5J0XA 4O3PA 4M47A 4EBCA 2Y1IA 2GLEA 1L3TA 1ZQBA 3KZXA 4I2JA 5DGAA 3V7LA 3D6JA 4Y2TA 4O3RA 5L1JA 1ZD2P 4RQNA 2KHVA 9ICIA 3BQ1A 4KLMA 4P4MA 9ICMA 2XVTA 2ZUCA 4FO6A 2HHSA 9ICCA 4UAUA 2OWOA 3KTQA 1TK5A 5DDMA 3UM9A 2CN1A 4TQSA 1JUDA 3AMZA 4XA5A 3QUQA 3PW4A 2FMQA 2LYBA 4PHEA 3RJFA 1X40A 1ZETA 1NJWA 4UB3A 1IG6A 3V6HA 4MHVA 5HR7A 4JWNA 5TZVA 4DO9A 1ZXIA 5CWRA 1QH9A 2M0NA 5J0PA 3GV7B 2JGAA 5EE3A 2J6SA 4LZGA 9ICAA 3LWLA 3ZI4A 1SV0C
chains in the Genus database with same CATH topology
3KFUF 2RRDA 2G0AA 4A8EA 2HOIA 3M6KA 2HBKA 1KBUA 2BDUA 3RF9A 4WJ3B 3H0LB 4NLBA 2LBOA 2F77X 3HKZF 1MA7A 2KEYA 3SMVA 3M6ZA 2KHQA 1GO3F 2JH7A 3IG5A 2MRLA 2WB1C 2ZIVB 4FZMA 4ACOA 2YB4A 4ICAA 3MGVA 2ZXIA 2KVCA 2ZIVA 4BUGA 1NZBA 2ZIUB 3F2CA 2GOLA 3LVVA 2G06A 2KD1A 2Y0SC 2ZIUA 2H3VA 2H3ZA 2KV2A 3F5EA 4AYBC 3SAFA 3SAGA 2YX8A 2RHFA 2VIXA 1Z19A 3H0MB 4U6PA 4CDGA 2OYYA 3N7RC 2HMXA 3IG8A 2R18A 1A6SA 3PSTA 2ZG6A 3C29A 1Z1BA 2HOFA 1XNSA 2K4IA 4QNLA 3SAHA 2K8CB 2VJ4A 2H3QA 3GU3A 3NRWA 4FE3A 1CRXA 4KX5A 2K4EA 1ED1A 3HKZC 3CRXA 2DGZA 2DQNB 1ECWA 2F8LA 2GH1A 2ZIXB 2DF4B 3L3FX 4NLCA 3IN5A 2LHTA 4O3MA 2ZIXA 4KX3A 1PVRA 3DEEA 1DRGA 2LKYA 4P0PB 2G07A 2W04A 1TAMA 1D8BA 1SZHA 4P0PA 2F2AB 3D2QA 2G08A 3KZXA 4BX9C 2CPRA 2XICA 4QIWC 2A3VA 4KMOB 4OJ5A 2LYAA 3NUQA 3H0RB 1HIWA 4PL1A 3ALRA 2W7OA 2KHVA 2K8BB 2HBJA 2E1EA 4BJQA 3C28A 1WUDA 2RP5A 3SQIA 3ONNA 3M7DA 1HEKA 2E1FA 4JMUA 2W7PA 3E0FA 2VKQA 2G5IB 2KIWA 2XVTA 1XO0A 2MA1A 2K89A 4PL2A 2HBMA 2D6FC 2KJ9A 2KKPA 2WAQF 2Z7JA 1P7DA 4FZNA 2JHDA 4OJOA 3N7SC 2K8AA 3D2NA 2PMZF 1PVQA 1IIPA 1UPHA 5A0LA 4P0QB 5CRXA 2CN1A 2N1RA 3T79A 3GZFA 2K4HA 5HR6A 2XI9A 1A0PA 2ZXHA 3PSIA 4NV0A 3AL0B 3VCBA 1PVPA 3IP4B 3AQEA 2LYBA 1YT3A 3OPXA 3ICXA 2ZIWB 4OJLA 3F2DA 4CRXA 2ZIWA 2E5SA 2KJ5A 2Q4TA 3CYMA 5KL8B 3LVWA 2KKVA 5KL1B 1F44A 2F76X 5T14A 1Q3VA 1Q3UA 2H3FA 3O0FA 2KOBA 2NV3A 2G09A 3CP8A 4GFJA 4IC9A 5HR7A 2JH1A 1URJA 3AQFA 1T94A 4C0ZA 3VC8A 2XIDA 2HOQA 3N7PD 2CRXA 2WB1F 2WAQC 4U7CA 2JMGA 3RFAA 3PZPA 2PMZC 2VJ5A 1L6NA 2M0NA 2OXOA 2KICA 2W03A 2G5HB 2OM6A 3F5AA 3K1ZA 4CGZA 1ZQ1C 3PSFA 2YB1A 3LYSA 4OO1J 2Y0SF 4FZLA 4QIWF 4AYBF 4P0QA 2KJ8A 4OJ6A 2JGAA 3F2BA 4OJPA 5C0YA 4NWIA 2KNJA 4QJFB 3PSPA 2OH2A 2H3IA 3F53A 2HBLA 1OUQA 3D2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKV A;  1OUQ A;  3C29 A;  1Z1B A;  1F44 A;  4A8E A;  2HOF A;  2HOI A;  1XNS A;  1Q3U A;  1Q3V A;  1KBU A;  2KOB A;  2KIW A;  3NRW A;  1XO0 A;  1CRX A;  1MA7 A;  3CRX A;  2KEY A;  2KHQ A;  4ACO A;  2CRX A;  2KJ9 A;  2KKP A;  1P7D A;  3MGV A;  1PVQ A;  1PVR A;  1DRG A;  2OXO A;  1NZB A;  5CRX A;  3LYS A;  2KD1 A;  1A0P A;  2KJ8 A;  2A3V A;  1PVP A;  1Z19 A;  2KHV A;  4CRX A;  3C28 A;  2KJ5 A; 
#chains in the Genus database with same CATH topology
 4F5N A;  3KFU F;  1KFD A;  4RQ1 A;  1L5U A;  3EWA A;  5F9N A;  8ICG A;  5ALI A;  1Z1V A;  3EPI A;  4R63 A;  7ICV A;  2H3V A;  2YX8 A;  8ICV A;  5ALW A;  3HP6 A;  4KLS A;  1A6S A;  1X9S A;  5AI8 A;  2BCQ A;  2VJ4 A;  3GU3 A;  4FE3 A;  3H7I A;  1WG8 A;  1UCV A;  1ECW A;  1XO1 A;  3TFR A;  3HIL A;  3FAH A;  4KX3 A;  5KT3 A;  5AI5 A;  4P0P A;  2A3V A;  4J9N A;  2W9B A;  8ICS A;  3KHR A;  2BKE A;  3RH6 A;  2IHN A;  2Y9U A;  2HSZ A;  4O9M A;  4PHA A;  4PL2 A;  1Z00 B;  2KJ9 A;  8ICA A;  4FZN A;  3PX0 A;  1X2I A;  1IIP A;  5EE1 A;  5ALQ A;  3OJS A;  4I2B A;  5DQH A;  3JPP A;  4QZ8 A;  2IOF A;  5J2I A;  4MF8 A;  4UAS A;  4M0A A;  3QXG A;  9ICJ A;  1Q3V A;  2IA6 A;  2FJ6 A;  1A77 A;  2KOB A;  8ICN A;  4DQQ A;  3G6X A;  4TUQ A;  3RFA A;  5DLG A;  5DDY A;  2OM6 A;  2D3D A;  4QIW F;  2WF8 A;  2ATL A;  1DOQ A;  4J9M A;  3B0Y A;  3ZDB A;  1PK1 B;  4DQI A;  2RRD A;  1KFT A;  4KIT B;  2JEJ A;  3PR4 A;  1AQ6 A;  3RF9 A;  2QAR B;  1MA7 A;  3SMV A;  1MC8 A;  4IQV A;  5KFO A;  4QZA A;  5J2D A;  3A0H U;  4I2D A;  4DSJ A;  4G9B A;  5GTI U;  2NRX A;  4ZOH C;  4ECY A;  1TAQ A;  2R18 A;  4LZD A;  5KG3 A;  1Z1B A;  4UB5 A;  4GIB A;  1K5O A;  5CJ7 A;  4NLC A;  4UW9 A;  2W9C A;  4O3M A;  3V7J A;  1ZQI A;  1ZQA A;  4IRD A;  1D8L A;  1JRO A;  2ZUD A;  5DG7 A;  2YMQ A;  1BNP A;  3H0R B;  1FO4 A;  2AQ0 A;  4O3Q A;  2IHM A;  3M7D A;  4B9N A;  2W7P A;  3RB0 A;  2EAP A;  4BWJ A;  5KFR A;  4NM2 A;  4KLE A;  2HHV A;  3TAR A;  4IQW A;  2JHD A;  9ICR A;  4Y2S A;  1NK0 A;  5AKH A;  3C2M A;  1ZRM A;  2EAM A;  2E8M A;  1ZQY A;  5K4L A;  9ICV A;  3F2D A;  2ZIW A;  1ZQU A;  1IM4 A;  1N48 A;  5H2F U;  1URJ A;  4QW8 A;  3VC8 A;  4RQ4 A;  4KLQ A;  2QB0 A;  2K60 A;  3G6Y A;  1ZYQ A;  1S10 A;  2VJ5 A;  2BZF A;  4ECR A;  3MDC A;  2Y0S F;  2DBY A;  3M9M B;  4MEY A;  4F4K A;  2RQ5 A;  4DOC A;  4PL1 A;  5EWF A;  8ICY A;  1ZQR A;  1TFR A;  1SB3 C;  2BCU A;  2FPL A;  4JUZ A;  4DFJ A;  2LBO A;  2C2R A;  3BQT A;  1ZQM A;  1NK9 A;  3C5G A;  4ED0 A;  1QLN A;  2C2E A;  1RXV A;  5KFH A;  2KD1 A;  2MUT A;  5AKI A;  2KV2 A;  4PH5 A;  2ZJ8 A;  2E8O A;  2RDI A;  1Z19 A;  3H0M B;  3U26 A;  5KFN A;  1NNL A;  3HW8 A;  7ICP A;  1JXL A;  4PZN A;  9ICL A;  3UXO A;  4J9K A;  2JZB B;  5AM4 A;  1TK0 A;  3QUT A;  2W3R A;  2DF4 B;  3V6K A;  2KZ3 A;  3JPT A;  3I76 A;  5J2K A;  1KEJ A;  5KT4 A;  3WKB A;  1ZD5 A;  3ETL A;  4GXK A;  4ED6 A;  1WWV A;  3ALR A;  4CNQ A;  3TFS A;  3B0X A;  4DOB A;  5KT2 A;  4QZI A;  4KN7 A;  9ICW A;  4P4P A;  2MU2 A;  3ZD8 A;  2PMZ F;  2BQR A;  3K75 D;  3PSI A;  2Y1J A;  4PJ0 U;  4F93 B;  3HRD D;  1BPX A;  2A1J B;  3CNH A;  4OCZ A;  1UT5 A;  4BDP A;  1SZP A;  7ICE A;  4UAW A;  1X9X A;  5T14 A;  2WF7 A;  3NAS A;  1NOM A;  2H3F A;  2VA2 A;  1Z4O A;  4X5V A;  3PW0 A;  2DPJ A;  4DF4 A;  3F5A A;  3C1Y A;  4R66 A;  2EDU A;  5HML A;  3QU7 A;  3AUO A;  5CA7 A;  3PSP A;  3PML A;  1C20 A;  2C28 A;  3F53 A;  2DFL A;  1OUQ A;  9ICT A;  5ALM A;  2LM4 A;  5AM1 A;  3UMG A;  4F5Q A;  1NJX A;  9ICB A;  4WJ3 B;  4MFF A;  3H0L B;  4US8 A;  2BPF A;  2BR0 A;  1Z4N A;  2HW3 A;  1GO3 F;  4NM1 A;  3T5K A;  4ECS A;  2BPG A;  3LVV A;  3F5E A;  5TIS U;  4RPX A;  7ICK A;  2HHW A;  3N7R C;  2HMX A;  3KOO A;  4MF2 A;  2BCR A;  1KTQ A;  5EWE A;  5KFL A;  2ZUB A;  2ESE A;  2FLN A;  3L3F X;  4F91 B;  3PW7 A;  2R8G A;  4Q43 A;  1DGJ A;  4KMU A;  1J2N A;  5AM5 A;  4O3N A;  4KLD A;  1JN3 A;  4F71 A;  4UQG A;  1JMS A;  1A76 A;  3SQI A;  3Q8L A;  4ECT A;  3PV8 A;  3H4D A;  4PPX A;  5KG1 A;  4ECZ A;  9ICS A;  4YR0 A;  9ICG A;  5AM2 A;  1Z00 A;  4OJO A;  5KG0 A;  4I29 A;  4IL6 U;  3T79 A;  2P35 A;  2FMS A;  4RQ3 A;  3MGI A;  4TUS A;  5G5H A;  4R8U B;  3GQC A;  2WF5 A;  4O5K A;  3QUC A;  2KFZ A;  3CP8 A;  1MSW D;  2QB1 A;  1NK6 A;  3GV5 B;  3KKA A;  3RBD A;  5EOZ A;  2CRX A;  1QCK A;  3QEB Z;  9ICP A;  2ASJ A;  2A1A A;  1ZQ1 C;  3WK5 A;  1S76 D;  2FI1 A;  5KTQ A;  2OH2 A;  3TAN A;  1PK1 A;  2G0A A;  2VAN A;  1RDF A;  4R65 A;  1U45 A;  2QAR A;  5L1M A;  1NKE A;  1RG6 A;  3TKA A;  5CR0 A;  4DLG A;  2ZTE A;  3PW5 A;  2EZZ A;  1NZB A;  1IXR A;  3E2E A;  2OEH A;  4AP9 A;  3KD3 A;  3JPS A;  2EZY A;  3SAF A;  5DBB A;  7ICS A;  3QU9 A;  8ICX A;  4RUA A;  5L9X A;  3EW9 A;  5AKY A;  4I28 A;  1YZ6 A;  1JXE A;  4DFP A;  4CF5 A;  2UVU A;  3OJU A;  3SAH A;  3E58 A;  4MFA A;  1DK3 A;  3Q8S B;  3FC4 A;  4KLL A;  2ZIX B;  3L5K A;  1Q46 A;  4QW9 A;  3SD7 A;  1DRG A;  5AKJ A;  4O0I A;  1XU4 A;  2FPM A;  2KK0 A;  2XIC A;  4OJ5 A;  5J0T A;  5AHX A;  1ZRN A;  1HIW A;  4C7Z A;  4RUC A;  2QLT A;  8ICC A;  2QKQ A;  5KG6 A;  3N4M B;  2ZTD A;  5J0O A;  4JK1 A;  5J2F A;  2VKQ A;  4M6W B;  4J9Q A;  4F4Z A;  2WAQ F;  2Z7J A;  7ICU A;  4J9P A;  4EEL A;  2KTQ A;  4C8L A;  1Y88 A;  1N5W A;  1NK7 A;  4F3O A;  3QU2 A;  4XRH A;  4EBE A;  4RPY A;  2YY6 A;  2ALZ A;  4KLG A;  2G09 A;  3OTQ A;  1U47 A;  4YP3 A;  4Z6C A;  1N63 A;  3K1Z A;  2PI5 A;  2W03 A;  2G5H B;  3K1R B;  5DB7 A;  1QQ6 A;  2P6R A;  4OJ6 A;  1ZQV A;  5JTI A;  2NO4 A;  4Y2X A;  1U4B A;  3NVV A;  3T5L A;  2ES6 A;  3OSP A;  1RQL A;  4A8E A;  1CUK A;  2HHX A;  1VJ5 A;  9ICF A;  2JH7 A;  4FZM A;  4ACO A;  2FLL A;  2RLT A;  2KVC A;  1NKB A;  2AQ4 A;  2BDP A;  2W3S A;  3PNC A;  5KFF A;  5AIB A;  4KLT A;  1SIJ A;  2KN7 A;  3UMC A;  5ALU A;  1H38 A;  4F2S A;  4RZR A;  2BPC A;  2V4Q A;  4C4S A;  1ZQJ A;  2JZB A;  4YQW A;  2DGZ A;  4Z6D A;  5JUM A;  3V7K A;  3PY8 A;  2C2D A;  3NRZ A;  4CCH A;  3J81 j;  2F2A B;  3D2Q A;  3UXP A;  4C80 A;  4BXO B;  2E1E A;  7ICT A;  2E3T A;  3WU2 U;  5IIO A;  3ONN A;  3PR5 B;  2I6X A;  4I27 A;  1X6J A;  4O3S A;  1V38 A;  4YXM A;  4DSF A;  1YZ7 A;  1KDH A;  5D46 A;  4P0Q B;  4PHD A;  4KLI A;  5CB1 A;  2JV3 A;  5IIJ A;  3RB4 A;  5AI9 A;  4QZG A;  4K4H A;  3SV3 A;  1TVA A;  1TV9 A;  5KFS A;  5AK6 A;  3WK8 A;  1KL9 A;  2A1J A;  3GV8 B;  1U48 A;  1QQ5 A;  4UAZ A;  3IRU A;  2NV3 A;  1SKS A;  3QU4 A;  4NLK A;  4KLH A;  4M9J A;  5IIM A;  3IV6 A;  2AXT U;  1JRP A;  1DK2 A;  2KJ8 A;  4NWI A;  3CW2 C;  4C8O A;  2JEI A;  4C8K A;  2NRW A;  2W43 A;  5BPC A;  2W8L A;  5KAI U;  1D8Y A;  4RQ7 A;  1T3Q A;  2AJQ A;  4DFM A;  2Q0Z X;  2BDU A;  3SEI A;  2FDR A;  4KLJ A;  2KHQ A;  3GDX A;  2MRL A;  2ZIV B;  5AM0 A;  2YB4 A;  4ICA A;  1SXE A;  5KT7 A;  4BUG A;  3LWM A;  1ZQT A;  1ZQL A;  4DS5 A;  3LDA A;  2RHF A;  2VA3 A;  3KKA C;  4YR3 A;  3C29 A;  1ZQH A;  4GC6 A;  4I2G A;  3IDW A;  1KRP A;  4EEN A;  2HDO A;  3BQ0 A;  1N62 A;  4K4G A;  1FFV A;  1PVR A;  1L7N A;  2NRV A;  5J2J A;  2DKZ A;  3OHA A;  2PFN A;  4RNO A;  4DS4 A;  4KMO B;  2P66 A;  5BOM A;  5ALD A;  2LPE A;  2AH5 A;  4C4R A;  2XY6 A;  4Y2Y A;  2KG5 A;  2PFQ A;  4USA A;  4Y2Q A;  1SWV A;  4Y2J A;  3AL0 B;  3N97 B;  4GXJ A;  2JXJ A;  3OPX A;  1T3N A;  2E8P A;  3BS5 A;  5KL1 B;  4YMN A;  1O03 A;  3FYH A;  3QYP A;  4CF3 A;  4O5E A;  2HOQ A;  2UVR A;  2B0C A;  8ICQ A;  1BPD A;  5DLF A;  1NJZ A;  3V6J A;  5AKG A;  4AYB F;  2IOF K;  3UQ2 A;  5KFT A;  2BCS A;  1SWW A;  5DQG A;  2H3I A;  5ALE A;  9ICK A;  4PGQ A;  3RR8 A;  1KN5 A;  2DWQ A;  2ZJA A;  2PFO A;  1S77 D;  1N56 A;  4DQR A;  1D9F A;  2DUY A;  2AGO A;  4JV1 A;  4DSK A;  3JPQ A;  2MSN A;  5KFB A;  5KNI A;  2Y0S C;  4FFD A;  2F1J A;  5KAF U;  3QZ8 A;  2I1Q A;  1ZQD A;  4Y2R A;  2ISP A;  1Z3E B;  5J2C A;  1RXW A;  5ALX A;  1S0M A;  3CRX A;  4PGY A;  2DQN B;  1JI7 A;  4O5C A;  5KFZ A;  2LHT A;  2ZIX A;  4B9U A;  1S8O A;  2LKY A;  1D8B A;  2HVH A;  3EUB 2;  3OHB A;  4DQP A;  5KFD A;  1FIQ A;  3BJY A;  1WUD A;  2DPI A;  4UB6 U;  5C5J A;  4NLG A;  3ZD9 A;  2B6G A;  4ELT A;  4Y2U A;  4RT3 A;  5KFU A;  3H8W A;  8ICW A;  2F1I A;  4B9V A;  9ICQ A;  3JPR A;  5AKL A;  5CRX A;  3SYZ A;  4C8M A;  1L8L A;  4EYI B;  3VCB A;  2KIV A;  4NLZ A;  4DL7 A;  2KJ5 A;  3CYM A;  4DOA A;  2R8J A;  4J9L A;  3M9O B;  5AIA A;  4YN4 A;  4GFJ A;  2JH1 A;  1T7P A;  3AM9 A;  2FLP A;  4PHP A;  1S0O A;  3ETR A;  4DEZ A;  2PMZ C;  9ICH A;  3C2L A;  2YB1 A;  2W54 A;  4Y2P A;  2L5Y A;  1RYS A;  2NRT A;  2IMW P;  2HBL A;  5ALG A;  2AGP A;  3MR3 A;  3PMN A;  3PO4 A;  2BQU A;  4JWM A;  3QE9 Y;  2KEY A;  3M6Z A;  1JAL A;  1ZQS A;  1QSL A;  5KFQ A;  2I9G A;  3F2C A;  2GOL A;  3EZ5 A;  1QQ7 A;  4QWD A;  2F3N A;  2H5X A;  2W9B B;  4UAV A;  3S6J A;  5DBA A;  2E8N A;  4MFC A;  1DGS A;  4ZH4 A;  2GO7 A;  5KG7 A;  2C22 A;  4KX5 A;  2K4E A;  1ZQX A;  3Q8R B;  4R64 A;  5CHG A;  4C4T A;  2XGP A;  5KG2 A;  1CEZ A;  5D4B A;  5HHH A;  2LYA A;  1HUZ A;  5J8Y A;  3DV9 A;  5AK4 A;  4C8N A;  4BXO A;  4YMM A;  3MC1 A;  8ICU A;  3HJE A;  4NJ8 A;  4M9H A;  1XO0 A;  3AEV A;  2EQY A;  2K89 A;  1T8E A;  3RTV A;  3UXN A;  3PW2 A;  4UAR A;  4EBD A;  1P7D A;  3MR6 A;  3N7S C;  3D2N A;  3B9J A;  5III A;  5HR6 A;  4Y2V A;  5ALL A;  3IP4 B;  1OXJ A;  3ICX A;  4DQS A;  3ISD A;  4F4X A;  2Q4T A;  5JRT A;  4TUR A;  7ICH A;  4QWC A;  3TAQ A;  2J6T A;  2M9N A;  4ED1 A;  4EZ6 A;  4KTQ A;  4CGZ A;  3PSF A;  3LYS A;  3K4G A;  4OJP A;  3EPG A;  4YXJ A;  4XUS A;  4IR9 A;  4ED2 A;  5EWG A;  3BZK A;  5KFW A;  1NK4 A;  1X9W A;  3BQ2 A;  3WKC A;  3SI8 A;  3RH4 A;  3HX0 A;  5J2G A;  4CE6 A;  1SKR A;  3OSN A;  2DL0 A;  1KKX A;  2KZZ A;  2HHT A;  1X9M A;  1TK8 A;  1HJP A;  2ZIV A;  3QUB A;  3KZI U;  3I1Y A;  4YCX A;  3RB6 A;  1JX4 A;  3RJG A;  1SV4 A;  3SAG A;  4RQ5 A;  3SZ2 A;  2VIX A;  2IOH A;  4KN4 A;  3HWT A;  2XY5 A;  4F72 A;  4PGX A;  8ICT A;  2K8C B;  3NS1 A;  2XC9 A;  4I2I A;  5KG5 A;  3M9N B;  4IQU A;  2HVI A;  2BCV A;  3Q8Q B;  4UB2 A;  4B9M A;  4RPZ A;  3H8J A;  1RZT A;  1SZH A;  1RPL A;  2EAO A;  4BX9 C;  2CPR A;  2K4P A;  1N5X A;  3ZDD A;  1LKY B;  4QZ9 A;  2ASL A;  9ICX A;  1RQN A;  2YQE A;  4I2C A;  2QB0 B;  3BZC A;  2KSO B;  2MA1 A;  2GWS A;  5HP4 A;  2KE7 A;  1KFS A;  1BNO A;  5J2B A;  3QZ7 A;  5FP0 A;  4US9 A;  2RDJ A;  1UA0 A;  2XI9 A;  9ICN A;  4YFK A;  4IQT A;  1B43 A;  1T4G A;  4FBT A;  4CRX A;  3H8M A;  5ALO A;  1F44 A;  2YTU A;  2YMM A;  1XSN A;  3AQF A;  4C0Z A;  3GIK A;  1XSL A;  5D49 A;  2WB1 F;  2WAQ C;  2JMG A;  1X6I A;  1SXD A;  4HAI A;  3ISC A;  7ICI A;  5J2H A;  5C0Y A;  5JU5 A;  2XCP A;  5KFC A;  2XY7 A;  1HUO A;  3MGH A;  4DL6 A;  1V85 A;  5KFV A;  2HOI A;  4KLF A;  3TAC B;  4DL2 A;  3HKZ F;  2W9A A;  7ICL A;  9ICE A;  2BGW A;  1COO A;  3KHH A;  3C5F A;  2ZIU B;  2UVW A;  7ICM A;  9ICO A;  3NVY A;  4I2F A;  5KFA A;  4DSE A;  8ICB A;  2JEF A;  5KFE A;  3AU2 A;  1U9L A;  8ICH A;  4KLO A;  2LI6 A;  2ASD A;  1ZQW A;  1CRX A;  1ED1 A;  4J9R A;  8ICL A;  3WKE A;  5G5G A;  5IIL A;  2VA8 A;  1ZJM A;  4Q8E A;  1O08 A;  5DKW A;  2W04 A;  4DF8 A;  3H8S A;  3JPN A;  3SEN A;  1UA1 A;  2W7O A;  2K8B B;  5KFG A;  2F44 A;  5AK5 A;  1ZQO A;  2LMR A;  1HEK A;  2E1F A;  4JMU A;  1BPY A;  2ODG A;  3UQ0 A;  4DL4 A;  5A0L A;  5J0Y A;  2R8H A;  2D8C A;  3GZF A;  5AI4 A;  3ED5 A;  3KBB A;  4OD0 A;  5DG9 A;  3RRG A;  1RYU A;  4JB3 A;  5EE0 A;  4OJL A;  1F5S A;  2PKE A;  2F76 X;  1Q3U A;  3O0F A;  4C7Y A;  4M04 A;  4ECW A;  3HPO A;  5E79 U;  4DL5 A;  2EH9 A;  4IRK A;  1WCL A;  2XID A;  3Q8M A;  3N7P D;  4EX6 A;  3C1Z A;  5J8Y C;  1L6N A;  2KP7 A;  4EEY A;  1L3S A;  5J0Q A;  1LVH A;  5F3X B;  3F2B A;  3FDS A;  4YD2 A;  2KNJ A;  2BHN A;  4Z6E A;  1K1Q A;  3QNM A;  3EYZ A;  4RU9 A;  3TAP A;  4DSI A;  4EYH B;  1ZJN A;  3WKA A;  3BQ7 A;  5J2A A;  3M6K A;  4F5O A;  1LV5 A;  4Q44 A;  4F92 B;  2F77 X;  3RJH A;  4TQR A;  4RNN A;  2J6U A;  4BWM A;  3RH5 A;  3MGV A;  5HNK A;  5HMM A;  8ICM A;  4IS7 A;  4Q8F A;  4HYK A;  4P2H A;  4TUP A;  3GFK B;  2UVV A;  3IHQ B;  3MAB A;  4Z6F A;  3PST A;  2XCA A;  1KW4 A;  5DB8 A;  1XNS A;  1DXS A;  3ISB A;  3WK9 A;  5DBC A;  3BS7 A;  5AM3 A;  1L7P A;  3RAQ A;  3FM9 A;  5DB6 A;  2DKX A;  1NK8 A;  4BGD A;  3RB3 A;  2F8K A;  1SGG A;  5KFY A;  4QIW C;  3NVW A;  3C21 A;  5KFJ A;  7ICO A;  4DSL A;  3C2K A;  1NKC A;  1B4F A;  3ZDE A;  1ZQC A;  2LYH A;  1PUZ A;  1TE2 A;  1ZQP A;  2KIW A;  1TAU A;  2WF9 A;  2HBM A;  4DLE A;  2KKP A;  1BPE A;  2WFA A;  4ECX A;  2PI4 A;  7ICQ A;  4M9G A;  2N1R A;  4M9L A;  4FBU A;  1COK A;  4B6J A;  4QZH A;  3MBY A;  1RM6 C;  4F4Y A;  2PFP A;  5L1K A;  5ALF A;  5KL8 B;  4NXZ A;  3WK4 A;  4I2A A;  3PVX A;  2Y9T A;  1U49 A;  2ISO A;  4IC9 A;  5J0U A;  3R9K A;  5ALT A;  4B9S A;  2EAN A;  3WK7 A;  5KFI A;  2KIC A;  3NTU A;  4CF4 A;  3JPO A;  1XS9 D;  4OO1 J;  4FZL A;  7ICG A;  1C7Y A;  1ZQQ A;  1ZQN A;  5AKZ A;  3RRH A;  4DCC A;  3NVZ A;  2OHF A;  3D2S A;  1J97 A;  7ICN A;  4UAT A;  1BGX T;  1SKW A;  1PK3 A;  3Q8K A;  4YR2 A;  2F1H A;  4F2R A;  3H40 A;  4R8U A;  3SV4 A;  4NLB A;  1IV8 A;  4RNM A;  4F8R A;  2I5H A;  4UB8 U;  2H3Z A;  4AYB C;  3GII A;  2JR5 A;  4B9L A;  2HHQ A;  4CDG A;  2OYY A;  1ZQF A;  1VLB A;  1X42 A;  1MN8 A;  5EE9 A;  3RBE A;  3ZDA A;  1S0N A;  2ZG6 A;  1J2M A;  2K4I A;  4QNL A;  3TAD A;  1QSS A;  4NL9 A;  3IN5 A;  4LVS A;  1M6Y A;  5BOL A;  2G07 A;  1SL0 A;  3IM1 A;  4F5P A;  1ZQZ A;  2G08 A;  5KG4 A;  2HBJ A;  4BJQ A;  3C28 A;  3MR5 A;  1LKY A;  5DG8 A;  8ICZ A;  2R8I A;  3RAX A;  2KSO A;  2D6F C;  4RQ0 A;  3QU5 A;  5IIN A;  1PVQ A;  1UQV A;  2K8A A;  4YG2 A;  1UPH A;  3MR2 A;  1UT8 A;  4Q45 A;  4NY8 A;  3AN1 A;  1JIH A;  3N28 A;  2V9W A;  3T5J A;  2HCF A;  1YT3 A;  2JEG A;  1MQ3 A;  2E5S A;  3RR7 A;  5ALY A;  2A19 A;  2WHE A;  4ECQ A;  5AK3 A;  4UAY A;  1S97 A;  2KMD A;  2PXI A;  2YML A;  4RQ8 A;  4U7C A;  4M6W A;  4DFD A;  3KHG A;  3HT3 A;  4QZD A;  5B5E U;  2CXY A;  2HHU A;  2OXO A;  3MFH A;  5GTH U;  4DFK A;  1BPZ A;  1V97 A;  3KHL A;  4QWE A;  5ALS A;  2BQ3 A;  3M1Y A;  4FS2 A;  2HBK A;  4F50 A;  2W11 A;  4G3I A;  4ELU A;  3Q8P B;  5IIK A;  5ALP A;  1L3V A;  4DWI A;  4ECV A;  1WWU A;  2G06 A;  5KT5 A;  2ZIU A;  2R8K A;  1F0M A;  4U6P A;  5CEH A;  1B22 A;  8ICO A;  3RJK A;  2MAX A;  4JV2 A;  5AKK A;  8ICF A;  2HOF A;  4ED3 A;  4RT2 A;  2YMP A;  1UHU A;  5J0R A;  2H3Q A;  5J29 A;  4QWA A;  4QWB A;  3G6V A;  5L1I A;  4NLN A;  2F8L A;  1L8O A;  1S5L U;  2W55 A;  2LM1 A;  1FFU A;  3DEE A;  8ICK A;  3PX4 A;  1KSP A;  5AKE A;  4P0P B;  1VDV A;  1L7M A;  2WF6 A;  1L7O A;  5F9L A;  5KT6 A;  3NUQ A;  1BVS A;  2KZM A;  4LJX A;  1X66 A;  5DQI A;  2KVS A;  3E0F A;  1XSP A;  2G5I B;  1SV0 A;  1B0X A;  1QTM A;  1FEZ A;  4QZB A;  2JRZ A;  1ZOL A;  4M2Y A;  8ICP A;  1SL1 A;  1SL2 A;  4QZF A;  4ED7 A;  4E0D A;  2NRZ A;  5J2E A;  2W8K A;  4NV0 A;  1CI4 A;  2V4R A;  4YVZ A;  3AQE A;  4XQ8 A;  3M8S A;  1KLN A;  8ICR A;  3M8R A;  2KKV A;  5KFX A;  4PZO A;  3TQ1 A;  4I2H A;  4UB4 A;  3GIM A;  3T5H A;  1NJY A;  1T94 A;  3DDH A;  4FS1 A;  7ICF A;  1PZN A;  4QZC A;  5DB9 A;  1N61 A;  4P0Q A;  3QX7 A;  4QJF B;  5AI6 A;  1KQQ A;  4UBB A;  5KFM A;  3GIJ A;  1S0V A;  5B66 U;  4K4I A;  2O6K A;  2W9M A;  3IG5 A;  3MFI A;  4UBC A;  1S9F A;  2ZXI A;  1RYR A;  3TI0 A;  4ED8 A;  3UPQ A;  2IBK A;  1Q8K A;  4P4O A;  5ALH A;  3UMB A;  4EEK A;  2FMP A;  4IR1 A;  3V72 A;  1ZQK A;  1OW5 A;  3WKD A;  5ALR A;  3IG8 A;  3WK6 A;  1L3U A;  5ALN A;  3QEA Z;  3NGD A;  1NI3 A;  2AU0 A;  3NRW A;  3GIL A;  1EXN A;  1ZQG A;  2ZJ5 A;  2W9C B;  3RJJ A;  5KFP A;  3C23 A;  2OCE A;  2NO5 A;  4B9T A;  4UB1 A;  3RJI A;  4QZE A;  1WCN A;  4O3O A;  1TAM A;  4J03 A;  3THV A;  4EX7 A;  1ZD3 A;  3ORY A;  1ZQE A;  4J9S A;  5J0S A;  4GC7 A;  3BS5 B;  4DL3 A;  2XO7 A;  4RQ6 A;  2RP5 A;  5ALZ A;  2WTF A;  1XWL A;  8ICI A;  1LB2 B;  3BDP A;  4J9O A;  4M9N A;  2B21 A;  1WYG A;  3MDA A;  2K4H A;  1A0P A;  2ZXH A;  4RQ2 A;  1PVP A;  2XGQ A;  1N2X A;  3OGU A;  3TAD C;  3I28 A;  2ZIW B;  5AI0 A;  1ARO P;  4I2E A;  4KLU A;  4NL9 C;  2HI0 A;  3LVW A;  4IRC A;  7ICJ A;  1BPB A;  5ALJ A;  2EZX A;  5ALK A;  3LK9 A;  1N60 A;  2AHO B;  4RQM A;  5L1L A;  3PZP A;  3RJE A;  4YMO A;  1V9P A;  2FPK A;  1ZD4 A;  2KFN A;  4GXI A;  1D9D A;  4YD1 A;  1K1S A;  3T3F A;  2YN4 A;  5AKX A;  8ICE A;  2P6U A;  4F4W A;  4ECU A;  2FE9 A;  1XC9 A;  8ICJ A;  5ALV A;  1KBU A;  4F5R A;  3AU6 A;  3PO5 A;  1NZP A;  4GLX A;  2WB1 C;  1NK5 A;  4EZ9 A;  3L4P A;  1MQ2 A;  3H4B A;  3A0B U;  2MUT B;  4JV0 A;  5KFK A;  5AIC A;  3ZDC A;  5HHI A;  5J0W A;  1TKD A;  3PX6 A;  4MEX A;  7ICR A;  5DGB A;  4ELV A;  2NYV A;  1QSY A;  3HKZ C;  2AGQ A;  5CP2 A;  2GH1 A;  3SR6 A;  9ICU A;  2ZTC A;  5J0X A;  4O3P A;  4M47 A;  4EBC A;  2Y1I A;  2GLE A;  1L3T A;  1ZQB A;  3KZX A;  4I2J A;  5DGA A;  3V7L A;  3D6J A;  4Y2T A;  4O3R A;  5L1J A;  1ZD2 P;  4RQN A;  2KHV A;  9ICI A;  3BQ1 A;  4KLM A;  4P4M A;  9ICM A;  2XVT A;  2ZUC A;  4FO6 A;  2HHS A;  9ICC A;  4UAU A;  2OWO A;  3KTQ A;  1TK5 A;  5DDM A;  3UM9 A;  2CN1 A;  4TQS A;  1JUD A;  3AMZ A;  4XA5 A;  3QUQ A;  3PW4 A;  2FMQ A;  2LYB A;  4PHE A;  3RJF A;  1X40 A;  1ZET A;  1NJW A;  4UB3 A;  1IG6 A;  3V6H A;  4MHV A;  5HR7 A;  4JWN A;  5TZV A;  4DO9 A;  1ZXI A;  5CWR A;  1QH9 A;  2M0N A;  5J0P A;  3GV7 B;  2JGA A;  5EE3 A;  2J6S A;  4LZG A;  9ICA A;  3LWL A;  3ZI4 A;  1SV0 C; 
#chains in the Genus database with same CATH homology
 3KFU F;  2RRD A;  2G0A A;  4A8E A;  2HOI A;  3M6K A;  2HBK A;  1KBU A;  2BDU A;  3RF9 A;  4WJ3 B;  3H0L B;  4NLB A;  2LBO A;  2F77 X;  3HKZ F;  1MA7 A;  2KEY A;  3SMV A;  3M6Z A;  2KHQ A;  1GO3 F;  2JH7 A;  3IG5 A;  2MRL A;  2WB1 C;  2ZIV B;  4FZM A;  4ACO A;  2YB4 A;  4ICA A;  3MGV A;  2ZXI A;  2KVC A;  2ZIV A;  4BUG A;  1NZB A;  2ZIU B;  3F2C A;  2GOL A;  3LVV A;  2G06 A;  2KD1 A;  2Y0S C;  2ZIU A;  2H3V A;  2H3Z A;  2KV2 A;  3F5E A;  4AYB C;  3SAF A;  3SAG A;  2YX8 A;  2RHF A;  2VIX A;  1Z19 A;  3H0M B;  4U6P A;  4CDG A;  2OYY A;  3N7R C;  2HMX A;  3IG8 A;  2R18 A;  1A6S A;  3PST A;  2ZG6 A;  3C29 A;  1Z1B A;  2HOF A;  1XNS A;  2K4I A;  4QNL A;  3SAH A;  2K8C B;  2VJ4 A;  2H3Q A;  3GU3 A;  3NRW A;  4FE3 A;  1CRX A;  4KX5 A;  2K4E A;  1ED1 A;  3HKZ C;  3CRX A;  2DGZ A;  2DQN B;  1ECW A;  2F8L A;  2GH1 A;  2ZIX B;  2DF4 B;  3L3F X;  4NLC A;  3IN5 A;  2LHT A;  4O3M A;  2ZIX A;  4KX3 A;  1PVR A;  3DEE A;  1DRG A;  2LKY A;  4P0P B;  2G07 A;  2W04 A;  1TAM A;  1D8B A;  1SZH A;  4P0P A;  2F2A B;  3D2Q A;  2G08 A;  3KZX A;  4BX9 C;  2CPR A;  2XIC A;  4QIW C;  2A3V A;  4KMO B;  4OJ5 A;  2LYA A;  3NUQ A;  3H0R B;  1HIW A;  4PL1 A;  3ALR A;  2W7O A;  2KHV A;  2K8B B;  2HBJ A;  2E1E A;  4BJQ A;  3C28 A;  1WUD A;  2RP5 A;  3SQI A;  3ONN A;  3M7D A;  1HEK A;  2E1F A;  4JMU A;  2W7P A;  3E0F A;  2VKQ A;  2G5I B;  2KIW A;  2XVT A;  1XO0 A;  2MA1 A;  2K89 A;  4PL2 A;  2HBM A;  2D6F C;  2KJ9 A;  2KKP A;  2WAQ F;  2Z7J A;  1P7D A;  4FZN A;  2JHD A;  4OJO A;  3N7S C;  2K8A A;  3D2N A;  2PMZ F;  1PVQ A;  1IIP A;  1UPH A;  5A0L A;  4P0Q B;  5CRX A;  2CN1 A;  2N1R A;  3T79 A;  3GZF A;  2K4H A;  5HR6 A;  2XI9 A;  1A0P A;  2ZXH A;  3PSI A;  4NV0 A;  3AL0 B;  3VCB A;  1PVP A;  3IP4 B;  3AQE A;  2LYB A;  1YT3 A;  3OPX A;  3ICX A;  2ZIW B;  4OJL A;  3F2D A;  4CRX A;  2ZIW A;  2E5S A;  2KJ5 A;  2Q4T A;  3CYM A;  5KL8 B;  3LVW A;  2KKV A;  5KL1 B;  1F44 A;  2F76 X;  5T14 A;  1Q3V A;  1Q3U A;  2H3F A;  3O0F A;  2KOB A;  2NV3 A;  2G09 A;  3CP8 A;  4GFJ A;  4IC9 A;  5HR7 A;  2JH1 A;  1URJ A;  3AQF A;  1T94 A;  4C0Z A;  3VC8 A;  2XID A;  2HOQ A;  3N7P D;  2CRX A;  2WB1 F;  2WAQ C;  4U7C A;  2JMG A;  3RFA A;  3PZP A;  2PMZ C;  2VJ5 A;  1L6N A;  2M0N A;  2OXO A;  2KIC A;  2W03 A;  2G5H B;  2OM6 A;  3F5A A;  3K1Z A;  4CGZ A;  1ZQ1 C;  3PSF A;  2YB1 A;  3LYS A;  4OO1 J;  2Y0S F;  4FZL A;  4QIW F;  4AYB F;  4P0Q A;  2KJ8 A;  4OJ6 A;  2JGA A;  3F2B A;  4OJP A;  5C0Y A;  4NWI A;  2KNJ A;  4QJF B;  3PSP A;  2OH2 A;  2H3I A;  3F53 A;  2HBL A;  1OUQ A;  3D2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...