2KI6A

The fgf1-s100a13-c2a hetero-hexameric complex structure: a component in the non-classical pathway for fgf1 secretion
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
128
structure length
128
Chain Sequence
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Synaptotagmin-1
total genus 21
structure length 128
sequence length 128
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2ki6A00
3B7YA 5JHBA 2ENPA 3TJPA 1W15A 1DJGA 1E7UA 4QJ3B 4GB9A 4KZCA 1QASA 2K8MA 2JQZA 3JZYA 1QATA 4LDCA 1E90A 4FHJA 4ANXA 2ENJA 3MJWA 2CHDA 4F91B 2WXKA 3TWYA 3S2AA 4ANVA 4EZJA 1V27A 1GMIA 3ML8A 3APCA 4WWNA 4Y1SA 2LHAA 1UGKA 3ML9A 4FADA 2R83A 3P2BA 1DJHA 3QJZA 1TJMA 1DJYA 3L54A 1E7VA 2WXIA 3W57A 4BFRA 5EDSA 1WFJA 4TV3A 1DJWA 2A5UA 2QZ5A 5H4ZA 2Q0ZX 3F00A 3HIZA 1RLWA 5G2NA 4OVUA 4GNKB 4MJJA 4IQHA 4ANUA 3PFQA 3PREA 4QJ5B 4URKA 3F05A 4L23A 2B3RA 4XX5A 4EZLA 1K5WA 3QR1A 1E8WA 4KITB 2CM6A 4BGDA 4FA6A 4XZ4A 5G55A 3SD5A 4ICWA 2WXHA 2FJUB 2ENQA 4FJYA 4G11A 1E8ZA 3NSJA 2WXQA 2RD0A 3DBSA 3L13A 1RSYA 4EZKA 2ISDA 4L2YA 1DJIA 3GPEA 4LCVA 3L9BA 2ZKMX 3F04A 3L17A 2Q3XA 3CSTA 4QAMB 5CCGE 3IM1A 3IBEA 3L08A 2DMGA 1DSYA 2K4AA 4JPSA 4DNLA 2WXOA 2NCEA 4F1SA 2KI6A 2WXJA 3L16A 2CHXA 1CJYA 2NSQA 2WXFA 4J6IA 4PS8A 2CJSA 4WEEA 1HE8A 3N5AA 2A4ZA 2K45A 3NZUA 4F92B 3CSFA 1E8XA 4V11A 4TUUA 4NP9A 4WAFA 5CCHE 2DMHA 2NQ3A 3ZW3A 4PS3A 3OAWA 3RPBA 2WXGA 2WXRA 4LT7A 3W56A 3T8MA 1DJXA 1E8YA 4ICXA 2CHZA 2WXLA 1A25A 4A55A 2X38A 2CM5A 4KZ0A 3KWTA 3TL5A 4AOFA 1W16A 3KWUA 3ZVVA 1YRKA 3QAQA 4NPJA 4HLEA 1TJXA 2WXNA 4WWOA 4XE0A 1UOWA 3RDJA 2WXMA 2K3HA 3PRZA 2CHWA 3HHMA 3PYCA 4L1LA 4NPKA 1UOVA 2Z0UA 2WXPA 4WWPA 4FLHA 3APFA 2Y3AA 5CCJA 5JHAA 2YOAA 3APDA 3ENEA 3LJ3A 4FULA 3DPDA 3NZSA 4IHBA 4QJ4B 3R7QA 4DK5A 1BCIA 3L4CA 4NS0A 2FK9A 5T8IA 2V4LA 2EP6A 3QR0A 2D8KA 2YRBA 5KJ7E 2N1TE 4PS7A 1RH8A 4ANWA 4OVVA 3F01A 2BWQA 4FHKA 3R7RA 2UZPA 3HN8A 4L1BA 3ZIMA 4F93B 1WFMA 4TS6A 4FJZA 5H4YA 2QZQA 1BDYA 3QK0A 4Y1TA 2CJTA 3OHMB 4HVBA 3FDWA 3PS6A 1BYNA 3M7FB 4AJWA 1DQVA 3QARA 1DJZA 3FBKA
chains in the Genus database with same CATH superfamily
2CLRB 4BM7A 2VLKD 3HB3B 4YIQB 1F2QA 1DQQA 3WD5H 1N5YL 3P0VH 2AEQL 4XNXL 4F91B 3D2UB 5DRZA 3DPBB 4HPOH 1A47A 4H25B 5DUPH 1JGUH 4P46A 4J4PC 3ARFD 4AEEA 2YO3A 4PGBA 4LSPH 4YVUA 5FO2A 4E9QA 4B9IA 5C9KA 4UMGA 4YSPA 1PX4A 3WNJA 1R75A 2PYED 3DVGA 1BAFL 1WUZA 1HWGB 3BPNB 5D1QB 5EU5B 1B3IA 4QXTB 3WFZA 1QSEE 4I13B 4LMQE 5CNHA 3UTTB 1E4XI 1VENA 2ESVD 2Z35A 2JI2A 1YC8A 4PJFA 4FG4A 4JKWA 3JTTA 2VN3A 3FTSA 2L3BA 3H54A 2X40A 3HPLB 1IC4H 2HTLC 3CMGA 5CD3A 2UX6A 3BYTA 3MNDA 1DR9A 3FKUS 3TBWB 2CE6A 3RL2B 1PZ3A 3X1BA 5EIQA 2HG5A 3OG6B 4JCMA 4EI0A 5A2KH 7FABL 1EFQA 3L3OC 4N8CH 5EUOE 3P11L 4Z0BL 3RWGA 2D2OA 5AYUH 1VGKA 2DQIL 3CLFH 5DTFA 4LMQI 2ADGA 3VGFA 4F2FA 3P4LA 3CFIC 3MRGA 2OV0A 4IMKA 4QD2E 4ZOCA 1WAAE 1A9EB 1B4TA 2FB4L 3QUMH 1CYXA 3SPGA 1A6AA 2ATPB 4HMEA 1GY2A 1RUML 4UB0H 3T04D 4JO5A 4PRPE 3P02A 4ONGH 5D6DC 1A25A 2Z4QB 1EHLH 1EEQA 3PJNA 4NBXB 3BRGC 1A64A 1UT1A 1XB3A 1RJZA 3DKHA 5E94B 4YGAB 2WTOA 5J13C 1I3GL 1LO4H 1V55B 4A7UA 7PCYA 3O2DA 1SQ2N 2WOYA 3DX3A 3TCTA 1VFBB 3PDOB 4WFFD 3U4BL 1T66D 4HHWA 2W80C 4FQQA 5T3XD 4P05A 1XBRA 1JGUL 4N2DA 4DOHB 3LIZL 2Z91B 3LZNA 4OKVB 4ETQA 1GZHC 4QTIH 1QA9B 3NACH 3CN0A 2QDWA 4BELD 5D7IB 1AIFB 5EFIA 1IAOA 3E1ZA 3SKOA 4ZI8A 3KYOA 4G6MH 4H7VA 1UD3A 2H32H 1C16B 3GJFK 1NGWA 3FCTA 3MGTA 3QUZB 4RGMC 5DZOA 3WKNA 3BH4A 1FVCA 5CZKA 1KBWA 5CGYC 1JP5A 2WJ7A 3UTTD 4GXVL 1QWUA 4ABVA 1U8PA 1HINL 3NBNA 2WLIB 4FFZA 4Q8BA 1KCVL 5BW7C 1M6UA 1XGUB 3DSFH 1U8LB 3BPNC 3DGGB 1BBJA 1MIML 4FF9A 4OY9A 1JPST 4W9GC 3U1SL 4KMQA 3UX9B 4JRXA 1C08B 1OK0A 2F2HA 1RJYB 3SOBH 2NY4D 3F58L 2F54D 1NOLA 5IQ7H 3DX7B 1BOYA 3WEBA 3WKML 4K73A 1NFDE 2R1XB 1T7WA 5F0PB 4AE1A 5CZVL 4Y1AD 1OQOA 1AGBA 4JFXA 3DTDA 4PV8A 5DJZB 4HCRH 1O0VA 2YXVA 3MGOB 3CJJA 5GJSH 3FULA 2Z31A 2KZKA 2P8LB 5B7MA 1YYML 4PLJD 4OFQA 2W65A 2XTJD 1GGCH 1GGBL 5AVQB 2GUOB 2NNXA 4Z77A 5BO0D 2NSMA 3AZUA 4HKXB 2VLRB 5KN5A 2H2PD 2WAHA 1VKXA 2QTVA 3U83A 3ZDYF 3BGFB 4PJBA 2FL5A 5I0VA 4Y9CA 3HG0A 5INDA 2HTLD 4G5ZH 1FGVH 1DYZA 4J8RA 1CN4A 4UQEA 2YQGA 3BE1L 4K3EH 1DEDA 3VD9A 4P2OD 4DESA 3M8OH 4ZSOB 1F4HA 5EHFA 1Z6JT 1JUFA 2YK1H 3DXAA 2QVTA 1NBVH 1ORQB 2ADIA 2R4SL 3ARED 1JGLH 2NYKA 4GSUA 1HESA 2OSXA 2X4NA 1OPGH 1MVUB 5C3TA 5LGYA 2ZOWA 4ZFQA 1HH9B 1KYUA 3LKOA 4KKAC 3D85D 4H1LH 2MNJB 3BH8A 4L4VE 1JHLH 2QQLL 3NK3A 1MNUL 4QHLB 1G94A 2HUHA 5HSFA 1S7WA 1NL0H 4W6XB 4WEBL 4X9HA 1UJ3A 2HRHA 4M5ZH 1KCSH 1NMBL 5KTEL 1J0ZA 1KY7A 4RGOL 3MLXL 4ZFOA 5FHBL 1SUJA 5K39B 4HS3A 2ADJB 5DRWB 5IVOA 1CDGA 5LDUA 5DQ9A 2X4PB 2P8PB 4HA1A 1CLYH 4M5TA 5DK2A 2WBJA 1IKNC 2DEYX 1UWGH 2HVKB 5SWZE 3I85A 4ANWA 2NY1B 1PD0A 1I8UA 3QQ9C 4LRIA 2H9GB 1W0WB 4PJ8A 4UT9H 3T6XA 5KUMA 3UO1L 2YPKB 2HWZH 1A6VH 3CX5K 4HQQH 3T1FB 2CJTA 3EH5B 3FDWA 2JKLA 3EDFA 3QPXH 3F83A 5CJOH 2W60A 2YWZA 8CGTA 4CJ1A 5HGDA 1N6VA 4WENB 2DLEA 1CXKA 2W60B 1OB0A 1J0IA 1W72L 3MRHA 1ICTA 2WPGA 3CFNA 4HIIA 2QT6A 4MLIA 1R3JB 2EH8L 5FDYA 3FMGL 4XN4A 3KHOA 4JDTH 3K72B 4WU5B 5IJDC 3VYPA 1FVCB 3SQOH 2GAZA 4FZ8H 5A6IA 1DJYA 2P5WD 2NY3C 1P4IH 2HVKA 1E9OA 4NLHA 3SDAB 5I0DA 3HI5H 4NFDA 2KC0A 2OJEB 4MB1A 1DVQA 4PWIA 2P5WA 3CVBA 5GGTH 4YGVB 5G2NA 3P0VL 5C8JA 4OIIL 3GTTA 1CF8H 3BOVA 1OTUD 5IBLD 4FN0A 4JRYB 3UTSE 4K3HA 3DHJA 1OPGL 2F7IA 2UXTA 1GYCA 2DICA 4LSPL 4ILDA 4KMLB 2EEAA 1XH3B 5JW4N 3SOTA 2DQEH 2W95A 2G2PA 3BZFB 1JN6B 1IX2A 4P2QB 3H4FA 2AAAA 5CMAB 2VDNL 2NW3B 4AL8H 4DGYH 1QLEB 2AI0L 3WMPA 1U8CA 3QORB 5B3JF 4I3RL 1PBYA 3NZ8A 4M93C 4XO8A 2GUYA 4QXUH 1IGML 4B53A 1CJYA 4TNFA 4KUCF 3I9AA 3UIZA 4GRLA 3GGWA 5D5MA 4UV4L 1NBQA 3O2DL 5D96C 1FE8H 1MNUH 2WVVB 2NNFA 3ECBA 4N8VA 5BS0D 3MRBB 1AKJA 4IIZA 5KYNA 2EXWC 3K6DA 2YRLA 5FO8A 2GABA 5I9QC 2MH4A 1DVZA 3WE6B 15C8H 1DQDL 3H4HA 3COOA 4OLVH 4XI5D 4EUPB 1AZCA 4PGJA 2AXWA 1IJNA 2IWKA 2W07A 3CVHB 3MBEB 5INCA 5MP6L 1X4XA 3WUZA 2ICEB 3ZY7A 1C5CH 3F85A 4BDVB 2O6DA 1NGWB 4K9EL 3V4VH 3T5WA 4L4TA 4OLYH 3R8BB 2QMJA 1YEGH 4G6KL 3SE4C 1N4XH 2G2RB 1DBAH 1SVZA 3I6GA 4OB5H 4FFYL 1XCXA 2JTYA 5EBGA 1R24A 4JKLA 2H8PB 4OZGB 3SQRA 3ULUE 5AYQA 4N2LA 3HUJA 1ID2A 1CICC 1UOLA 1OSYA 4A7QA 4BIKA 1SRDA 1P69B 2WVUA 1KBVA 3PV7A 4KOCA 3UGEA 4X4ME 4X9FA 5AG9A 3N3EA 1HI6A 4Z0XB 1P84J 3BAWA 4OIIH 3FO9A 4QDGA 2FVNA 2OJZH 4N2EA 3RJQB 2YPLD 3OPZL 2TSAA 3P4MA 3V6BR 5FO7B 2XTJE 3HLKA 2KLRA 2RGSA 3IDUA 1RK0A 2XPGA 3OG4B 5EUOB 5SWSA 3E6FA 3VUAA 2Z4QA 5K9OA 5KBKA 4HWZB 4M7LT 2EECA 3FU6A 2V2WA 2FD6L 3FQ1A 1EXUB 5JQHC 5DURB 2IBBA 3QWOA 4NN6B 5DGQA 5IHWA 5GRZA 1N5AB 5IGXH 4FC3E 2CLVB 4N4YB 2DEWX 2BHUA 3W2DL 3RZCD 5F3FA 5EZIH 3MA7A 3Q3GA 1KCVH 3QDMB 3FRPA 2Z91A 4X6CF 1S7XB 4L29B 4TNVK 4UMSA 5F2FA 4WCYH 1T03H 4JRXD 1FNGB 2ZWZA 3UPCA 3FFDB 1YYCA 3ZHDA 1MHHA 4ONHA 3HNSL 5GS1A 5EBMA 1HNYA 4R96A 3L9YA 1U3ZA 4RQQA 2B1AH 3BZEB 5E94A 3Q5YA 4KXAA 2OX5A 5I1CL 2ZAHA 1ZLUK 3F04A 5FEBA 4TVPH 4G6FB 5CCKL 4LSSL 4J8QA 1GZHA 4UANA 1CDYA 4F1SA 2RH0A 3WFBL 3QP3A 4V2CB 3D5OF 3K2MC 3WS6A 3O2WL 1F3DH 3QJSB 4PJ7E 4U0RB 2ADGB 4PJDE 3OJ2C 2YLHA 3GB7B 2NXZC 3T2NH 4QO1B 5C2UB 5KG9A 4OZIA 3MBEC 4MJIE 1DQMH 1YY9C 4GEIA 3CDGB 2X9WA 2Y3NA 5HDOA 1QBML 2ATAA 4KAQH 5FO9B 2XV2A 2ICCA 4NO3A 4Y9BA 4LKCA 2JWYA 1QWHA 2GK0B 3LMJL 2XV6B 2Y1YA 1CGSH 3L5WA 1FLRL 5FA4A 4U1MB 2E27L 3EDDA 1UGNA 4NJAL 1QZ1A 3IFLH 4ZS7H 3MR9B 5ESQB 4MD0A 4JO8A 4JY5L 4PN6A 1N8ZB 4XNMA 1I75A 3KJ6H 2AEQH 4U1SA 5EN2A 5ADOH 1TUPA 5JPNC 3L4CA 4BSVB 1PD1A 5CD5D 2VC2B 3L95B 4L18A 5EIIA 1J5HA 4OV5B 5DMKB 4Q2ZB 4NKDB 1SDDB 1GGTA 5DFWH 4HAKA 3GSNH 4HCRA 3NEOA 2ZIDA 1BXAA 4JFDE 3SDXA 3DPBA 5C1MB 4WFEE 3A22A 1J1XL 4LVHC 4D0CB 3HC3H 5M94B 1BOGA 1KJ2B 3GJEA 3ZE0F 5F0LB 4MA8L 5ANME 4N2KA 1LO0H 4LHJB 1FL5A 3WELA 3FT0A 4KXBA 1V27A 1WA0X 1Z66A 5DQJB 1H9DA 2XQYG 4A04A 4DWHA 3MDJA 1HHKB 1UWXK 3GSWA 1QYGL 1KFAH 1QTYT 3AS1A 1QR1A 1RU9H 5GS1C 4WUKH 3H6AA 3D09A 3WUWG 2ZUTA 1AD0B 3F64A 4IIQB 4A2DA 4NKOB 3V7MA 3SDCB 1EO5A 1UFGA 5FYLH 1HZLA 3DX8A 5IF0B 4OCYL 4HIHB 3WJMA 3QCUH 3SDDD 5TE6H 2JIXA 3LKRA 3ZU8A 4BQBA 4DF9A 4BK5A 2BERA 5AOLA 4ZJ9A 3QQNA 4WU7B 1QFOA 1WP6A 3C60C 1UQSB 1J9SA 3LKSB 2YA2A 4MNGB 5KJ4A 1PLBA 3B9KA 4NOBA 3TO4D 4EZMA 4ONGL 3TV3L 5ISZD 2R0KL 1AO7E 4K3DL 4UT9A 3STLA 3HG1E 1A9BA 2BVOB 1XH2A 2J72A 4P49A 3RGVA 4R90L 4EBQH 4K3JL 2DN7A 2HKHL 3KZ8A 3OKEB 4BQCA 4UTBL 4YFLF 5C0NC 2IC2A 4OD2A 5I6XB 1UA6H 3T77B 4F27A 1NCWL 3EF4A 1WZMA 2X5PA 2IBZX 2X2JA 3ATDA 2FHBA 4L8SA 4Z95L 1T22A 3D08A 5IM7A 2R56L 4M7JH 5AVXB 2MTAA 1EXUA 3EJPA 1ZIAA 1I53A 2C1OA 1LDSA 2DZEA 3B43A 1XXDC 2EDRA 3P0YL 3NACL 3CZJA 2AGJH 4HWZA 4X5QA 4FFYA 3NIFB 4JY5H 1ED3B 2FH8A 2F58L 4RDQG 3ZXAC 3NCXA 3E9UA 3V8CA 1FAKT 5IHZB 2JI3A 4LLQB 3MRJA 5CLYA 4IBSA 5AOMA 3QDGB 1M2VB 4DUXA 4I1PA 1WBZA 5D1ZC 3BCDA 3ZUCA 3MRCA 5E03A 3TV8A 3SDXE 1B3JA 2BMKA 1WZ1H 4BSVA 4GAGH 1PNCA 3O81A 3Q5OA 3ENEA 5DHYA 3V6OC 4IHBA 2DQUH 4X6FB 5DJ6A 4J2XA 1SXSA 5AW8B 4RNRB 5J1SC 1EUTA 3WYRA 4C56A 4M5SA 4LCIL 4YXHH 5CFHA 1RUKH 1A3RL 4OVVA 4YUEL 4ZQKA 2ZG3A 1FYHB 4FFWC 4LARL 4UAOB 3RL1B 3ZTNH 1NGPH 3L6FB 5F93C 4ZXBC 3NFNB 2IV9A 4OCLC 3SDCD 5I71B 5EF0A 1MWAA 4L4TB 1GHFH 2BNUB 1XR9B 4HJ0D 4ZS6D 2OCJA 2OL3L 3BP7A 3RRQA 5IBLC 3RNKB 3UYOD 4KUZL 4ODHL 3EOAA 3DV4B 3U7YL 5LQBL 4OZIF 3HI6H 2DOCA 2YZ8A 1Q72H 1EA9C 1ID5I 1KCWA 3GHBH 2DL2A 4AYID 1MH5A 3M07A 2F7QA 4AKQA 2DV6A 2QPSA 1VADA 3PWJB 3QIWD 4AXWA 3FSOA 3DVNA 1AKPA 3II3A 3RA7L 4K3JH 1FAIL 2J5LC 3OPZH 2R8SH 1HK6A 3MSPA 4GRLB 3EJRA 4LLMA 3TFKC 2MNWA 4GUQA 4NEHB 1S8DA 3MV8D 4D9QE 5TDNB 1DCEA 2LAAA 5IQLA 1FC1A 3Q1SL 3JUZA 4MNQE 3FUNA 1SOKA 4P5TA 1TQSA 5C70A 4XNZC 3WS3A 4WNQB 3KPSE 4ZTOH 1GAFH 2VCOA 4OV6F 5DLML 3L13A 4NDMA 4JM2B 5IJVB 4X6CA 5C3LD 3O6FC 1QSFD 3S7GA 4KJWC 4H8WL 3HS9A 2OMZA 3FRPB 1SEQH 3L1GA 4TSBL 3TVMA 5I17A 3OB0H 3ERXA 1XO8A 4K4KA 4JFYA 4JPSA 2ARJB 5C2BL 2XFXB 4HIXL 3I6GB 4ELME 2Y07H 4OM0L 2Y2WA 4PBXA 1RUAH 4PD4K 1MHCB 3ZKXB 2AGJL 4PJEF 1MUJB 3RVWD 1RXLA 3BEVB 5E9NA 6CGTA 2BOBA 5TF1H 2IPKA 3QH3A 4FQHA 1U8JA 5ESVA 2WLLA 5DXWA 4CVWA 1ES0B 3RHWF 1RIUL 2NY6B 5IVXE 1B0GA 2HJKB 4TOYH 2WZ6A 1UZ6F 3QUXA 1B4JH 3FT3B 3IAGC 4JQXA 4I87A 3U2JA 4WWOA 3A47A 2H26A 4DGVL 1GIGH 2IDQA 4IGBB 1P7QD 5IUSA 5I6OA 4QTHB 2JH2A 5FYJH 1BM3H 1R34A 4LU5H 1T2JA 4WWPA 1D5MB 3MV7A 1J0JA 4JHZA 4C54A 3EYUH 2ALAA 2W65B 3RIFK 2HA1A 1FHNA 3L9RA 3QEQB 5ICYB 2UXGA 3X13B 3TPUB 3DBXB 4F7KA 5DI8A 2R51A 2EIZA 2P80A 3GZPA 1EEZA 1JN6A 3VMPA 1NGYB 4P2RD 4LCWD 5F1IA 1E28A 3T6QC 2C7UB 2CIIA 2HLAB 3AXLB 1U30A 3DO7A 2VISA 5KSVA 4ANXA 1L3WA 1PFCA 1GJWA 1MQKH 2LQRA 4U6TA 4WTXA 1JVLA 4PP1C 4JPQA 4PW9A 3SDAA 2XKUA 1FVDA 4M9OA 4LCWB 5F9JB 5AD0B 3E7JA 1GSMA 5ESVB 3FTYA 4I2XE 3HI1A 4ZK8A 4MNQB 2XQBL 4LCWA 4LVEA 2AI0H 2I5YH 2ZWYA 2A9MH 4GSQA 2FSDA 1WE5A 2CA4A 2K6WA 1AR1C 3Q1EA 3PFQA 3SE9L 4PY8I 5ECJE 4JDZA 3NA9H 1NC4A 5FOJA 2J3SA 4K7PX 1HN1A 1RZKL 3DO7B 3M88A 3TF4A 4F37F 2D7MA 2V17H 2I25N 1DFXA 2Z8VC 4W9LC 4J12A 3MRNA 4GUPB 4HS8H 3FOLA 1FSKC 5I16B 1UVQA 5C8JB 3NJIA 1JRHI 3ZO9A 4LLDA 2QADD 4UDTB 4LLAA 4TM9A 1ZXQA 1M05A 3F7LA 3LRLA 1MCPL 4ZRGA 4H0HB 5T5NG 1VFOA 2HTKD 3L1EA 4FQCH 4QGYA 3V0AC 5KEZA 2MQCA 4FOMA 2UZXA 3K4ZA 2DLGA 2X53A 4QHNB 3JWNG 3U7WH 1T7XA 2FT8A 4R5XA 1IKFL 3O45B 1NLDL 4OGXL 3T6ZA 3IE4A 2UZIL 1COBA 4EI5B 5C0BB 4XP5H 1KBPA 3OPUA 5GSRA 2AAVA 1LE9A 4PJAF 3QA3B 5EA0H 1NGZB 4M8RA 3QEUB 3QIUB 4OZHE 3P77A 2DQDL 1JI2A 2VAJA 1S7TA 4BZ2H 1D9KD 1IGTB 3MRLA 3FQYA 1OE3A 3KM1A 1IEHA 1A7NL 3V4VA 4CVZA 3SDYL 3ZKMC 1ZTXH 4OLUH 1MCQA 2F54E 1LP9A 5E70A 4HS3B 1A6ZB 3ARFC 43C9B 4G8GA 3GI8L 3GZQA 3R19A 4XPBH 3CVCA 3S98A 3JVFC 3MTRA 5F7DA 3TZVD 3F84A 1XH3A 3ME0B 1TJGL 3ARFA 1E4XH 1XH1A 4NKQB 4K5MA 4QRRE 4EN3D 2Q8BL 3FXIC 1DANT 5IW1B 5DJXB 2A6JB 1RPKA 3Q0HA 4I1NB 3HG1B 1F0LA 5HGBB 1JZ4A 3RTQA 2P5WB 1MFBL 1Z3GH 4YHLL 1ZGLB 4HBQA 1LMKA 4WW2B 1N3NA 5FYLD 1O6VA 3QEQA 3S88L 3HN3A 4P9HC 2GSIB 3MLXH 1PLCA 3VWKB 3QXWA 4PCSA 1KPUB 1F4YL 3VXME 3IMRA 3WTYA 5HYSA 2IPUG 2QQNH 2HXAA 3JVGA 3TZVA 4KKAD 1I85A 4LP8A 3ROLA 2E59A 2P7TB 1PKQA 3LH2H 4N90D 4TV3A 2R39A 5AEAA 4Z7OB 4G6AD 4XNUH 3ARDD 4GAYA 1KLGB 2CO1A 2CO4A 3DXAE 5D72L 3L5XL 1G7JA 5EH1A 1H3GA 4R3SB 3OSKA 5LGKA 3K46A 1CDUA 5EU4A 3WEXB 1UXWB 3IFNL 5DD1H 1XCTA 1ADQL 4WI0A 2FGWH 3R06A 4E2OA 4G8IB 5JORB 2D3LA 2GCYA 1F1GA 2IG2L 3EDKA 4F7EB 2BK8A 1TQTA 5D96B 2KZ1B 4KNQA 12E8L 5ALCH 3WIIL 1X7SA 2VM3A 2B8OT 5JR1L 2OMTA 3LN5B 2AXGB 5BVJB 2X4RB 4FLRA 2Z93B 4ABWA 5E6ZA 1U92B 1WCQA 1SJEA 2VXSL 2QPFA 3FN3A 3RHWK 1CFTA 2VWEE 2GY5A 1OHQA 1QRKA 1VAHA 4HX1A 4KDTA 4YHKH 1LO2H 3C12A 4A68A 2W88A 1LQBC 3FQNA 1FV1B 1C7TA 1S7RB 1ZHBA 5ADPH 3KLDA 1GR7A 3WEAA 2E75C 5FYJD 4ZMOA 1XB8A 5D7LE 3CSPA 2DTML 3S5LG 1UYWL 3FT9A 4GUOA 5GGQH 5DVNA 4ZDHB 1HJCA 5T5NF 1CFQA 5DK0A 1QHPA 3JWOL 3LIZH 3WHE0 2E0PA 1W16A 3AJ7A 4C47A 4BFJA 4FFVD 1DLFH 3ABLB 3EO1B 3JWDH 4JFEB 1RUAL 1X5GA 4HCGA 3DRQB 5DO2D 1SLVA 4F24A 1JIBA 3PIQA 2DWTA 1R47A 4GI9A 2WZPA 2EACA 2JJSA 3AM8C 3MRGB 3BRDA 3HA0A 2J1XA 3AG1B 3DO3A 2A4EA 4P8QA 3O3AB 1BFVH 4U1IA 4U1NA 2NTFB 3PABA 3F12B 3NCCB 3HE7B 3X3GH 2Y5EA 2ODHA 4DKAA 1NIDA 4OUUB 4PJ7B 3L4WA 1MRDH 3NGBB 3T0EE 2O5XL 3FU3A 5DT1H 2F1EA 3HG4A 5SWZB 5C0RL 4XR8C 2YUZA 4DJMA 5JHBA 2GITB 4PRHB 2JIXB 3LKRB 4X5LA 1QSZA 2IWFA 4Y2OB 4BFFA 3QFJE 5BV7H 3IFOA 2IWGA 2W9DH 1S7VB 3UMNA 3AS0A 1E40A 5IB3B 5TDOA 2AJ3B 2N0MA 2GPZA 3U6RA 4PJBF 3V0GA 3O4OC 4MXVE 2JJUA 1DJSA 2R4RL 4GG6B 4HHAA 4PFEA 2JB5H 2C4FU 1G6RH 1IEAA 2FWLB 4L4VB 3QS3A 4M4RB 1XGUA 3VU2A 1G7IB 4NUGL 2R0KH 4B9JA 1EHLL 3GSQA 4P4RA 2NSXA 4ONOA 3MUGA 3UTQA 2GTWA 4G70B 3UBXB 4CC4C 2AQRA 3QC6X 1XQ4A 4PCTA 1U8OA 4PJGB 1VHPA 4G11A 5HHXH 3AMLA 3LX9A 2EYSB 1JPGB 1A3LH 1YPZE 2APSA 3CVHL 2AJZA 4XHJC 1L6XA 4BH7A 1NFDA 1JF1A 1QUNB 1IM3D 3QCVH 5IR1B 4L5FE 5HPMA 4I18B 2I5YL 3QFDA 3BAXA 4U1JB 3N40P 4IBLT 4ALAL 1JGLL 1WBXA 5CZVH 1A7BA 3C8HA 3CH1B 3D18A 2W8CA 3K8LA 3KEDA 3NA9L 4FKEA 4TL4A 3N1PC 2EZ0D 3OF6D 4IW4C 1JHLL 1UCBH 2QQLH 2WY3B 4ZW8A 4NRXA 5L4IA 1FYTB 4WU7A 4LSRL 3JWOH 2FWOA 4JO2H 3MRRB 5I1JL 3PAUA 3Q13A 4JGMA 2QV4A 5D1ZD 4A37A 5I5RA 5D4IA 3DSFL 4UT6A 3FH7A 2OQJA 4GFXA 4HISA 3SGDI 4LESA 3UDWC 4ZX3A 5MI0C 4XCEB 4N20A 4ODXB 1QLEL 5A6MA 1QLRB 5DJYB 1MLBA 1YQVH 2EDWA 1PYWB 5GGSY 4LHUG 2YPLE 1WPCA 3REVA 3WN5A 1J8SA 3CHQA 2F5BH 4QO1A 3NH7L 3OKOA 5AAWC 2Y69B 3KPQB 1QPXA 2Q2EB 4JZJC 1FLTX 4HXAL 5CCJA 5DDHA 5FW8A 4WGKA 2NUPB 4PWGA 3VQMA 2RMNA 3EJQA 4RAUB 1HNGA 4X9BA 1Z2KA 1QFWH 2YUWA 1WV7T 5ICXA 4N2GA 3VG0L 2X4QB 4I0PA 1BFSA 4ZW5A 1U92A 4PRAB 3VFGL 3VM5A 1OSPH 3KR3H 4X80H 1L9MA 3TJEL 4S2SA 4PRHA 4UNIA 4IOFD 1JPFA 4BZ2L 4N9GB 1LWJA 5SWSD 4EVNB 1PW3A 3OR7A 2WSDA 4Z7QB 5GS1B 1WWBX 1QASA 2IAMD 2VC2H 3FQRA 2IBGA 3PQYA 5T1KA 3O9WB 2XZQH 1SJHB 2BIQA 4N8VG 5L2KD 3ZRCC 1JWSB 1BXXA 3KYKH 1S9XB 4KX7A 5E8OA 3NP3A 1D9KC 2DDQL 1D7DA 2AXFA 5KZCD 2FX7L 1GTFA 6FABH 2XZAH 2A5UA 1EZSA 5TGBB 3ULUH 2W0LA 2X4TB 5EBLA 1NEZB 3CAFA 3VAEA 4FQXD 5C09A 1NCHA 4HUNB 4QJ5B 4I1RA 2V9RA 4YHPB 1E5UI 1IUZA 3J07A 1MKFA 4H8UA 5IWLA 3CDGA 3QUYA 2AP2A 4UF7C 1DVUA 4FQ2H 4U2YA 2IANE 5IKCB 3T77A 4LSVL 5CZXC 2CR0A 4FXKB 4HKJB 1J88A 1OP9A 2WBXA 3DIDA 4NKDA 2VLKE 2BO0A 1E6OH 3W9EA 2R2BA 4WJ5B 3WSQL 1KELL 3IJHA 1T0OA 3BIBX 2Q10A 2BSTB 3KPRD 3ASOB 2DWEB 3RVUD 1SUHA 5I73C 4RETB 5GGRA 3JUYA 3L3HA 5GGTA 2XPYA 2PYEE 3V52L 1SN0A 4PTTB 4UDUA 1YEKL 1NEPA 1XCWA 1BJMA 2EYSA 1BFTA 2HWZL 2NY6D 2MIZA 2JELH 3KPOB 3NSFA 2CDEB 4HK0A 1JGDB 1BFOA 3IDJB 1YQ2A 4DZBB 3O3EB 5L2JA 1OL0A 2LLLA 1OGPA 1ESOA 4E9XA 2X44D 4OGYL 4DZ8B 4HIJA 4OFYD 4NJ9L 4BE5A 1J5OL 3ROOA 3VRJB 3BSZA 4HWEH 5GQBA 5I8EB 3IN0A 4X99B 5TE4H 5BOJA 2CPCA 2AQ2A 4FNUA 3TNNA 4NUJA 5DGRA 2EDTA 2HKHH 2F74B 4FLHA 3T4AB 5GISH 5I1IH 2DIJA 3HZMA 4D0DA 4TL5A 4D3CL 2ZTBA 2BHYA 2CNZA 4YXKL 5JXAH 1XSIA 1WBYB 3G5YB 2DMCA 4GKNB 1CIUA 3TTYA 2DKMA 2H2PC 5DYFA 4IEFB 4KXZH 5AKVA 3Q05A 4LP5A 3B2XA 1NZRA 2DQHL 2K4WA 3P4MB 5JQ6L 2VDOB 3QUKB 4DW2H 1F6LL 3FOLB 4MA1B 5AL8A 5AW3B 3D2TA 4ZFOB 5CINL 1YAIA 4DP0X 1RSFA 1F41A 2C1PB 2DIEA 1RZGB 2QDVA 3O0RL 4NI6A 4LNVA 2IFGA 4UZGA 2F6AA 1I8IA 1EHXA 3BKML 4XBGB 4HWUA 4N0UB 4K9EH 4JQVA 1H5BC 5KSBA 4G7SB 2FX7H 1ORSA 1K4CB 3K2KA 4IK6A 3RKDD 4FQIH 1Y6NR 3PL6B 2G2RA 2HFEB 2JCCE 1SYSB 1DJHA 1JXGA 3LHPL 2HMIC 1FE8L 4MA7L 2X9XA 3HG1D 2NY1D 2BP8B 3JV0A 3DXAB 2XWXA 2LLNA 4JY6A 2L7QA 3EOBA 3T4YA 2V7HA 3Q6GL 4PWJA 4KRPB 5CR1A 1N6QH 1IEAB 4TLUA 2V7NA 5F96L 2E9GA 4E36A 4DEUA 4G80B 1A65A 3O45A 5DUBB 2AJVH 3STBA 3FTGB 3ULUC 5HGAB 4MD4B 1DL7L 2R27A 3PNWA 2E7BA 1G9EA 2HKAA 4FFYH 3WLBB 5AB1A 4NQTA 1BIHA 1LYQA 4RA0C 3CH8A 4YBQC 4PRID 2NR6C 4EJ1C 4JG9A 4YHOL 1D6EB 1S9VB 2E7LA 2XG5A 1HCVA 5DQ9B 5KYYA 3IKCB 4X8JB 4H88L 4DCQB 5DC9B 3ESMA 1PQZB 2BCKB 3F12A 4RBPK 3ZKMD 4ZO6A 2ZUSA 1M7IA 3EYOA 2DLIA 3NTCL 3PWPB 1DP0A 4GLRI 4OSUL 5DJ8B 3SDYH 3T8MA 3WKYA 3HZKB 3VSVA 3FTXA 4TUOB 4NJAH 2BSDA 2CO3A 2IQ9L 1BQ5A 4WY7H 3DYMA 3QYCA 4FE9A 1IC0A 3MGAA 1U41A 1NDMA 4DP7X 4X5XB 3DX6B 5D5MB 5FM4A 3FQTA 2X1OA 3VX1A 3D7PA 1NPNA 1M1SA 2VLRD 1QP1A 2BP8A 4Y19E 1KIRA 2IPKB 4F3FA 3BX7C 5J6HA 1RZFL 4LCCC 1PZBA 4QNPF 5I1JH 4BZ2A 5DJCA 1XT5A 3SGEI 4Z0BH 4YAQA 2HLEB 3LNFA 5IJBC 1A6UH 3QI9A 3SDDB 1NQBA 4RGOH 1G1OA 4NQDE 2UZPA 1WEJH 4HJ1A 4XODA 4AYEC 3QI9C 2OMUA 5IW1A 2VITB 5EEXA 5DURD 4NQCD 5EEUA 4Q97A 2GKIA 1GY1A 2IMMA 4KJYA 3FBKA 5LNDA 4MNQD 3MXWH 1WD9A 5D1ZA 3P3UA 5E99H 1ZPLA 2NY3B 3G6JF 4BQ9A 3JZYA 4YGVA 2PYFB 2OW6A 4O58L 1D6EA 3DBXA 3FT1A 3ARTA 1FH5H 3RWFB 2IPUK 4OJDH 4WRLA 1RIVL 5DHVB 1AGDA 5HVWA 5JXEA 1FZKB 3QEHA 1A6AB 4RMVA 2A6IA 3N41F 1OM3H 5EDSA 3OZ9L 3VGDA 1ADWA 4NZFA 3NIGF 4PJ9A 3H85A 4P23A 1EO8L 4L8SC 4G82A 1MREL 3GJFH 2F8IA 1FCGA 3QNZB 1AGEA 1NMAH 1KIPA 4KY1H 4K8RH 1NINA 4E9YA 4AE0A 4XNYL 1OIOA 5GPRA 2R0WL 3VMNA 5IFAL 3CIAA 1TSHA 3DV4A 1LO2L 2DDQH 3NPSC 3HI1B 2VT0A 3KM2A 4HLZG 4NCDA 1H6EA 4YHOH 3BRFA 1F58H 4KNTA 1B4LA 2WN3A 3E1F1 4M4PA 4Y5VB 3RTLA 3OJDB 2VLJA 3HVDA 4GAJH 2ZWKA 1A3QA 4EIZC 2IVFC 1CXIA 1IAOB 3U9WA 1KIUB 3QRBA 4PJDF 2NW3A 2Q86A 4HP5A 2LOEA 1J48A 3CSBA 5I16A 2GBUA 3A5VA 5KSBB 2WZ0A 4JNXA 4ZW7A 5DJ6B 4DVRL 1CLVA 3EYOB 3PWPA 1CR9H 2PXYB 3VRLF 1OLLA 2RB8A 2XZCL 5DVKA 4F8NA 3HG3A 4BQ6A 4JRYA 2EVHA 3K6SA 2BH0A 3A0OA 5DFVD 5F0MB 2WXRA 2PCFB 3DVIA 4YEEA 5IROC 4B95C 5BZDB 2V9QA 2CM5A 2SODB 1ZT4A 4K71B 5DVLA 3SCMD 3MV9D 4GXVH 1FFNB 4H13C 4G8FA 5CO1A 3MREB 3BSHA 4F7MB 2FNWA 5E2TL 5TQ0H 1DQDH 2WVTA 1UENA 4J39A 3GSVB 2WXPA 2YGQA 3RI5K 1E50A 3O6KH 4K7PY 3RJOA 2H26B 3IBOA 4YLBA 1M7UA 5AW5B 3ZDYB 4JRYD 1FZMA 1G7LA 4JM2D 2E4FA 1J8RA 3VW3H 3HLAA 4XZUA 3WHXA 1LEGB 3BQUC 1WFIA 4C4KT 1SM3H 2EO1A 4TVPE 5GZOD 4DKFH 4BKLA 1TCRB 4QHUB 1N64H 2WKOF 3ATBA 4IOSD 4RIRA 1U8PB 5D7KE 4YLQT 3FAXA 3MAWA 4JO3L 1TETH 3QEQE 5CD5C 1R1CA 2ZP9A 3ARZA 1OAQH 2J1ZA 2FTAA 3GEWB 5AVRB 2F8XC 1YEJH 2V8MA 4HFWA 1ZKAA 3R0MA 1S5HA 1T3FA 1PX3A 2JK5A 2YN3A 4X6DB 5B39B 1AR2A 3HNTL 1O7DC 1ECYA 5D7IA 2PKDA 1IGYB 4FFZL 3IDNB 1A7NH 4OCXH 3QQDA 1UGKA 2X88A 3NRFA 3VFTB 2IALA 2ILLA 4M6OL 5IV2A 4G8GE 3FU7A 3FTGA 4F15B 5C6TL 5EC1B 2YJLA 2HJFB 1AQDB 3IFPB 5IFAH 4HHGA 3JV5A 2KLTA 2YGPA 4NX0A 4CMMB 2CH8A 1BBJB 2VDQH 4I9XA 3ZQ9A 5A40E 1Q94A 1QABA 4G7YH 1OT4A 3MRPA 1RCYA 1JZGA 1REIA 4U3CA 5B7EA 4XX5A 3GHEL 3IGLA 3LCYA 3TC9A 3VFMA 4J3OC 2Y5TA 4MAUL 4ICWA 4YIQA 1SOQA 1UCBL 1A6VL 1JUFB 1PZ5A 1EBAA 2H6UA 1BVZA 2H2SD 5GZNA 2AZUA 2J4WH 4E41E 2XFXA 3QWRA 4MB4A 3I50L 1MCNA 5IFHL 3KXFE 4U33A 1JZEA 2XBZA 4AV5A 3NSCA 7PAZA 1Z0NA 4PS8A 4LIQL 4R7DA 1UH2A 5DRNA 1XR8B 1PF3A 1UG9A 4IRSD 2A4ZA 3WOVA 1LO3L 4E42A 2XKNB 3CN4A 1NGQH 5E7BA 3HVNA 2YXFA 4WO0A 4NBYB 1NDGB 1QUNA 1QG3A 4FKKA 2Q3AA 2AEPL 4P5TB 4Y4KA 5BXFA 1J8HB 3U0WL 3S37X 3G6JE 4PPTA 5DJZA 2LLGA 4YXLH 3H9ZA 3VXMA 4KGLA 1KJVB 3T2NL 3SDXF 4EIBA 1YY8A 3IDIB 1BZ7B 1EVUA 4JO1H 3ZZ1A 3ZJAA 5HXMA 1MW2A 5ICZA 2XG4A 1AMYA 3CHPA 3Q2CA 1MY7A 3IDMA 4N0FA 5DDHB 3TURA 1NEUA 2A83A 5DD6A 1X5YA 4AKOA 5FYLE 3MLUL 1AHWC 4JPVH 3QJTB 4ODBD 3GUTB 4JK0D 4J5VA 1C1EH 3A23A 4QXGL 2P5ED 4EE2A 4DKEH 2I07A 2A83B 2HJKA 1B0GB 1PAMA 2BVQB 2D7NA 2FO8A 2L8AA 4J3BA 3ZSSA 5I6KA 1TETL 1A7OL 5L8LB 4NQED 4MDJA 5FUCC 3HN8A 4FMKA 4P4KD 4P3CH 2X09A 1UYWH 3N43B 3RWJB 4NHCL 1CLOL 4PB9H 1H3TA 4FABH 2C3WA 2O1AA 3DXAD 3FO0L 4XPFL 2UWEE 4Z3GA 2HP4A 3TJHD 3GMRA 3JBG7 4OCXL 3V79C 2CG9X 3Q48A 5I19H 4NUPA 2NXYB 3W3BA 4R5TA 4APQC 1E0OB 3ARVA 1C12B 1BM3L 3QZOA 4LU5L 4QRSB 3ML8A 5FM8A 5CR8A 1MFMA 5I8CA 5D1QA 5EU5A 3B5TA 4P5KB 3ESPA 3SYAA 3Q3GB 1R33A 4Z5RA 3FH8A 3VU1A 3C5ZB 1CC3A 1OP3H 3PV6B 3TH4T 1DUYA 4ZUTB 3HIZA 3KH3A 2XQ0A 3PWPE 3VH8G 2X4OB 1RIUH 4RX4D 5F89B 2FLMA 3KL0A 3Q2NA 5J4MA 2WYIA 1MCFA 3I74A 2VTFA 5IMKB 3U0TA 2OP4H 3AQZA 5FLVA 2DBJA 4BGDA 3MUGB 4P04A 8FABA 2XRAL 3PWJA 2UZYB 2MCPH 4XP4H 1CBVH 1TSRA 5T1JA 1IL1A 1QPPA 3H9SA 4FLQA 2BP0B 2A9CA 3O41A 4XX1E 3B6SA 3M1BB 4HFUL 5C0JA 1OOAA 3B7SA 1MAKA 1KC5L 3GO1L 4O02L 4N0YL 2BZ7A 2YXMA 1NA8A 2ITCA 3QQXA 4JFFA 1FORH 5H94B 5LBSL 4ZG1A 3JWNH 2EEXA 4FXGB 4M6ML 2H32A 3MLUH 2W81C 2X05A 4JR9L 2VZSA 3RGHA 5JOFA 4X9YA 4LL1A 1A14L 1P84K 2DH3A 3E6HB 3EOYG 2EC9T 3NZHL 2VLLA 2XWDA 4XVOA 3PGDB 3S5YA 4BFIB 4H1LA 2N0KA 1ILSA 2N01B 4OF0A 2O72A 2WXLA 3UDWA 1MHHB 3FSWA 4ONHB 4XVUC 1L7IH 1T89A 2FO1A 3K6NA 2JLPA 4RAUA 4YR6B 3W11D 3WE1A 3F7YA 4NQXB 2QQKH 4RA3A 4J4PA 1C1EL 1IM3B 2K9FB 5T3ZL 3OLDA 4L9LA 1E5YA 5E6SB 3OBAA 2FEEL 4OR1A 2VXQA 5TPWH 3UADA 4U1GB 2TRYA 2R9HC 4HJSA 3K2UL 3LHAA 2Q8AL 2WZ5A 4X7TA 2CWRA 1ERNA 5C09B 1ZA3A 1I1YB 4NHCH 4NUMA 2CBMA 5E6RB 3OHXB 4KQ3H 3QR0A 4ZX5A 2ED6A 4WI6A 3L5JA 1KACB 4PJEB 1E4JA 2A74A 2ZOUA 4UOJA 4J1UA 4TS6A 2Q3ZA 1VGEL 2LAGB 3ZSTA 2FHFA 4KHTH 3E0GA 3RILA 3IT8D 5DMGD 3U25A 4LCIH 4YXHL 4ZNCD 1RUKL 3QDJE 4YUEH 4KI1A 5AW6B 5E8EB 2ED8A 3MUJA 4BH8A 4NAMA 3HCVA 3KL5A 4NCC1 4PJCA 3SCMC 1VSCA 1MN4A 4FG2A 1HOCB 2B1AL 2D03L 2ZPKH 8PAZA 1HT6A 5KW9L 1JYWA 3GC3A 3LKSA 4YX2H 1WISA 5HPMB 4H1LG 5HHOB 3PGCB 1J9RA 2AXGA 4ELMF 3QZWG 5J3HC 2ZX6A 4IRSA 2OCCB 4B60A 1MLCA 3L2LA 5TK2A 2B5IB 1IGJB 2PPAA 5FHAH 5C0CB 4JZJA 3SPVA 4CN1A 4HLJA 4MJIB 1FNGA 3DROB 5AAWA 2E86A 2UY7B 4MCMA 4WI8A 3NQKA 4NZRL 2MHAB 1JVKA 2H0FA 3ARYA 1I4FA 3QA3A 3L3KB 4L8DA 4NXSA 4RESB 1ZS8B 5C08E 2GC4C 3WHXB 3QT2A 4N5ED 2BP0A 2COVD 4FFVC 1AI1H 3IK2A 5FGSA 3CTTA 3AREC 3FUJA 3H55A 1AQHA 1FORL 4ZNEA 1JWMA 4BCYA 1NPUA 2EE3A 1RL1A 4HIEB 3ETBF 1XIWD 2Y7SA 1CVSC 3DRQA 2V5TA 1IGFH 1FFOA 2EZ0C 3CN1A 2AK4E 4B27A 1NANH 4RAHA 3AW5A 4LE8A 1CTMA 1EHKB 1UWXH 3LY6A 3MBED 4H8VA 5LAPA 4B7LA 2Z64C 3FHAA 4F92B 3O4LE 4R96B 5F7EL 1EFXA 1L5GA 2DLFH 2P5EE 1VFUA 4MZ2A 4U49A 4QUOA 5BRZE 3HG1A 4PU2A 1A6WH 2QQKL 4KRMB 5D1ZB 1ETZA 3MV8E 4D9QD 2CKNA 4AJVA 2OMYA 2VQUA 3AY4C 2X41A 1GZQA 5EEVA 3N40F 1L9NA 4NQEE 2XWZA 4WV1B 3HPJA 5H8DA 1IBFA 5EPMA 2IG2H 3QDMA 2FH6A 4NWTH 3QO0A 2ZCHH 1B9KA 3ABMB 1NFDB 5KVFH 3EG9B 1JZ2A 1XMWA 2YAPA 4LF3A 3PHAA 4PG2A 1I7UB 1HHGA 2E7MA 5F9DC 2RQ8A 4ZUWB 2ICEA 4Y5XB 3ZKQD 1A4KB 4CSSA 5IHHA 4J3OF 2KYIA 2GC7C 1ROWA 3P30L 2BFVL 4JFZH 1CYWA 2WC7A 1QNZH 3MV8B 1LE9B 1A22B 1ZOXA 3KCPA 2JQMA 1RULL 1TZIA 2AJSH 3FN0L 3PQYE 4KRPC 1OCWL 2VDKL 4HXBH 1F6AB 4X8CA 2IAMA 4OCYH 1MCOL 3OQ3B 3HFMH 2BZDA 4GRWH 1KIQB 4H20L 4O2FA 3GBNL 3LEXA 4HCRL 1MFAH 2NLJA 5FYKL 1HZKA 2K8MA 4KMTH 1NBZA 4PREB 3D0AA 4Q89A 5C0IA 5L2KA 4TRPH 2WXKA 2NY0B 5JIIA 5BPPA 3WXWL 4Z3IA 5ITFA 4PJ8C 4C4BA 2NX5E 4JVWA 4EN2A 4PHZA 3MLWL 1HL8A 2OZ4L 4AQEB 1BQRA 5EBMB 4LKXB 3X14B 1CLOH 4L3ED 4MS8C 4PB9L 5INCB 4FABL 1GGIL 2CCWA 5DJXA 2WNGA 3AXIA 4KKZA 4R7DB 4U1NB 1BVLA 4J3UA 4R7XA 4HW6A 5HVFB 3ARGA 3K1KC 4I4WA 4PRNA 4XN8A 4FAAB 5HHME 1FRGH 2WVSA 4PB0H 3VXSB 1HJBC 3FCGA 5BS0B 3QJRB 1AKJB 5CJOL 1HXYB 5I1AB 3UAEA 3CVIL 4XPGL 3GSVA 1YMHB 1T6VN 5HHOE 3ULVF 2WXQA 1EHNA 2W0KA 3BQUD 4PGEA 1U2HA 1W2KT 4OZHF 2X7LA 1KPRB 3L2NA 5DJCB 5F7FA 1ZLWH 3L9EA 3TP4A 1U8MB 3TPKA 4G8FB 2YFOA 4KUZH 1XGYL 1DN0B 3N41B 3ZRSA 2WKGA 1P5UA 4ZSOA 4W9CC 1Z5YD 5CF3A 4G9DA 3BSZH 3I6KB 1L9OA 4N2BA 4F58H 1KENL 2VDMB 3CFTA 4UT9L 5JXED 2ZP0T 3U2SB 2P52A 4CC0A 1JNNL 5C08B 4NGHH 3OKDB 4MB3A 4KO5A 5AB9A 4WAFA 4OIFA 2IDCA 1ND0B 5B38G 3VXUA 4FQQB 3ME0A 4XCFL 3OKDA 1GGUA 1OEZW 4PJIA 1F42A 3UEQA 3K8MA 3PP3H 4KQ4L 3GSRB 3MOBH 4X83A 1A1MB 1C5DB 3MLRH 5EUOF 5C0AA 3WEMA 3D69A 1EJOL 4HT1H 4HFWB 3D12B 5IREA 4AW7A 3FU8A 1BLNB 5IOKA 1AE6H 4BFNA 4JDTL 3QDJD 5ACLA 2EO9A 3VFWB 1G7MB 2HFGH 5E2VL 2UZIH 5HHPB 3FU5A 4NPKA 3VA6A 4LLMB 3ISWA 4UZSA 4UCFA 3ET9F 2IH1B 4MXWL 4PRHE 3TNNB 3FB7A 4OCWH 3RIKA 3IKKA 1IIKA 1I85C 3T0EB 2CLZA 1Q0YH 3UBXI 1VGKB 3RU8L 1KB9K 2HMID 2R2HA 3CFUA 2HT3C 2Z65C 4W4NA 3UXFA 1OSZB 2CXGA 4ANKA 5L2JB 2BOCA 4KI5D 2A4CA 1FZKA 3QEHB 1F4WL 1XD0A 3B8YA 4BZ1L 3RTQC 3RKDC 4Y5XA 1UATA 3FCTB 3MGTB 5C0CA 3NZ8B 3ZDZE 4NQSB 3E2HC 1RLBA 1KB5B 4DN3H 5KYWB 3X11A 4NO0A 3ZL1A 4ANVA 5I6NA 1INEL 1KGUA 1PGRB 1X4ZA 3PJLA 4ZQKB 3WEOA 4AT6A 3GKZA 1LO5B 2H41A 4KVNL 1ZK9A 3BKJL 1PVHA 3EZJB 6PAZA 3VXUB 3A67L 4WTWA 1A6UL 3UTTA 3KWWA 2IAMB 3S36X 2FX9H 1JTTA 1S3KH 3CHSA 1GW0A 4MKTA 4RFOH 4BFRA 1VKXB 1DBBH 3EJZD 5F7DB 3VXSE 2RR3A 4JE0A 3O3BA 5D7LB 4HEMA 2OK0H 1C5BL 4ZX4A 2ZUQB 2PPEA 2VZTA 1MHEB 3TLRA 4CU7A 1XTLA 5E4EB 4F33B 2GJZB 3ES6B 4NBZB 4WF7A 2OULB 3LH2L 3S3CB 1O7DE 1E5CA 2AEWA 5ILTH 3MLPA 4NNPL 1CGWA 5DJ2A 4IBWA 4UV4H 1NCOA 1ORQA 4R7LA 3GXNA 3IWUA 4K3GA 2QBWA 5F8RC 1KG0A 1SDAB 2OM5A 1NDMB 3MUZ1 3O6LH 1QW8A 2C3GA 3STZA 5JW5A 2V0AA 3DUSA 3OD3A 4RH4A 3VXMD 4HK3J 1CTNA 3FTVA 4K7FB 1TTFA 3X3FL 2IOMA 5F97E 4L1HA 1MCWM 3RWGB 4QHNA 5AKTA 1UHVA 4R7NB 4UQ2B 2GG1A 5SX5H 5TK4A 4L0PB 4DZBA 4FQLH 4JQXC 4LKXA 2MPAL 5JOPD 4QXGH 2M26A 3OGOE 5HYJB 4R8WL 3RAJH 3NCJH 1V54B 4NQDD 1LD9B 5T1LA 4H0GA 4Z7OE 1UWEH 4IKJA 5FYKE 3ZE0B 4AGMA 5I5MA 5KVEH 2J1YA 4QNPE 3RFRA 3PQYD 4OZFB 4JQIA 1UACL 2XWRA 3L3HB 3MNVB 5I1IL 5IQOA 1ZTMA 4CDGC 3S6CA 1T1YB 5CWSB 3A4EA 2F8VA 4ISVA 2ZWNA 1XIWB 3LAFA 3K5RA 2ATKB 2D4DA 4YWGL 4DGUA 1EK3A 1N0XH 1J11A 3QDGA 2V5MA 2WP3O 3A6CL 2O4EA 4Y4FA 3KBFA 3QUYB 3LRGA 4N6RA 2F7OA 4BSWA 4F93B 2BWQA 4FMFA 4MLSA 2NY2D 4FMVA 4GRMB 3BWAB 4CA4A 4MQSB 3LXUX 4DO4A 3SE3C 2OTWB 3QXTA 4YBLB 1ZGLP 2O5YL 3HRZC 3T3MF 1EWHA 3BD4A 1HU8A 3D50A 4AEHL 3LXAA 4FLSA 4LSUH 1P9MC 4LLYA 5CHNA 25C8H 5C7XH 1E90A 4LSSH 1SLXA 4XVJH 4AUJA 4PRNB 3FB6B 3TO2A 2QLYA 2FL5B 3NJMA 2VZ3A 4C83A 5L8JB 1M7DA 5FDWB 4PJCB 4IOIA 5ACZB 1EVTC 5IEHB 4L4TD 5LLIC 4U1SB 2I24N 3CFJB 4AL8C 4DPBX 1L6ZA 5GGUA 1XGTA 4P57A 1Q0XL 2WGNB 1F56A 2VXTH 3GXIA 5D6CB 3RVXC 1DEEA 3L6FA 3U82B 4F8LA 1QZNA 4OCRH 4PCYA 4HPYL 3CXDL 3MV7B 1GXEA 4HUMB 5B38A 4GQPH 5T33H 4YSQA 1Q8MA 1VDGA 4RAVA 2X4QA 4HWEL 3PNWB 1MRFL 4FKHA 4Z7NF 2GTWB 3CFDA 2GT9A 5CSZA 3RWDB 1K4DB 3VXRB 4ZXBA 4EZKA 3I9GL 5DEGA 5DJAA 4OZIB 1L0QA 3MRJB 1JPSH 4HOMA 4TQEH 3WTVA 2YOCA 2AV1B 2NCEA 5IBUG 4J3XA 2AEOA 1RU9L 4KRLB 3L7FB 2RIKA 5DRZB 5LGHH 4BA0A 2I60L 1W8EA 2GTQA 3NTCH 5D7JC 1BZ7A 4JZJB 3SPVB 3BPCB 4G7YL 2CLRA 3MYZA 2PO6A 4R97C 2H3KA 2XTSA 4U1GC 5KYXB 1EXGA 3VQ1C 1H8SA 2JKTM 4PRIB 2UY6B 3C8KB 3L4VA 4N5UA 1AFVH 4XVUD 5GJSL 4NAJA 2QPUA 3C6SB 4PRBA 2ZWSA 5H2BA 3QXDA 4XNZB 3TT3H 4Y4KC 4ZW6A 1RZFH 5EIIB 1CFVL 3B3IA 3QZNA 5DRNB 5A2IH 1OGSA 1XVSA 4HLEA 1OAKH 4P5TC 2J57A 3RFZC 3GMPB 2CRZA 5K9JH 4UM8A 4GLRH 4GS7C 2A73A 3HZVB 2HFTA 1U8KA 4L9LC 3KNBB 2Y3AA 4HAFA 1FGVL 4Z1PA 4A67A 5BO1L 5CUSH 5IMKA 2ITEA 2HH0L 1ZSDA 3Q6GH 3Q9PA 4LIQE 1J0KA 5AYTA 3AG4B 2OTPA 1OLZA 5FS5A 4DTGH 2X42A 2IPTL 1TPXB 2B5IC 4X42A 4KROB 4BK5C 1MFDL 1TQBB 4ZDHA 2IQ9H 5C9JB 2APBA 4L3CB 3PHOB 5GXBB 2R15A 3B9KD 3TO4A 1X5HA 1KXVC 5EBWA 4Z7VA 1EXHA 4FHJA 1UZ8B 1WT5A 4CMHC 4AW4A 3UTPE 1N8OE 3TESA 3DC0A 3QHFH 1DANU 4X8XA 1GMIA 2R0ZH 4AQ1A 3QCUL 3U46B 4CAGA 5J56B 2DM3A 3EIFA 1KJVA 4W81A 2G3MA 1IGJA 1MCHA 2YA1A 2WHVA 2Y1VA 1IGYA 1YEEL 4A7TA 4NT6A 4NFBA 2D3NA 3RIAF 1NMAL 2JKRM 3FUEA 3BZ4B 1MXGA 1P7KA 1MDTA 2X28A 4G8EB 3INOA 2VO5A 2CGRL 3MV7E 2JMRA 4PTTA 4P3CL 4HIHA 4MCZA 5B39G 2HVJA 4FL4C 1HOCA 3S5ZA 1T5XB 2DWEA 1KXVA 1FDLH 3E8UH 4GINA 4N25A 3ZHKA 4JFFB 3FO0H 2FBJH 4JFOB 1EZVX 4XPFH 5L0QC 2B39A 3LSOB 2Y25A 3DVGB 1ZLVK 1SF5A 4PEEA 4AZ8B 1ZLSH 2ETWA 3QG7L 3S3SA 2I60H 3U30B 2UZYA 2YQ2A 2VJ8A 5IROD 2RHEA 4LXFA 5ICZB 5KS9E 2HAZA 5CCGE 1TG8A 1KG0B 2MQ3A 3C5SB 4OGAC 4W9KC 1DQQB 3GGWB 3GJEB 2YSSB 1OM3L 2HJLB 5EU6E 1WHPA 1JRHH 1UXLA 1CFSB 2CMRH 5B1CA 4R26L 3E6FB 4OT1L 4BWTA 2ROXA 1WEJL 3F7VB 2J5LB 2K45A 1RVFL 5A2JH 2EKSA 2H3NB 4V11A 3ZPDA 1Q94B 1OGAE 3W81A 1NH6A 3Q8CA 2CALA 3SYPA 3EYSL 1U6AH 4I89A 2BRQA 2D9QB 4WWKB 5HHVL 2VM9A 4Z0XA 4XO4A 5E99L 3STLB 2NW2A 1CE1H 3B2VH 2B15A 1A1NB 3L81A 2X87A 3L3DB 1FFQA 5AFAA 5F0JB 3VG9B 2IOIA 5C0RH 1U93B 2BRRH 3CXHJ 4TNWF 5EOCL 1TXKA 4UIKL 5MI0B 3RX9A 5B8CA 4PJCE 5IT2L 5D1XA 4G8EA 1IVLA 3GS7A 5B1KA 5C0ND 4XWGL 3ZDXF 1NCCH 4PW4A 3RY6A 1LEIB 4RQQB 3RKPA 1KTKE 2YA0A 1AACA 1ZHKB 4F7EA 3LTVA 3KMDA 1FZJB 3VFPA 2XTLA 3KGUA 5T1MB 4B0MB 3VYOA 4RMWA 2AV1A 4M1DL 1Z9NA 2FRGP 4MJ5B 4NFCA 3RZCB 5MENB 1A4BA 1SQMA 4Y1AE 2O30A 3GEFA 3F5WA 1R3HB 1U3HB 2GVYA 5BRZA 1MI5E 3H42H 1XIWA 3QHFL 4P5RA 2EVJA 1SOXA 4PJ5D 4TSAH 3D39D 5C0CD 3G9VA 5J1TC 1QLRA 5DJYA 5E56A 2VWEC 1MAML 2OR8A 2ZSVB 4F7MA 1MW3A 1T83A 4Y19B 3S2AA 4PJ9C 4LZKA 1PCXA 5TFSL 2XKSA 1YQVL 4N2NA 5E4AA 2NDFA 4M7LH 3V5KB 1R4XA 3GFUA 1KZQA 1U3HD 1U2YA 4GYBA 2APXA 4YHYB 3ZHFA 1M2OA 3GRGA 4JKPH 1FGNL 1GGYA 3DGDA 5C0DA 3B2DC 4GT0A 3ILPB 1M6OB 4E5XB 4WI2A 4BFKA 2B4CC 5T5FA 5CEZE 3CFMA 1QFWL 2R1WB 2PWGA 2HRPL 2B59B 2HT2C 4QRBA 4YHIB 3VJ6B 2JF1A 1OHZA 2Z6FA 4HJIA 4K9JA 4G8GB 4TNEA 4AIZA 1R5IA 1HAUA 2JV6A 4LEXL 5DEJA 3RVVD 5KYWA 1KN2H 2YC1B 2YEQA 4G43B 2OMBA 5FB8A 2AMUA 2IF7A 1B6UA 1TLMA 3L9BA 1IJ9A 4PBDA 1NFKA 3BKYL 2HYMA 2J71A 3OV6A 2AJVL 4KGJA 4IRJB 1O6TA 4KZDH 3VRLE 2XCMC 1AR1D 1CF1A 4LCUB 3LKPA 4ZMYA 3BVUA 3BUDA 3IDYB 1SBBA 2YRPA 4POZD 4B3EA 2X2HA 2EKJA 4JN1H 3U30C 2E9JA 2PTTA 4LK4A 3UG3A 2FEJA 3VNZA 1SY6A 3BVXA 1KXQA 2VDQB 1WA2X 4ONFL 5JPMC 1E3ZA 2C9AA 4GOSA 5FCUH 4B9YA 2QADC 5IFJB 2A6IB 4KU1A 4NQVA 4UYQA 3RWIB 4KFMA 1BP3B 3HR5A 4GBXB 4AGPA 3RNQB 4GQZA 1QRND 1YEFH 4AOFA 4AQEA 5GRUH 5DI8B 2ZKHH 4S1RL 4UT6L 4ZMPA 5BRPA 2Z1KA 1MPAH 1FNSL 4M8QA 1F1AA 3O4LA 1I8AA 2PYFA 5HDBE 3DGCR 2CHWA 15C8L 3HW7A 2YS4A 1F4WH 2XWCA 3G5WA 5MEPA 2BIHA 2DAVA 4WI0B 4WSKA 5IW6A 1MCPH 1UB5A 5T3XL 1KMGA 2ENYA 2R59A 3O6FB 4BE6A 5I82A 2XN1A 4DN3L 1AFVL 4FA7B 2X4SA 1SEBA 3LKQA 3TYFA 2HLFD 2PTTB 1S7WB 2N1TE 1BD2B 2EIKB 1U91A 2X2YA 3RB7A 2IQAB 4C56E 2GSMB 3RVTD 2FSEB 2BNQD 2VDRB 3ULAB 1CBJA 2B08A 3VX0A 4XAKD 5E2UH 1SJXA 5I74B 4EQ3A 5EUKB 3D9AL 4DEWA 2F5AL 3EGXA 3MJ7B 2BOBB 2OK0L 3QHZH 1BVKB 3H3BC 4KTEL 4QHPA 1IBGH 3LVTA 5BQDA 5IK3A 3VGHA 1ZK5A 4RMSA 3RZCC 4YDJA 1IQWH 5HGHA 1RAMA 3LDBB 1DN2A 1UD4A 1QA9A 2FWUA 4JGUA 3P9LB 4P3DB 3OMZA 5D70L 1MWOA 5I15L 3V0JA 5LXVA 5L9DH 5E1GA 4DCQA 2ITFA 1UXMA 1T1WA 1HHIB 3EJTA 2VO8A 1FAIH 4QRPD 2ZP8A 5HYJA 3V5KA 4I48A 4QY8A 4WO4D 3TWCH 1AO7A 3QULA 4M5YH 4U1LA 4XH2A 1QMUA 3HBQA 1AG6A 1QBMH 2YGNA 2BM3A 4G6AC 4HKZA 3KL3A 3RWEA 3E3QE 4M1CC 1TDQA 2YBGA 4I0CC 5DYOB 3QUHA 4UT6H 4X5XA 4R8WH 3CPLB 3CFKA 4PH8A 3RAJL 3VD2A 1Q9KA 4KKQA 3WE6A 4JG0H 2EXYD 2VDRH 3QYMA 1CFNA 3VGBA 3RVVC 4LFHD 4I77H 4QRUB 5GHWH 1WAPA 2PW2B 5T3ZE 1Q9KB 5F71A 1BQSA 2VSKB 1LP9F 3LXCA 1MFUA 5E0QA 2WWOA 1D7FA 2ZG2A 2QLVB 2H9GA 2OP4L 2HT4D 2CK0H 1AGCB 1ZHKA 2F53E 1ITBB 3BKCH 1MWAB 4UDTA 1OAZH 1JV2B 4GI8A 2NUTA 3IMUA 4WW1B 3PL6A 4X6EA 2XA8H 3KS0H 1ACYL 4UDUB 1KGJA 5ALCL 3WIIH 2CBQA 4MJ6B 5TE6L 1ML0A 3D06A 3ZIYA 3RY6C 1T7ZA 1U93A 5E9DE 4ZS6C 4FYQA 1LO0L 3K6OA 3D51A 3BSZL 5E1IA 3SBWA 1EAPB 1ZANL 4DK3A 1M6OA 1FJ1A 1AKJD 1WBZB 4YDIL 1I1FA 2R69H 3PUCA 5C07E 1EV2E 5GRWA 2V2TB 1EFXB 5T8IA 3X11B 1QYGH 3JXAA 2Z0BA 5DMYA 4G5AA 1AD9A 5D2NA 4YK4C 4P46B 2CO6A 3W0WA 4OIBA 5CILL 3QI9D 4PUBL 3TBTA 3TN0A 7CGTA 2E6JA 5EU3A 3MJ7A 2DMKA 3EYUL 3O0LA 3PNRB 4YQXH 3W0WD 1PPIA 2HUEA 4F20A 5D93C 2QMKA 1FPTL 1Q9OA 2VXQH 4PJXE 3MV9E 4HUCA 1QOKA 3QQ9D 2YAFA 3V0DA 5F3HB 1QBLH 2DWXA 2ZUQC 4OD2B 1CIDA 4XRCB 3UG5A 2VN5A 2QGBA 3BEWB 3T3ME 1BWWA 4X7SL 2FBRA 3ML9A 4G6ML 4WK4B 1W8OA 2BZCA 3FSZA 2ZXEB 3CZSA 3I3EA 4LVNB 2NXZB 4MA8H 4ZXBD 4TMPA 3QJFB 4MJIA 4IBZA 4JRYE 3KPMB 4ZT1A 3NCWA 5AALA 4PJDA 1E2ZA 2WMPB 1BQHA 3UJIH 1E9QA 3NJJA 4A7VA 2V6HA 1YPZF 2OSYA 4WKZB 3G5YA 1KEML 2R0LH 1E8WA 2FJGB 4WGWB 4KZEL 1JZ5A 3PHSA 2NCMA 3DI2B 1N19A 4O2FB 4F80A 3DX9B 3OMAB 4I5BA 1A8JH 3DV6B 1A1NA 2DI8A 3Q6FA 1JFQH 3CCHB 4M3JA 4YE4L 5I0WA 5TF0A 1E30A 3EW3B 1CDBA 4JKPL 4G83A 3CDZA 5IMOB 3JV6B 2BY3A 2Y72A 2EDJA 2HT3D 5E5LA 4ZX6A 5JIPA 1IBDA 2JXMA 5IHBA 3DYPA 3INUL 5IK3B 5LAXA 4PI2A 8FABB 1BF5A 5BOPA 1EZUA 4IKNA 4PG2C 5EDXA 3N5AA 3VFSA 2MJWA 2HJLA 1TYEB 2Y36H 1JZIA 4ABUA 5L7XH 4JAMA 3VDBA 1IB5A 4DIXA 2CUAA 1F3JA 1HEZB 3RLSA 5DEFB 4UTAL 5SV4A 3VI3F 2B9AA 1CLYL 3G6JA 3LZFH 1RERA 5DTFB 3TL5A 1PZCA 3CFEB 3LKQB 4X6BA 5CJ8A 3TYFB 2EABA 5HDBB 3QAQA 2UYLA 1SLUA 1RURL 3ARUA 1QBAA 1N0LB 3BFOA 1L4IA 3CU1A 2YARA 1WD8A 4U1JA 3FFCE 2QSCL 2FWSA 3JV4A 4OQTH 1MCBA 3VWJD 1OAYL 3WY4A 1W8NA 2XLLA 3S97C 2Z31B 1VCBC 3GLEA 3S8GB 5DD0H 4XN5A 4WHYH 3I9IA 3N2JA 1D2PA 4ZMWA 1T21B 4PJFB 1FNSH 3IF1A 1SFHA 4W9HC 5JIKA 3FRUB 2DQUL 4HVBA 1I7RB 1UM6L 4N0CC 3UBHA 4KI5F 4KY1L 4J23A 4R84A 4R83A 4PJXA 2CGRH 4Y9FA 5ALBL 5JIHA 3VRIB 4YHML 3FT3A 3F5WB 3P4OA 1DJGA 1IAMA 4KZCA 1MH5B 4Q56A 4XNQB 2GY7B 5FM5O 3QNXB 2Q7YA 1SJHA 4EQ2A 2DWDA 3GK8L 1IL1B 3WN5B 5TQ2L 5FKAA 4JB9L 4ORZC 4EZJA 2MHAA 1K72A 2NY4B 5JPNB 1NKOA 3D2UA 3RDTC 3V5HB 1A4KA 2FLBT 5KUKA 3FTZA 3QZWB 2BNUA 4NN7B 3W9DA 2GK2A 5ISZE 3L54A 4Y5YB 2H0JA 2CRYA 1H6TA 3IU4L 2F5AH 2R0LL 4HG4K 3ABGA 4LNRB 2G4GA 2UVFA 2WSKA 4MD5B 3LPWA 5FW6A 1G6RB 5K1VA 5ABAA 3QEQD 1SXCA 3UC0H 5JMOC 3KEHA 1NC4D 4OLEA 3FOMA 4X6FA 1A7QH 2J88H 1TTBA 3WBDA 3UCRA 1XZ0A 3D18B 3L95A 4A7GA 3SD5A 2RAMA 3QUYD 5CM1A 1IEBA 1RVFH 4L29A 3MRCB 2NX5B 2J1KA 3KPQA 4JFVA 3V4PL 4O2EB 3QFDB 3NGBC 3HBGA 3VI4A 1RP9A 2DI7A 5D6DA 5J3HD 4JFED 4N0RA 4MFHA 6PCYA 5JO5A 2XFGB 2Q7YB 5C0GB 5FA4B 2CKBL 1GIGL 3BO8A 4IBQA 1BQHG 3NT0A 3AM8A 4XCEA 3DMMA 2CHNA 2LABA 1J10A 4FG0A 2B4CH 3DUHA 5AKRA 3HS8A 4FNTA 3BO8B 4UT7L 3TT1H 1XV8A 4OZHA 2AJSL 3SE3A 5KSUB 3N50A 3VW3L 3ETSA 2SEBB 3QJQB 4Z7QF 5FO7A 4BV1A 5HVHB 3QNXA 4D7PA 4FERA 3P3SA 3RVXD 3ARBA 2Y07L 4OM0H 5K59F 2NYYD 4A55A 1MJ7L 1FV1A 5CLZA 5IVXF 3B1TA 2AZAA 5DHMC 1A9BB 2BVOA 3RGVB 5ERWA 1PIFA 3BGMB 3BUIA 2QSCH 3HE6A 4JG0L 5IJKA 3GXDA 4FTVB 1G0XA 1ZE3C 2XICA 1X9RA 1P7BA 3EFDL 2O6EA 5E9DB 1JG9A 4WO4A 4Z9KB 3BPLB 1LXMA 3MLWH 4U3SB 2PCPA 2FJGA 2YBRB 1BYPA 3MNVA 1NFIB 1ZEAH 4NQQA 4PGDA 5SX4H 4KROC 4NN6C 1QSVA 4L1TA 5F21B 2R69A 3FSVA 3ZTJH 2Q9OA 4BHUA 5B4MD 3PGCA 2B2XH 1OB1A 4GW4A 3SPCA 4P5SA 3BH9B 4GKSB 2FEEI 1UM6H 1T2QL 4OCSH 5KJ7E 1ITCA 4QRFA 1OGAB 5B1AB 2M8XA 2UYLB 3M17B 3V6ZA 4EF3A 2D0FA 1M2VA 3O11A 4CVUA 4ERSL 4K15A 4XNQA 5D7IE 4CVXA 2Q20A 3IMTA 5DZ9A 2DI9A 1OOWA 3RDTB 4ZUVA 1SF3A 3OLIA 1W15A 2DM7A 1IKFH 1KGXA 2AK4B 3CC5B 3CFDB 3N6YA 3MA9H 2BW4A 5G5DB 5FECB 3HRPA 2ZF9A 1ZDQA 2IEPA 2V5RA 3IJSA 1UT2A 4Y2OA 4MZRA 4B9CA 2DY2A 2IO5A 3P9MB 3VFMB 3KW7A 4FYSA 4X7TB 5DK0B 1OT2A 3TN0B 5KSAD 2GSIA 2OFQA 3G08A 4GO8A 5I66A 2J12B 5ABDE 2MQ0A 1CD8A 3D0LB 3HKFA 4AY0A 2A9NL 2GSGB 4FZEL 3KDMB 1BWMA 4FHBD 1Z9MA 5CMAA 2I9LA 4Q9CA 4Q2ZA 5CCKH 1I1AB 5SWZD 1A9VA 3D4YA 3Q8BA 4Q6IA 4KROD 3WY1A 4PLNC 1IVTA 4DPCX 1MSPA 1ZV5A 1WQVT 3V52H 2HVJB 1XF1A 4F8OA 5K1NA 1NOFA 1MQ8A 3SGEH 3C8KA 3WTSA 4LVHB 4JG1H 5ESQA 4NZTL 4WKZA 1KYAA 5TJWK 2OMTB 4X6EB 2ARJQ 4NO0B 3ZDWA 1LVEA 1P7QA 2FAUA 3FT2A 3KE0A 4XP1L 4ZFFA 2GK0A 3SJVB 4XBEH 3VXTA 2WMPA 4B9PA 4PV1C 2ALWA 3UJIL 4DO6A 4GRWF 2WBWB 3IEAA 4HUUA 2BC4A 3RQ3A 4TN9A 3FFCD 5FKAB 4U6YA 2EAEA 4FQXC 4X5RA 1X7QB 4KZEH 4OF8A 3GSNB 4HGMA 1GPOL 1QLFB 4RMUA 3F8UB 1EGJH 1SHMA 3VRIA 3H6JA 4S0SD 4RGND 2G60L 3STZB 4FX5A 4LCYA 4MCNA 3WD5L 1ZT1B 2G3NA 3ZDZF 2APWA 1ZEAL 2DQ6A 3GJFB 4TPRL 1DL7H 2DKUA 3DMMB 4RSVA 2LFGA 3TOPA 3RWEB 5HYSB 3INUH 1G9NL 2CDGB 2XRAH 1TJXA 4MWFA 1R5WA 1Z9SB 1M9SA 4N3UA 1TCMA 1S9WA 5IB5B 3I75B 4JUSA 1TZAA 4MNHB 4KUCD 3D4CA 2N59A 1OALA 2EO7A 1ZLDA 1YUKB 4OFDA 2PWHA 1NUDA 3UTPD 1J1XH 3BZFA 1D3CA 3MRNB 1LTXA 1QR4A 2DKSA 1IGIL 3BKMH 3I2CH 4RFNB 2VUKA 3RTQD 1DBJH 4JL1A 4KK5D 3Q2VA 3C60A 3MO1B 3AU1A 1SNRA 4HJJL 1HZHL 3PXJA 4XBMA 5GRVL 4JRWA 4HD9A 4OLZL 2JKIS 4FG6D 4KOBA 2NUTB 4JDEA 3M1OA 5IOPB 3FC8A 4JAMB 2XWBB 4MNQA 1SYVB 2IOOA 3EO1A 4JFEA 3MREA 3N1GC 4H26A 4JHWL 2BNRA 5I2IB 1FNEB 1HXMB 1M53A 3LB6C 2VDKH 3MRPB 4QT5B 1BZ9B 2A6KB 5GSRB 1RHFA 4GG6A 2R83A 3QXAA 5KG9B 3QJZA 1BBDL 1JCVA 4O5LL 2P47B 3U6RB 3C5JB 3LZLA 5MHSE 2K7PA 2UUDK 1DJWA 3TX4A 5IG7A 3ILQD 3RX8A 5E6IA 2BX5A 1NC2A 3FO2B 3CUPA 5IMMB 2I9TB 2YPKA 3F05A 5IESL 2FECI 3SE8L 4K8RC 4AT6B 2XXCB 5A2FA 1S9VA 1S5HB 1T3FB 5EMYA 3D3VB 1HKLH 2RD0A 2BP5M 1ASQA 3JVGC 3TZVC 3A24A 1OP5H 1ZSHA 5A43C 1AGBB 4JFXB 3EH4B 5D1QC 3GMMB 3PDDA 3UPRB 2XACC 3PG2A 3UC0L 2D0GA 2PR9A 4RWHA 4B5ZA 3MRIA 5GRJH 2YR3A 1Q0XH 5ANMA 5C0BA 3VXRE 2XA8L 4NN5C 4O02A 5HI4D 1CCZA 3VTMA 4ZZFA 4QHMA 3X1NA 4L3EE 3BT0A 2OMVB 1ZY9A 4DEPB 4HWNA 2FJFB 2DMHA 5AG8A 1G6RL 1WS7A 2A77H 3EYVB 4WSJA 1FZOB 2J6WA 2ZUUA 5CEZL 4KJWD 5E5RB 5EU3B 5GZOC 1GS8A 2V37A 1YNTA 4NRZA 4Y4FB 1CL7H 4M48H 1DVXA 3SKOB 1J0HA 1DBMH 3GSRA 5FK9A 5I0XA 3UZVA 4PJ8D 2QADB 3G5VA 5IMLA 1NCWH 1SXAA 4Z95H 5IB4B 3FUDA 4OF3A 3M8OL 4YX2L 2OI9C 1M7IB 3IXAA 2Q7AA 5AW2B 2P5PA 1RZGA 4W9IC 1OXYA 3KVQA 3BT2L 4NM8L 4UM9A 3T2QA 3OTTA 3TIEB 4OZFH 3MJ9A 5IW6B 2BJML 1GYVA 4O5LH 4ZBJA 2UUDH 2V2XA 2Z4TA 4XI5C 4Z7WA 4YDJB 5HGHB 3D3VA 2GBVA 4K94C 3RE0A 3X12A 1E9QB 1QTPA 4V1DD 3B7UX 4YBHA 3QIWB 4MJID 1P1ZB 1U8HA 3B37A 3QIBD 5CEZD 1NBZB 4EOWH 1ULVA 3B9DA 3TEYA 4GSRA 1OSZA 4GW5A 4P9MH 3T0WA 2PXYC 4UIMA 1YMHA 2NZ9D 1BAFH 4IRZL 2ERJC 2PW2A 1NAMB 1AGEB 2TRHA 4J3OD 2BY2A 4MB5A 3CFBB 3SKNA 5CGYD 2YD1A 3D39B 4KKLD 4UQIM 4ZUUB 3ROOB 3VRJA 2IH1A 2PWEA 5IB1B 4H2CA 4DN4L 3FO1A 2NY2C 4D2NA 1J1PH 2VJXA 3SZKC 4LPXA 1WFJA 2UY7A 4PRHD 4BSJA 3DJTA 3NSYA 1HQ4B 4K55A 2NY7L 4YZFF 4LQFH 4R6UA 3DECA 2FX8L 4MQXD 1M1XB 4JFDA 4GPVA 4ES9A 4JO2L 3ESOA 4KJQD 3WIFA 5GS2D 4RZCA 4AYBA 2BSED 5GRJL 5FFLA 1ODAA 2WQXA 4KTYA 1ZDSA 4TNGA 4LO9A 2VDOH 2H1PL 4PCKA 5EO1B 2BS71 3WFEH 4MJHA 2R29A 3G5XB 2V8LA 2IV8A 4QAMB 1GW6A 5D71H 5ITBL 3IM1A 3L08A 2VZOA 3MQIA 4TOYL 5ETUA 4MBRA 4JFWA 4R4ND 2DJSA 3EUUA 3SE4A 1R9FA 4M00A 4HPHA 4CVZB 2JCCF 3AAZB 4QT5A 3ZO0A 3HTLX 1KY6A 4KC3B 1MJJA 1CGSL 3CSFA 3P9MA 1MI5A 1QSED 5J9PB 3LKNB 1GOFA 3O6ML 3TA3A 4F57L 5LNEA 1OAQL 5KVGL 1I7UA 2HVBA 4Y1AA 4R2GD 3HC4H 1JL8A 1K8IB 3MRHB 1EJ6A 1RULH 1R5IB 2PWFA 3T3PE 1CVRA 3RDTA 4O51B 2ZUXA 4YVNA 4TVUA 3T0EC 1QFPA 4M02A 4TUOA 3GSNA 5GRXG 1OP4A 3AVEA 4I3RH 4N8UA 2L4OA 3IJEB 1UOVA 5C86A 5T1MA 1CTOA 4FNRA 3DTXA 4LP4A 3LEVL 1MEXL 1HEJC 4NO0D 2ZOKB 4F8QA 5LCVL 1LMIA 4LPTA 2EDXA 1CF8L 3IGFA 1L9PA 2ZUWA 3IJ9A 3MLSL 3C08H 5EZJA 3IJ8A 1WFMA 4KJQC 4PJIB 3HB3C 4XOEA 1KIQA 1INQA 1THAA 4NKIL 4Y4HC 3MBWB 4E9WA 2FR4A 2E74C 4JPIA 1CD1A 4RRPM 5E4EC 4QRPE 1W6WA 2P49B 2IDUA 3SJVE 5HBBA 2L7EA 4G9FE 2C9VA 4MJ5A 1QAWA 3L3KA 4R4NC 2EKSB 3WSQH 4W1TA 4NWUH 2NY4C 2FATL 4QXWA 5DVOA 4JCLA 3L45A 4HUUB 5I6MA 1FZJA 4LQFL 4U6XB 3VFPB 3X2QB 3WY3A 2AJUL 3BP6A 2X4TA 3HC2A 2X7LB 3MACH 4WTZG 4LF3B 3EYSH 2EDNA 4MXWH 1EH9A 3IWVA 1MHPH 1VJSA 1TJHL 1G9MH 4G1EA 3QUXD 1HXYA 5I1AA 4EN3B 2Z7UA 3F7KA 2FE0A 4JVUA 3IDGA 3CN2A 4CVXB 4JANB 5L4JA 4JN2B 4L3FA 5DJ8A 5KBMA 3GUFA 4JO1L 4LBEA 5J5EA 3HHSA 1J87A 1BAGA 1T6BX 4K3EL 3EZ8A 4LGSB 5LO7A 1QBLL 3CXDH 4L2YA 1NMCB 2GUOA 4Z77B 3RURA 3VI4E 3D07A 3U0WH 4ODSH 4MCZB 2Z34A 3E9TA 4OF6A 4PRIA 1AXTH 2NZIA 5E6ID 3X13A 2HZHA 4IEFA 2AABH 4ORGB 4XVTH 4URTB 3BPLC 1JTPA 4F57H 3O3DB 2DIBA 5E9DD 5C0IB 2LU5A 1E6OL 2N1KA 3MLTA 3GBML 4HBCH 4L4TE 4P07A 2CJSA 1I1YA 2VKXA 3DUUA 3QQ4B 4XGZA 4AQ1B 4EI5D 3BSGA 5IFJA 3HEIB 5IY5B 4IGBA 2F9BT 4QRRA 4X5WB 3C6LA 1I8KA 3D30A 1SVCP 3DOSA 3JZ7A 4I2XA 4KVCL 2B2XL 4YSAA 1Y1UA 1G1YA 2CHZA 4HHAB 4Y9EA 4NZUL 4G3YH 2FYYB 2GJPA 2YD7A 3PAZA 1NCIA 3V6OA 2YN5A 4HCIA 3FT4A 1YRKA 1YN6B 2EIMB 3UTZA 1JNLH 3LEYH 5I73B 1PEWA 1UWGL 3KPOA 4HK0B 3RZWA 5BMFL 1VCAA 4N9GA 3VDCA 1Z3RA 2A77L 3NN8B 5D4JA 5I6PA 1IC1A 5CEZH 3E6HA 2VMJA 4BQ8A 4YHIA 3VJ6A 4AIZB 2M2DA 1E4HA 3CGTA 3TVMB 2VR9A 3A3YB 1KLFB 4G59C 5DHYB 4QEGA 5DZVA 5D2NC 3ARQA 3NCFB 4FJZA 4JRFA 5FYKD 3C5ZC 2C1PA 4Q6IB 1HL9A 1I7ZB 1NJ9A 3ALPA 3ATEA 3MI6A 3GTNA 2NTSP 1YEFL 2J8UF 3DVFA 3BAKA 5D7SH 3UERA 2BY0A 4AQOA 4G7VH 3BWUC 4Q4EA 3JT2A 3VGEA 1EGJA 4AQ8A 1HTYA 1X5IA 4WK2B 3M45A 3LRMA 3L5WB 4YSUA 2IAND 2QPDB 3APNA 3EO9H 1KJMA 4HYTB 3HI5L 2QKIC 5ENWB 4BEIA 5CJXA 1YPZB 1K5NB 3B2UC 1M7XA 4LOUD 4BRJA 1KZYA 5HHQA 2Y5TB 4NKMA 2AERT 1KJMB 5A3ID 2C9QA 1CBVL 4GW1B 5JPNA 4UQCA 2VQ1A 2DYPB 2UVEA 3GDCA 1T7VA 2E6QA 3ZE0E 4NC1C 3QZBA 4JJOA 4K5PA 4XN2A 4YHZL 1MFBH 3AY2A 5DQDH 1U4FA 4M61A 3FQNB 5D7EA 5C2BH 4L23A 1IBYA 2BNQB 2XN9B 4TXVB 5CSZB 4U2ZA 3V5DA 5JNYA 1UQSA 5L4MA 1XSJA 4KK5C 4KK8C 2VLJD 4QMEA 3P73A 5DR5L 5BVJA 3O6FD 3PGDA 3ELAT 3GBMH 4Z7WF 3LZOA 1G0YR 1KULA 4POZC 4Y4KB 32C2B 3IBEA 1MIMH 4D8PB 4O58H 3DX8B 4U7KA 5IF0A 1RZ8A 2E3VA 3QWNA 5GGUB 2KH2B 5AZ2H 2ZT9C 2CHXA 3NABL 4HLZH 3ULVL 3TO4C 2BVUA 3ARSA 4XMUA 5FGRA 3SCMB 5HPOA 4PWEA 5KBNC 4JMNA 4OQTA