2KI6A

The fgf1-s100a13-c2a hetero-hexameric complex structure: a component in the non-classical pathway for fgf1 secretion
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
128
structure length
128
Chain Sequence
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Synaptotagmin-1
total genus 21
structure length 128
sequence length 128
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2ki6A00
4ICWA 4KITB 2V4LA 2FJUB 4ANUA 5G2NA 5JHAA 3W57A 4OVVA 2WXOA 2BWQA 3M7FB 5CCGE 1E8YA 1DJZA 3DBSA 3L9BA 3L17A 2WXRA 4L23A 3ZVVA 1W16A 3MJWA 4FHJA 4TUUA 3NZUA 3W56A 3F04A 4QJ5B 4L1BA 3PRZA 4QJ3B 2B3RA 2K45A 2QZQA 4FLHA 2WXKA 5H4ZA 1E7UA 1HE8A 1RSYA 2WXHA 3ML8A 3NSJA 3PYCA 1DJHA 3HIZA 4JPSA 1K5WA 1A25A 2WXQA 4FADA 4EZLA 3L08A 5H4YA 5CCHE 4FA6A 3R7RA 2N1TE 1UOVA 2A5UA 4LCVA 2X38A 3KWUA 4ANXA 2FK9A 3IM1A 4DK5A 1DJWA 2UZPA 4L1LA 3PS6A 3DPDA 2EP6A 2WXIA 4F93B 4PS8A 1BCIA 4BGDA 4LDCA 2CHDA 3F00A 2WXLA 2ZKMX 4F92B 1YRKA 3PFQA 4QJ4B 3HHMA 3S2AA 2YRBA 1W15A 3P2BA 4XZ4A 4EZKA 3F05A 3HN8A 4AJWA 4Y1TA 2CHWA 1DJYA 2Q0ZX 4NPJA 4Y1SA 4F1SA 4WWOA 2ENJA 4A55A 1RH8A 2NSQA 1E8ZA 1DJXA 4WWPA 3T8MA 3N5AA 4QAMB 3L13A 2CJSA 2CHZA 2JQZA 1DSYA 1TJMA 2Y3AA 2NQ3A 4G11A 4AOFA 4HLEA 3RPBA 4J6IA 3LJ3A 3NZSA 2Q3XA 2WXJA 2LHAA 3FDWA 2WXNA 1UOWA 3APFA 1V27A 1E8XA 1QATA 2CM6A 4V11A 3ZIMA 1DJGA 3JZYA 4PS7A 4TV3A 3TL5A 4WEEA 2QZ5A 1QASA 4FHKA 3IBEA 2WXPA 5EDSA 2ENQA 2CM5A 4FJYA 3GPEA 4GNKB 4EZJA 4FULA 2RD0A 1TJXA 3ZW3A 4GB9A 4NS0A 4BFRA 1BDYA 2K8MA 2DMGA 3ML9A 4LT7A 3B7YA 3QK0A 3FBKA 3R7QA 2YOAA 4IHBA 4PS3A 4DNLA 3TWYA 4WAFA 3ENEA 4ANWA 1E90A 2A4ZA 3OAWA 5G55A 4FJZA 4IQHA 1E8WA 3QARA 3CSTA 3KWTA 4L2YA 2KI6A 2WXGA 2CJTA 3QJZA 2R83A 4ICXA 3L16A 4XE0A 2DMHA 1UGKA 3PREA 4HVBA 5T8IA 2K4AA 5CCJA 3L4CA 1RLWA 1GMIA 2ENPA 2Z0UA 2WXFA 4KZ0A 1WFMA 2WXMA 1WFJA 3CSFA 3QR1A 3TJPA 4OVUA 4NP9A 3SD5A 5JHBA 2D8KA 3QAQA 3L54A 4MJJA 2NCEA 4F91B 3QR0A 4URKA 1E7VA 3F01A 3RDJA 3APDA 4TS6A 1DQVA 4WWNA 4ANVA 2CHXA 5KJ7E 1BYNA 1CJYA 4NPKA 3APCA 3OHMB 1DJIA 2ISDA 4XX5A 2K3HA 4KZCA
chains in the Genus database with same CATH superfamily
2BO0A 4Z77B 1SHMA 1B0GB 1N5AA 4RGNB 3PWLB 4L4TE 2VOTA 4WKZA 4GUQA 4LGPB 5DRZA 1WA0X 5E00B 2Z7WA 4GRMA 2C3VB 4M48L 2OXGA 3QIBA 2F5BL 4YDVB 3U83A 2FATL 2KQNA 4BSVB 1U8JA 2VDPB 1EHLH 1MCCA 4IYKA 2WGXA 1M56B 1BZ7A 5IHLB 3OMZA 4NKQB 5KSAD 3QZWA 4G2AA 4LRIC 3UEQA 2YN3A 5JQHC 4TVSa 1NJ9A 2XACC 1T66C 3SKUD 1CDYA 1WWCA 1AI1H 4GRWE 3TS8A 3TBSA 1P7BA 1Y18B 4ESKA 2IAMB 1I1FA 3G6DH 5L4MA 4POZD 4C56D 3TPUB 3EDFA 4O02H 4X4YA 2DYRB 3PWPB 2XKNB 1J8HE 2P26A 4NN7C 5KSBE 2AI0L 4GSUA 2K3TA 1QI4A 4HKJA 4F58H 2XWTB 1OM9A 4J3BA 4Y7OC 3AC0A 3UZVB 3LN5B 2ZOKA 1IFRA 2O5XH 3V5DB 4M5YH 2GW5A 4XMZA 4OZ4B 2A6JB 2YPVA 4PP1C 4OCYH 2ARJQ 3BD4A 1SRDA 3DO3A 2JE8A 1QQDB 3WY2A 3KJ4B 4WGKA 3TBWB 2IQAB 1N64H 3SE4C 3BW9A 1HH9B 4IEFB 3UTSA 2GJRA 3QFDB 2Q86B 1MXDA 2G5BA 1KTDA 5C0CA 2DLGA 3PGCB 2GFBB 3GO1H 4I85A 5LCVL 1AZVA 1BEYL 3CSYB 3ET9F 2OMWB 3C75A 3MRNB 3OC8A 2CO7A 1KJMA 2WD0A 4AEIH 3OKMB 3HPJA 3QUXB 5E8PA 4BDVA 3ARBB 3LV3B 1QVOB 2UYLA 3LIZH 5J3HC 3DMMA 3DYOA 3I3BA 3ML9A 3MV01 4IRJB 3SB3A 5GZND 5KVFH 5IQ9A 3DC0A 2CKBH 1L9SA 1M1SA 3HMXH 3I6GA 4OGZA 3UTTE 1SDAB 3VD7A 1TJHL 3WY1A 3SPCA 3HG1B 2DWXA 4UTAA 2CWRA 4P5KA 1CI5A 4M9PA 3L7FA 2R15A 1TQBB 2C9SA 3Q5YA 4UOW0 2X0UA 5I8CB 1TIUA 1BBDL 1A7OH 1EHNA 5EEVA 3TN0B 1RIUH 3HZMB 1F41A 3NIGF 5H2BB 5DFTA 2PPAA 1S9XA 1MAML 3UH8A 4PI0A 4WWID 3VXMA 4EN2A 3EYOB 5KJ7E 4HT1L 4K7FA 2CXGA 3HC4L 3O3DA 4W9IC 4G8GA 5GJTL 4FLRA 3U2IA 3WFCH 2QGEA 2E6JA 3OGCA 1F1DA 2JKSA 3KPQA 4DFHA 3VFSB 3RGVD 1OHQA 3EUDA 3TC9A 3Q3GB 2BC4A 4FNUA 1IAKA 4YDZA 5KAQF 3BKMH 2QZQA 3BWZA 4JDEB 2QV4A 4XP1L 2ID5A 4YAQB 4A6YH 4R4NC 1YEWA 3LX9A 4LBEB 4YSQA 3MLVL 4PTUB 5ID1B 1Y18A 1TVDA 1KGCE 3VXPB 2L7QA 3MRPB 3AXHA 3OLIA 3WTSA 4U1GC 5TPWH 3WIAA 3RFZC 1JNLL 3E1F1 4X8JB 2W07A 5C0CD 1QZNA 2QTEA 1NKGA 4BQ8A 4ANXA 4DHLA 4JFZH 5DMGC 3C8KA 4WFHD 3FU7B 4F93B 5F9OH 2Y7QA 4AWJC 4MKMA 5C86A 1EWHA 5ILTL 4LVHB 4U1HB 3PFQA 2VR8A 3S2AA 2A6JA 3O2WL 1HCFX 1RZFH 3K4AA 1R5WB 1E9QA 4JJHA 5FUZL 5FUOH 1XTLA 2WVVA 3OGOE 3QUYA 5FWQA 2C4XA 2UZIL 2Z3FA 5ADPH 3VXUA 5DTFB 4MQ7B 3EO0A 3F7PC 4OLXH 4XO5A 4G11A 1AC6A 2ED7A 1XF4A 3ALPA 4Y8AA 1CG9B 3IJEA 1HT6A 5IMKA 3QQDA 1AR1D 2BP0A 1BXVA 3L1OL 3OQ3B 3PY9A 4R7LA 4FFZL 5HHQB 4MXVF 3GT6A 5ECJE 3VUAA 1FGVH 2R7EB 4M61A 3NFNA 4EZJA 2ZJSL 4GT7A 3PIQB 1TFHA 4XX1G 3RY5A 4CSSA 2UXGA 1CN4A 1MHPH 5JNYB 2DQGH 4CRPA 3VWJC 1ZTXE 1PFOA 2EE2A 1PKQB 1A6ZA 4DPRA 4KDWA 5A40E 4OB5H 4NZTL 4RNRB 4JJOA 1L7TH 4G9FD 1YJDH 2XZZA 1HSBB 1LDPL 5HI5D 5IUSA 1O6TA 4YDIL 4I18A 1QRNB 2XOTA 4MSWA 5DZJA 3V5KA 1YAIA 4H88H 4UM9D 4WW2F 3UYPB 5I71B 4IS6B 4KK9D 5FYJU 3SO3B 2VLKE 1K9TA 4X6FA 3MKGA 4URKA 2KT6A 2VSCA 3ULUE 5CZVH 1IEAA 4AEFA 1OOAA 1BJ1J 3F6JA 4BM7A 2X3BA 2FT8A 5FDYA 5CSZA 35C8H 1WWBX 2FHCA 3UBXB 4HKJB 4LPVA 2GJJA 3QIWD 4BWTA 5I1HL 5IJVA 1TTGA 2EDMA 2WINB 4CVXA 5CCGE 1IX2A 4LARL 2GY5A 2D03L 2ZX7A 2LLNA 2J1KA 5J1AA 4JQIH 2B3RA 1ZT4A 1BZOA 2FJGB 1W0VB 4P2YA 3QEQA 1U36A 3OKKA 2E7CA 4OJYA 4PRIB 3HJ0A 4Q6IA 3WNKA 1XV8A 1TXKA 3SGJA 3SKOA 3MBWA 3NVQA 5IB4B 1F3DH 1T22A 2AVGA 2YD9A 5F3FA 3QZMA 3G6JE 2HXAA 3KWUA 1DE4B 1L7TL 3T0DA 2NY7L 2R69L 1YNTA 2CPCA 4H8WC 4JDTH 4UOJA 5DZOA 4OZGB 5IBTH 3MBXH 3WTUA 3HRPA 3CIQA 4ZD3H 2G75A 3NDZE 2HMID 4HH9A 4X9BA 1CXIA 3BP4B 3OHXA 2AGJL 1GTFA 4Y19A 4OJEH 3HN8A 5ISZB 4GS7C 1WAPA 2MSPA 2PW2A 4M6OH 2YPLE 1FL5B 3GJFH 3LEXA 4L8DB 3RE0A 2YPKB 5DD3H 5T1KB 3ZE2F 5F2FA 5C2BH 1QLRB 4PJHB 5CJXC 3CTTA 4PJEB 2EDDA 1ZLUK 3RL1B 3GTNA 1DCLA 1NCCL 4YFLI 3DX6B 3L3IB 3CD4A 5DO2D 3IDJB 1F4XL 1JJUA 4PJCB 1WCQA 5A6LA 5C9KA 1VFBB 4KKBC 2Z65C 2P5EB 4F7CB 3RVUD 2AQNA 4NQCA 4NYLA 3H54A 1MREL 2ETWA 3UAJD 4D7BA 3T3PF 2XY1A 2LAAA 4UQCA 1GJIA 2BIMA 4TTDD 2O6DA 1MLBA 2EEFA 4PBDA 5J6HA 3AG2B 3KWWB 3I6LE 2Z91A 3O3BB 5KANG 3AZUA 2GHWB 3GMQA 1AQDA 4K23H 1A14H 3KYOB 2UXVA 3P4MB 1MWOA 1YQVH 5DD5H 3AS1A 5IW1B 4CL7A 1MCJA 4X6FB 1GMIA 3NCFB 3GSNL 3IAQA 2WZPD 2IANB 3ZKNC 1RUKH 4HUVB 3U25A 2N01B 2VJ8A 2DI7A 1QBML 2VDKL 4W9JC 3U79A 1U58B 1D5RA 1YEDA 5TE4H 2YK1L 4HGWA 4HCFA 5CP3A 5E1AA 4KITB 4XCYA 5EIIB 4CN4A 1WT5A 3WXWL 4QYAA 1LE9B 1XZWA 3BH8B 5BVPH 3BUYA 5KVDH 5CBEA 3WFCL 4XZUA 1QTYT 3L3KA 1XCQB 3SDAA 3ARZA 1NEZA 1U3NA 3DBSA 3IDIA 3IT8D 5IVOA 2VDLL 3QDMD 3TURA 2WVVB 1R46A 3ERXA 4DN3L 4ZX6A 2BINA 2XFXB 2CGRL 3MUHL 1K4CB 3BDBA 4LLMA 4MHHI 5D7JC 5EC2A 2FYYB 3QIWB 1ED3A 4ZUVA 3ESNA 4BINA 3TO2A 2X2UA 3NACH 4YC2B 4UTAL 1N8ZB 2N7BA 5C0AD 4BZ2H 4MMXC 1IVLA 3FQTB 1JMZA 3C8KB 3NCEB 3FU7A 1KFGA 1DJWA 3EFDH 4FMKA 4B0MB 1OIOA 3I3EA 1DSFH 2WPGA 3HMXL 1JVOA 3AABA 3LVEA 5DS2A 1P7QA 2YBGA 2Y36L 3FTYA 1DQDL 5KVFL 2XN0A 3H9SA 1W15A 1JHLL 4OZFA 4FXGB 4KK8C 4N2CA 3VFPA 2QPSA 4QHMA 1BM7A 5EB9A 4B9FA 4M7LT 2DYSB 1S9VA 3HZYA 1PKQA 5MEPA 2VLJA 4LLDA 5DDHA 1JBJA 1OAQH 5DQJB 5T33L 2EUXA 3RWGB 5IY5B 3LKSB 1EX0A 4UU9B 1SGKA 5JIKA 1C5CL 4KNUA 1BZQK 1UOWA 1RURH 5F89B 3MXVL 3FTWA 5AZ2H 5GRUL 1I7ZA 2LT9A 3BT2H 4NT6A 5D5MB 4R90L 1SFHA 1L9PA 1FNHA 1KXQA 3POHA 4YGVB 3KVPA 1TZGH 2DY2A 3PAUA 1XCTB 1UWXK 4FULA 1NMAH 4YHYC 1M57B 4DP7X 1BDYA 1U91B 2B15A 3E80A 5ENWB 4ETYA 2AXJA 4QXTA 1JRHI 2Q8BL 4TSCH 2VQ1B 4PJCF 4PS4H 1NWPA 3R0MA 4Z7VE 3LHAA 2C9XA 4HBQA 4KHXL 4HS6B 3KPSA 3ALXA 1KLGA 2IH1A 2YLKA 2YD2A 1T3FB 3IKKA 2XDHA 4FQQA 4IQHA 3HE6C 3I75B 4JY4B 2GTWB 4FNPA 5D7JB 5E4AA 1DFXA 4NENA 1CYWA 3X1BA 4IU3B 5GZNC 3T3PB 4FNQA 5CBAA 2HT4D 1Q0XH 5HJBA 2Z31B 3CSFA 5EHFA 3WJMB 1HHKB 3V4VA 4WF7A 3FUEA 3CU1A 1QTSA 3T8VA 1ML0A 3BPLB 2EIZB 1BG1A 4APXB 3EDJA 2OSYA 1R3HB 5D96C 1LE9A 4FOMA 5BRZD 4AQZA 5AYTA 4YN3A 1NCAL 5IROD 1J88A 1HQRB 1ZDQA 1CDUA 3ZO9A 1EGJA 3GRWL 4XPHH 1ZA6A 4W9EC 3QUYC 4FCAA 1S7SB 3ZKXC 5HVHB 3DRTA 1NIAA 4GIOA 3NABL 4G9DB 3CMOH 4N0UE 5B4MC 4HV8B 2YA0A 4AIZB 3B2VH 3GMNA 4LF3B 1XF2A 4OFDA 3HG2A 2HTLC 4JPSA 4XNQB 4EAEA 4I18C 3I6LD 1TZAA 2APVA 4TULL 4JHWH 3CHRA 43CAB 2YIHA 3FO0L 5KSUB 2VXSL 1LP9A 3EHBC 2CR6A 4IOSA 3L2NA 4JANB 1QBAA 5F9WC 4WFFE 2HT3C 5DJDB 2IAMA 2E56A 1FIGH 4HUWA 4MZRA 4YHZL 4N9GA 5BZDB 1NFDE 1MIML 2MH4A 2XV2A 4B7IA 2VLRB 4L8BA 4X80L 4L18A 4Y19B 1X7TA 4W9GC 1T7ZA 5HGDB 1L3WA 1PLGH 3IGUA 4FYSA 3MLRL 1FZOA 2UUDK 4Y1SA 4ZDHB 3WEMA 3P0VH 4R0LB 3DX4A 3HG4A 2GBTA 1T7XA 5E6ZA 4NXKA 5EMYA 1QP1A 4ZNEA 2JIXD 3H1ZA 5CEXA 5AZEH 1T89A 2Y7NA 2Y2TA 2I9TB 5IQMA 2G2RA 3SDCB 3MRBA 4F5CE 3WNIA 2QDWA 4PVMA 2DQCL 2WC7A 3T9WA 1JPTL 2F7OA 1DANU 2ARJA 3TBYB 4XE5B 4U3XA 3IEAA 1UD5A 4IU2B 2R2BB 4G8IA 4XN5A 1K2DA 4N25A 1YEDB 1NAML 1U8IA 2GIMA 4FQXD 2RALA 3VFVB 2VR3A 5EORH 2GAZB 1HE7A 1O7DE 5IQNA 1EUUA 1AD0A 2NYYD 3ZDXF 3NUKA 2XA3A 43C9A 2CA3A 4OZ4A 2APWA 2P8MA 4CVUA 4IRZL 3GIZH 5CXPA 3ZQXA 4XGZB 2DZEA 2V5TA 1ZVYA 3KYOA 3FAXA 3BVXA 3W9DA 4NIKB 3WL9B 4EUPB 1DVSA 4I0PD 4ZMAT 1P2CA 4U1SA 3V4PL 4OV5B 4FA8A 5E08H 3KPPA 4HLZG 4Z7QE 12E8H 2WXFA 7PAZA 4O9HH 1JXDA 1WLHA 2ENSA 5CJOH 4XPGL 2GEQA 1ZHNB 1MW2A 1Z9OA 2RFXA 3DETC 3DTXB 5I24A 4NFDA 4KVCL 3B3IA 2AJXL 2F0CA 3PP4L 3D18A 1Q1JL 1Y1UA 3JWOC 1QLEH 2JXMA 5DA4A 1G0XA 2UWEB 4K7PH 2X9XA 4NQXB 1AQKL 2TAAA 1BGXH 5ERWB 1CPUA 1KELL 3IJ8A 3CCHB 3PP3K 3GRGA 4IGBA 3FRPG 4U1IA 5DEGA 4TTDC 1CLOL 4IBVA 5EZLA 5DRZB 3ZHLA 2YAFA 3HZYB 5HDQL 5HGHB 1BQRA 1NAMB 5DMIH 4P9ML 4R4FL 4Z8FL 4L5FH 2PR9A 1CL7H 4P3CL 5SWSB 3LRSA 1SEQL 3KL3A 4R96B 1HHHB 5TF1H 1ID2A 5GGVY 1TVBB 4Y16A 1GGBL 3QYCA 3ZL4H 3WGVB 2J3SA 2N1TE 4GMSH 4QY8A 3QUZB 4TNVF 2DTSA 1F45A 4N0UB 3S8FB 2VJ0A 3TBSB 1D5IH 2EIMB 4N2DA 4FTVD 1PX3A 3KG5A 4U3SA 4NQDE 2PP7A 3AS2A 4NO0D 5GGQH 4G6JL 3RP1A 4AMKH 4U1HA 3GMPA 4JB9L 2F8XC 5IM7A 3LPGA 3FL7A 5CLYA 4JGJA 2ZX5A 3WO4B 1GA2A 4D8PA 1RZIB 1B4JL 1PQZA 3MNWA 4XNZB 1TPXB 1ACYL 3AG1B 4AGLA 3AWEA 3SQBA 2WB7A 3CK0H 1H19A 5ID0A 1KCUH 2XT1B 3IJ7A 2BSBA 1S2EA 3GSQB 1SMDA 4OZHB 3RDTD 1HC1A 4HSQA 1CDGA 1OLZA 4TLSA 2D3VA 4X5QA 2ZUUA 1MIEH 3E8VA 1D5BA 1WEJH 3C08H 4H1LB 4RMRA 1L3NA 3EBHA 4Y4HD 3A22A 1D2PA 3OZKA 3UTQA 3Q43A 4HD5A 3NSXA 2CD0A 4K9EC 2XV6B 3ZRCC 4KO5A 4MXQD 5JORA 5M95B 5LNDA 3X3GL 5BQDA 2DWYA 3ZKSD 4JKMA 3S8GB 1A1OB 3ES6A 3G6JA 2ZG2A 4DGVH 5DHXB 2VLKA 3D2TA 3R4DA 4PIBA 4P2QB 3TJEH 1LE5B 1G9NH 1P84K 3B9EA 1UZGA 1UVQB 1PAMA 1LMIA 3AREC 5I5JA 3QZOA 4XN8A 1GS8A 4I3RL 3S0PA 1LO0L 1KYUA 2VXQH 4WI0A 4WV1C 3OAUL 5J13B 3HTLX 5DJAA 1ZVNA 2UWEA 2W5PA 3Q8AA 3DHMA 4MYWB 3C5SB 3WE6B 3B9AA 4LPYA 1G9MC 4H13C 5DUBB 1NCAH 3ILEA 5F0JB 4BCZA 4NZRH 3LKRB 4JMNA 3U36A 5TDPB 3WIIL 5HPMB 5E70A 1CFNA 4KKLD 4Y19D 1AZUA 5H2BA 3TU6A 1BV8A 3MACL 4UTBH 5DS8B 4XOBA 4DN4H 3F7LA 2RAMA 2DMCA 4ZFGH 1HILB 3T0ED 2EUWA 3ZYOA 3ZMRA 3WUWB 4LZKA 1QW8A 5JA9A 3M7OA 2DM7A 2IH9A 4Q4EA 2BY2A 3LRKA 1MJ7L 3KW8A 3TM6A 3EBGA 1HEZB 3QDME 3SE8H 2X6CA 2W07B 4XAKD 2IQ9H 3IDNB 2XNAB 2B1AL 2PTVA 1I8LA 1K2DB 2X4PB 1UUNA 4PTUA 4PRPB 4ERSL 4EI5D 4HCIA 1T4KA 1MNNA 5DFWH 5IJKA 5E99L 3AADB 5CEZE 3G5ZA 2ZONA 4AZUA 2RTTA 4S1DC 5HDBB 5JOPD 4KROC 4EQ2A 5J6SA 1INDH 1RIHH 4E9LA 4LCIL 2IANE 5IROC 3NGBC 5EZIL 3RPBA 3VXUB 1K8IB 1OWWA 3E9UA 1P6WA 4JM2D 2WHVA 1MF2H 1BQLL 3MV9A 4OGXH 2Q6WB 3PXHA 3M8OL 1R9FA 3DOIA 3LH9A 4MDIA 3JZYA 3L3JB 1HVXA 1FAKT 3DX6A 3L3IA 5IMKB 1QFUH 1CXFA 5KOVC 1IM9A 4PCKA 1QSZA 4NWUH 3N91A 2VXQL 3FJTA 4M4RB 3RRQA 4JL1A 1IEBB 1MOEA 1NBZA 1WFTA 2XPYA 4JPIA 2X05A 1JPGB 4D9LL 1DQJB 3ARPA 3K6IA 3BZ4B 4C4BA 5HYQA 4HAKA 4HG4K 1GY2A 2CLVB 4KNSA 2LU3A 1ZS8A 4OKDA 3DK2A 3PWPE 4FP8L 5INCA 1FNLA 3QDMB 2N1KA 1CDCA 2BSED 2XG4A 3I02A 1SHXA 3JWNE 5IFAL 2V7NA 1PNCA 4JFHD 4IRJC 3FTZA 4NQDD 2F53B 1O7VA 1QSVA 2CPUA 3QUMB 2F8VA 5D7LE 5BRPA 5M94B 2ZOUA 2CJTA 4HGMA 4HEME 4Y5XA 2LVCA 2DL2A 3L3HB 3MJ9H 2WLYA 3DVNB 3NJNA 4AITA 4QHUB 1BLNA 2R29A 3OF6D 4ZX3A 3CVHB 2CGRH 5DGQA 3PJSB 4GRLB 1R3IH 1T5KA 5B1JC 1UM4L 5ACZA 1WBZB 2L0DA 2OL3A 4N0FB 1WG3A 3FTGB 1KCRL 2JH2A 4WJ5A 3LOWA 5L8JB 2E74C 4PRBB 3RY6C 1TVHB 4JPWL 1IAMA 4BKTC 4ORZC 5AB1A 1LNUA 5F7EH 1FH2A 2EICA 1IL1A 4LLWB 4X6BB 3NZUA 1QBMH 2VDKH 3VJ6A 4O2FB 2BSRA 3WJLC 2ZF8A 1EVTC 3L3GB 3LHPL 5JOFA 5BQ7B 3HMWH 1MFEH 4Q52A 1KIRA 2IG2H 4MD4A 1ID5I 3MUGA 3FOMB 3FH7A 1YY8A 5ESAA 1UWGH 2H1PH 4K23L 3TBTB 1XXFC 3REWB 3VFGH 1LYQA 5JW5A 3DPDA 3MROB 2HSIA 4J3VA 3KXFD 3D4CA 3HG3A 4PWFA 3ZXAC 4GW1B 2CG9X 3BPCA 5HBBA 1HIML 3N43B 3RAJH 2CDGB 1HL8A 5HYFA 2AV1A 1K4DB 1L0XA 4K8RH 4B9KC 5DURD 1CL7L 1P7QB 5DYOA 2D0HA 4HIJA 2E46A 4JO5A 3H2PA 3GWJA 3P54A 2X4SA 5HDQH 3HE6A 3APNA 1SVCP 3H6JA 3PJLA 5HHOA 1KXQE 5ESVA 4JRLA 3IU4H 4RVBA 4ZPTB 1KN2H 2NQ3A 1P7HL 2NT1A 2F74B 4PWKA 4Y4FC 3ECUA 3OAYH 4ZSOE 2NW3A 1NLBL 4RRPG 3T2OA 4EDXA 5JO5A 3WD5H 1FFQA 1KIUA 3N41F 2WTPA 1YEKL 3AQXA 4XOEA 4YO0B 1UXWA 4X9HA 1RHHA 3PP4H 3ZHDA 2AJXH 3D25A 3KPOA 4E9RA 5IB1A 3BT0A 1XSOA 3MLUH 3ZRFC 1JXKA 1MY5A 4PRDA 4AJYV 5LCVA 3SDAC 3EFOA 2CLVA 4I9WD 2A9CA 4NRZA 2VXUL 4Z7VF 1S7WA 3ZW3A 1AR2A 2XZCL 1OCCB 1RULH 4LB8A 4AEHH 3B2PA 2IBGA 5BW7C 1CBVH 3HI5H 4F7CA 2NR6D 2NX5A 4FERA 1EJ6A 1ZD6A 1XZ0B 2E6PA 2V2WA 5TDPA 1H15A 1OGPA 1HINL 2XWDA 3BGMA 4G5ZL 3IDJA 2EDKA 3RWIB 4Y89A 1L0PA 1J1OL 1VIWA 2V6HA 3K74B 5I1AA 1OCZB 2EE3A 4A6YA 3BAKA 1CFSB 4XHJD 4K9EH 3PDGA 1XSJA 5EULV 3NDYE 3BXNA 2H3XC 1QSFA 4PVLA 2WWMC 1ZEAL 5DVKA 3QR1A 3P4MA 1MJJB 3TFKD 3ZDZB 1NOAA 4G8GD 4WWKD 2C1OA 1ZLVH 3WNOA 1GTNA 1Z9SB 4RH4A 3ULUL 4HWBL 2PYEB 3EOTL 4LCWA 2CK0H 5I1KH 2BHFA 3MRHB 1FCCA 3MGOA 3B8YA 4P9HC 1I31A 3VXOA 1A4AA 3MN8A 1T0NA 3O6FC 4NC2B 4BYHA 2EADA 4BK5A 5GGRY 2ZUSA 1IC4H 3K8MA 2EYTA 1HSAA 2A9ML 3KYMA 2H2SC 5JPNA 3KM1A 2Y1VA 2A74B 1Q9LB 3TVMB 4MA8L 3F04A 1VFOA 2SEBB 4E5XB 4QJ3B 4ZFFB 2K45A 3LZQA 4JAMA 4MLIA 8FABA 4DEPB 1JF1B 2HJKA 2PO6B 4JFPA 5C08E 3PWPD 2PCXA 4XCCH 3MNZB 5JHDD 3HIZA 2A99A 2GJ6D 4JRXA 3ILQC 5DD0L 5T1KD 1QUPA 2HVJB 3AQYA 1U8PB 3LZLA 3V7AE 3BMVA 3P2TA 5ADOL 3QQXA 4PB9L 4PBVC 2QELA 4YHZH 2HTKC 3SDAB 1N6UA 1YDPB 4JREC 1OPGH 4OB5L 1UD3A 2MFNA 3EGDA 5LN4A 4AYFB 1Q8MA 1D9KA 2VXSH 2VUYA 2YKKA 1CIDA 1OOWA 3UP6A 5JDSA 4AGMA 4PJ8A 2F7RA 3V0AC 1KC5L 2WP3O 4KJQC 4MJ5A 4W9KC 4AEHL 3BYTA 1W0WB 3HE6B 3ULVD 3KPLB 3F05A 3J8F7 1P69B 4Q9QH 5A2CA 4GO8A 4OGYL 3WTTA 4BSVA 5GS0D 1VPOH 3TNMB 4XB3A 3NRFA 4ZMZA 2VR9A 1OHZA 3MLUL 3QXTA 1YEIH 3WMPA 4HOXA 2YXWA 4NAJA 3L1OH 3MC0A 4GP8B 2FX9H 4Z0XB 4MTMA 4QKTA 1XH0A 1DP0A 3HBZA 5DJ6A 4P2RD 3WD5L 3GHBH 4WHYG 2X2HA 1JP5A 3BIBX 1KJ2H 2KLRA 2YA2A 4PRDB 2FO8A 5H94A 2L3BA 1OM3H 4JFFD 3MFGB 1W72H 3D0LA 5JXEA 3TO4A 1A7NL 1I7ZB 4NT6B 2VN6A 1PZAA 4BH8A 4OCLC 1DQJA 3OG4B 5TQ0H 4QIRA 2X1QA 5EU6D 1SXNA 1YEJH 1F4YH 5AW5B 1MUJA 1A7QH 4PJGB 4Q97A 1HL5A 1R5VA 1PY4A 1ICTA 5GIRA 1NSNL 1J9SA 3S5LA 2QSQA 5BRQA 4Q6KA 3ZTEA 4EI5C 4JRXE 5GRYA 5ITBL 2OCFD 2PR4H 2P52A 3AT8A 4LLAA 3FB8A 1S7TB 3QNZA 3QR2A 3BIAX 3RL2A 3MJ9A 1DBJH 1AXTL 1NEPA 1MCRA 1A8ZA 2B5IB 4N0FA 4QRTA 3VI4B 2DIJA 3MA7A 4X6EB 1OE3A 1NQBA 4APQA 1RZGA 4LCWE 3GD1C 3MXVH 4NENB 5AZ2L 2GJZA 4XNXH 3RIFF 3SDDA 4JDVB 4OAWA 1GXEA 3QORC 1BQHG 4L1SA 1HCVA 1CDJA 1VF5C 5FKAA 3SZKC 5GGTH 4R2GB 3SDXA 2A7BA 1B0RB 1LQBC 5I0ZA 5JW4R 3D05A 4I8DA 4HIHA 4M02A 1WD8A 1MAMH 4MQXD 3IN2A 4YHKH 3OBAA 4MMXB 3X1NA 4NI6A 1G1CA 2NNRA 1E65A 4LEOB 3CV5A 2Q2LA 3D5OF 1E5UI 2J5LB 4ZUWA 4M7KL 5A2LH 4HETA 5EBLB 3WELA 1AE6L 4W9ZA 4PLOB 1CGVA 4NM8L 3RTQB 4KTEL 1RUPH 3KR3L 4MB5A 4P5TD 2LU4A 1TJHH 3ZQ9A 3SHSA 3MCG1 4BZ2L 2WK2A 4MB1A 4KVPA 2R69A 3OAZK 2R29L 4Z76B 1NKOA 2FLRT 3EAKA 4FGMA 1QO3B 3CHQA 2X4SB 5FV2A 1R6VA 4AVHA 2JKWA 3GDCA 4MXWH 3BDXA 4NPJA 3RI5K 3DXAA 3ETBJ 2AJVL 1KGWA 1PMYA 2M2DA 4AKQA 2XTJC 1ECYA 4NJ9L 3NCMA 2UWEE 3B9KB 2X2JA 3ECBA 1XB3A 4L4VB 1KCWA 1BQLH 2APBA 1RLBA 3RTLA 4F9PA 3MNWB 4YXHH 4RA0C 4TQHA 1XIWC 2OMXA 2FNWA 1QHQA 4BQCA 1WJ3A 4JZJC 3RZCB 3GIVA 1AO7D 4PWJA 2ZPKL 4XVTH 1Q1PA 5ICYB 2K8QA 3ESOA 3VH8G 4BFIA 1KGIA 3CWGA 5I16A 3WTWA 3FQWB 4OBSA 1AXTH 1F11A 4HK3J 4ERSH 5DJ8A 3I50L 1KLUB 3FPYA 5B4MD 4G8IB 3G6JF 1NCJA 2VLKD 1H8OA 2CO6B 1QFOA 2Y23A 3DTUB 4ALAH 2XA8L 2PR4L 4EE2A 2Y72A 4JFDE 4YDLC 1AMXA 3TCTA 4ZTOH 2HJKB 1I9EA 5JPMA 4I1RA 4IDJL 3CZEA 2I5YH 2APSA 3TJPA 3UJTL 4X7TA 2R2EB 4M6ML 4LNRA 4IDLA 4HOMA 1X4YA 2G3NA 4F91B 5F3HA 1XB6A 3O41A 3ARFB 4X4ME 2WIIB 1X5MA 2B3IA 2EZ0D 4KKAD 3WEAA 4YPGA 5DEFB 1MCHA 3ROOA 4L3FA 3ZKXB 3SDAD 1P4IL 1WZMA 4JX0A 3T2LA 4PJXB 4PJ8B 3V6FB 3RX8A 3JTTA 3D3VB 1A9EB 3BPNB 4FYQA 4OIIL 4Z5RA 2FX8L 4PBXA 1JZHA 1FZMA 4NO2A 5D6DA 2QSCL 3MFFB 4MCZB 3QXAA 3MDJA 1U8KB 2JK5B 1DL7L 5IQLA 1OT2A 3MZTA 3WO3B 2R23B 1U8PA 1UZ6E 4ZXBA 1WTGT 4J12A 3JV6A 3VXNA 2QV2A 2DQ6A 3X14A 1AZBA 2J8UA 4TVUA 3UTSD 3DHUA 4IRSC 5EOQH 3REVA 3T6QC 5FHBL 4QRPE 2FHBA 3O81A 4LCVA 3H2QA 5AD0A 4Q9RL 3KLAA 4YSOA 3LS5L 2YRLA 3M17A 4A04A 3FN0L 4QOKB 3IMSA 3VGHA 3LRGA 4GAYA 5IWLA 3BE1H 4QRAA 4AX3A 4I0PC 1NGQH 1IKNC 2WN3A 2Y5QA 1DUZA 5DF0A 4FQXB 1S7RB 2ARWA 3BJ91 3QG7L 3QUGA 1NIBA 4JFVA 3EJCA 4Y7MA 2BY0A 4ZFOB 1U41A 4BKLB 4AV5A 3SPIA 5DZ9A 4A55A 4PJCE 4GKSB 3ULSA 3CH1B 4YHMH 2ZX8A 4LARH 2ICEA 3MJ8A 3MV9D 3ZDXE 5FPIA 4K0OA 1SY6L 1IGMH 4WV1B 2J8UF 3BZ5A 1WO2A 5T3ZE 4KXZI 2A77L 2IAAC 2VN4A 3L4YA 5DJZA 2E6QA 4N0YH 2V2TA 2DLFL 4LHUA 1N18A 3SY0B 5ICZA 1FQ9C 4NQVA 5L2KA 3C5JB 1OP9A 4O58L 5D7JD 4M62H 3CXFA 4ONHA 3DI3B 5EEYA 4XXWA 4LRNH 4YSAA 4IHBA 4D9RD 1BVZA 1D5IL 5D4IA 2ZT9C 3ARUA 4CW1A 2VM9A 4KVNL 4PFEA 5L88L 5IG7A 4FKKA 1YNKL 3F12A 1BF8A 4DGYH 1I1AC 3ARGC 1GOHA 2Y1YA 4P23D 4XWOC 3VGGA 4U1KA 1UH3A 2DJUA 1CBVL 1GYUA 1S5HB 3QDGB 3Q6FB 5IEKA 1I53A 4Z7NE 3VXME 3T0AA 1DZBA 4HEPA 3T1FB 4WU7B 1PGRB 2H3KA 1LO2H 4Y2LA 3WIFB 1RXLA 3T6VA 3EYSH 4AV0A 2AJ3A 2IDQA 2WLLB 4H26A 4K5MA 2WBJC 1KXVA 4OKVA 4RFNC 4KQ3L 2H32H 1DVZA 2HTLD 1RFDL 2OJ1A 3KWWA 4LCYA 3ABZA 3MYJA 2XQBH 1EZUA 3PLYA 4ODHL 3IXTA 4JHZA 3OJMB 1EGJL 4YSDA 4G70B 4JRYD 1M2VB 2COQA 2FLMA 1YSOA 5DFAA 1EO8H 3ETBF 4JM0A 4XMKH 4AL8L 12E8L 3U0WH 3GI9H 1C08A 5JOFB 2Z1KA 3QO0B 1AVAA 3RAJL 4OSUL 2ITEA 3ARDC 4ONGL 4JO3L 1YCSA 5CLXA 2JKRM 2R4SL 3TVMC 4GUPB 4LSPL 1ZHKB 3RZCA 2MCPL 2FK9A 4C55A 4JFXB 3L8QA 3NSCA 3NZ8A 4PJ9C 5CJXA 4JK0D 4OZHE 1BAFL 1BPLB 4P5RA 1XT5A 3H55A 4HIPA 4PCTA 3WO4C 2HT4C 4QO1A 4WU5B 4XN7A 1TEFA 1JV2B 2BWDA 2GT9B 2HRPH 5CMAB 4FXTA 4OM1L 2MRYA 2P80A 1NJ9B 3GM0A 2NQDA 3BSZL 1TZOA 4NIYE 5CR1A 3QZBA 4W9FC 1TZIB 4HJGB 3K7UA 2OYLA 4DJMA 1CUOA 1BAFH 1A1NA 3QULA 5CLTA 3EYUH 1KPUA 1R24A 5ESVB 4DK6A 4GSQA 4DH2A 2YEZB 3VACA 2Z93A 1URLA 5FGBC 3FB7B 4IIQC 3T0BA 1C5BL 3BZDA 5ES4B 1UT9A 4OZFG 3O4LE 4HXBL 3VTTA 3V52L 4LSTL 2J5WA 5C0IA 3GI9L 1I3GL 2FE0A 3UMTA 4LBEA 1P4BL 4AL8H 5ID1A 1UJ3C 3ZYIA 2Q2EB 3B1TA 2HRHA 1NDGB 3RWDA 4YZFF 2DMGA 2CO6A 3MLXH 2UV3A 2DQHL 1UADC 1UD8A 3SE9H 2PYED 1IIKA 3FQRA 3PAZA 5AVQB 4EVNB 1W72A 1XF1A 3WUWG 1WZ1H 1WGVA 2Y7LA 1U2HA 3L3JA 1AC0A 1KB9K 2YAQA 2WZAA 3QIWC 4FJZA 4ZOBA 4HHAB 3K91A 5E9NA 3VD5A 4Z3HA 1KJ2A 5SX5K 4HAGA 5C9JA 2G5RA 5CILH 2KL6A 1QWNA 3VWKA 3L4VA 1PZ3A 4L4TD 4JQVA 2D3NA 2VMCA 4PRPD 3KLHC 3DXAE 2F8OA 3U48A 3V4PA 4MJJA 2NCEA 3QFJB 2PTUA 2AITA 4XXDB 4AQAB 1C9SA 4PJXA 4B0MM 5HGAB 3CVHL 3VFOB 5ACZB 5CGTA 4WDIA 1IAII 2OL3B 2G2RB 4NNPH 2IH1B 3PAYA 1S7XB 4GQZA 1GS7A 3O3EB 1FVEB 4XAWL 4JBSA 3VWJD 2R7EA 1PZBA 3NCJL 2X4NB 4C56E 5HHPB 1G5AA 5C7XH 3VFTA 2QPEB 4GO6B 2IH8A 2W0PA 1JK8B 1NBYA 3QORD 3NSJA 2BW5A 3H0TB 4P46C 5IK3B 1MY7A 1QNZH 1OD9A 2XV0A 3FO2A 2HVJA 4UYPA 4APXA 4NBYB 4BQBA 1C5DB 1Z5HA 2COVD 2HG5B 2XPZA 4KC3B 3BZFB 2VDML 3Q3GA 4RWYL 3MTXA 1IL1B 1EO7A 3QT2A 1UB6B 5ESAB 5C0RH 2OX5B 2Q5BA 2OYPA 5EBWA 1G7QB 2OJEA 2Q1EA 4AUJA 2DEXX 2EYTB 5BQ7A 2Q8AH 5EU6A 3QFJE 1X5IA 1AIFA 1QBLL 3AXLB 3F6IA 4P2OD 3ARDD 4NFBA 4E5XA 1NGQL 1GAFH 3UAJC 5C0GB 3OJDA 2XFGB 4WV1A 1TETH 4HJTA 1EEUA 3UROR 4GW1A 2HP4A 4PJEF 4XBPB 2AQRA 3CVHH 4JANA 3GXFA 2VZUA 5INDA 4JG9A 2C9QA 4H25A 4X6CE 3ZDZE 1ADWA 1FSKC 2YD5A 2VLMD 5E8OA 2XSKA 3ULUC 1J0ZA 2ERJC 3LKPA 2ZUTA 3QE5A 5F8QC 3BO8B 4Z3FA 3RUGE 1I8AA 1W72B 5HVHC 1XX9C 4QRPA 5KBNC 1UZ8B 1KJ2B 2H45A 3QSKB 1MEXH 2XETA 1DN0B 4Z7IA 1HTYA 1BOYA 2B59B 3HW7A 5HI4D 5EU7C 2KERA 1QFHA 1TYEB 2EEDA 1CFMA 3GSRB 4QYOB 2Q87A 4GQPH 1XGPA 1G0DA 5I6XB 2NX5E 4WQOA 3T0VA 3ILPA 3VCLB 4NGHH 1KXHA 4A7VA 4OCSH 2EYSB 3BEVA 4PTTA 3D0LB 1PPIA 5FS5A 1SY6A 2YXVA 5IM7B 3LZNA 2DIEA 4G7VL 4OZIF 1GZQB 1AP2A 4ZMPA 3CDZB 4KDTA 4KZCA 3ZTCC 3MA7B 1WAEA 1JZ4A 2BCKB 1RZGB 3FFDA 3BCDA 4FQHA 3P40A 3FU0A 4KUCF 2P43B 4HW6A 1WYJA 4TVPD 1H9VA 1L6ZA 1YYLL 2H41A 2XA8H 2HAZA 3CK0L 2F53D 3ETSA 3NTCH 4YH6A 3KPNB 1NUGA 3FMGL 4YSTA 3W81A 1FA4A 3DLQR 4J1UA 5B38A 1YNTF 4X6CA 3FFCD 5I8OL 4I5BA 2ICEC 2GG1A 3QNZB 3GSNH 4OM1H 5B21A 3UBXI 5KS9B 3MGOB 1IEHA 4G42B 4BXVA 1YQVL 4LEOA 3B5TA 4XN1A 2PCPB 1NZRA 2V9UA 3OX8A 3DSFH 4FFVC 3W9EA 1JUFB 1GGIH 5JORB 1JV5B 1OQXA 1RJCA 1DLHA 3NIGE 3C6LC 5FGCE 3UIZA 2VQTA 3SO3C 3T6WA 2F15A 3SGKC 2B4CC 1BOGB 3PFUA 4ZFFA 4UV4L 5BXFA 5IW1A 4NJ9H 3TX4A 3BUIA 3MLWH 2VQ4A 2GCYA 1KB5B 1Q9WB 4IK6A 2AJVH 4LBAA 4K94C 5IREA 4M5ZL 1OAKH 2DMKA 4RSYA 3ARTA 1L9NA 4OTXH 5IF0A 2PCFA 1WDAA 4E0RB 4DZ8B 1JGLL 1KWKA 1PF3A 2DBLL 4KMTH 1DJXA 1O9WA 3BRFA 1CURA 4OLWL 3Q2VA 4N2FA 1KELH 3QCVL 2VT0A 5DD6A 1UT2A 2ADFH 2ALWA 2XJKA 1MHHB 2X6AA 5IGXH 5AENA 3S48A 3E2HC 3FDWA 4P46A 1O5PA 2AXGB 3ZDZF 3ZGHA 1GS6X 4M7KH 3HG1A 2UVFA 2R51A 3OG6B 5CINL 1LEIB 1ZA3B 3HBQA 4Y4FD 4W4OA 4PMFA 4XPGH 5F7FA 1NGXA 5FKPB 1U8JB 2AGJH 2W65A 3OLDA 3MRJA 4BFRA 1DBKL 3QORB 5JOPE 3V4PH 1J1PL 1N8ZA 2FQFA 4RX4A 3W0WE 4PS3A 3MV7E 1NBVL 4PJ9D 1UD2A 1S7VB 3EOAA 1HHIA 4WNQA 1J86A 1AD9A 2P45B 4IRZH 3ARBD 3FFCA 4X6DA 3FO9A 1JK8A 5I0VA 4DTGL 4AGPA 5DURB 1MAJA 5KW9H 2X4OB 4HOZA 1AFVH 3V9EA 4ZOAA 4DIXA 4ZTPL 4PV9A 4GBXB 1LP9F 4G1EA 2BOBB 2QT6A 5IROA 4XH2B 3P30H 1AJ7H 3UTPE 4QOKD 3J7HA 1OAYH 4K4KA 3A21A 4FCHA 3VXUE 2DQCH 5LNGA 1JZJA 4Z3IA 1T2XA 5A6MA 4OM0H 4X6EA 2ZKHL 2DJSA 1H6TA 4KXAA 2V2XB 3VFRA 4N1HB 4V1DE 5E6RB 3AREA 2AK1H 2FO1A 2GK0A 2XXFA 1XIWA 2W9LA 3EYFB 3U7YL 3V55A 3NJGA 5CZVL 5I17A 1F4YL 2NQCA 3KBHE 3KWXA 1YEJL 2X10A 4NQCE 3L6FA 4WW1B 2PWDA 4PJGE 4KFZC 3UPRA 1CC3A 4RMQA 1KZQA 2JIXA 4Y9BA 3O45B 5H4YA 5JYLA 3NH7H 3VFWA 4KQ0A 3Q44A 3ESPA 3BP7B 2YPLD 1A6UH 3N40P 5BMFL 4QHLB 2X4RA 3FRPA 4UTBA 2R1WB 3GHBL 3DK0A 3GZPA 4NKOB 2E27L 1NANI 4HJ1A 1OE1A 3KAAA 4LKXB 3PWLA 3WIHL 5F93C 4UIMA 1NH6A 3LKPB 5CCKL 2EO7A 3WDJA 4L4JA 3FZUD 4KY1H 5JUEL 3VMOA 2BIHA 3ZR6A 1UASA 1P1VA 2J72A 4K71B 3V2AR 2VDNL 3GMRA 5DUPL 2CO3A 5ISZE 3X12A 2NLJB 2NNAA 3LKOA 4GRLA 2CHZA 4PY7A 5G4MA 1DSYA 2APTA 2C9AA 1JYNA 4OIIH 1T1ZA 4L0YA 3ARBC 3UERA 3HKZA 2A3TA 1ILUA 2ZOTA 5LNEA 2BERA 4JO4H 1EFQA 3SODB 4GT0A 3S37X 2PPCA 5B1BB 4C4KO 1S3RA 5GS1B 2BPBA 4WEEA 3WFEL 4R2GD 4MMZC 3NOIA 2FJHB 2I9LB 5MEQA 4JRWA 1UATA 4M6MH 3O2WH 3P2DA 1M6OA 2A9BA 1R3KA 1OGAD 4NNXA 3R7QA 1BSIA 4HUXB 1ZDSA 3VFUA 3HS0B 5DHYB 1ADQA 4KOCA 1QZ1A 3INUL 1U3HA 4GKSA 2NY2B 2Y7MA 2Y2YA 5HXMA 1CD1A 3U9PL 1WZLA 3QS3A 1ZGLA 2ZCHH 4WHDA 3BWAB 5SV4A 1P1ZA 3OZLA 5G4NA 4P3WA 2CIKA 2XXGA 4BFIB 3Q13A 5TPWL 1U93A 2P46B 3QG6B 2CK0L 2BJMH 5SX4H 3PNRB 4PG2A 4I77L 4LE8A 3LNEA 3OV6A 5IJVB 5GGSB 1OSYA 4GBXA 1CTNA 4P49A 2XWEA 2YQ2A 3A3YB 4OFYA 4A6YL 5AB2A 1IM9B 1ZEAH 5JQ6H 4FXKA 3OX8B 2YC1A 1KY7A 2B16A 2XXMB 4XVTL 1JPST 3AB0B 2CUIA 3CC5A 2CDEA 2ICWA 1H6EA 1EPFA 1ETZA 3BDYH 3F7VB 4WTXA 3RTQD 1ITBB 2AJ3B 3KGRA 2BNRA 1ZHLB 2P5WE 2UVEA 2V5RA 4Y2OB 4JM2F 4ONFL 1JZ8A 3MRDB 5B38B 5FUCE 2HVKB 4GG6B 2GI0A 3Q6GH 3O2DA 4PJIE 3FUIA 4G7RB 4JKPH 1CU4H 4PRAA 3COOA 3IWVA 3RLSA 2IC2A 3GLAA 1JN6B 4WHTA 3P11H 1RIUL 3NFNB 4F8LA 2C4FT 4FADA 1DQDH 4UOQA 5IQ7L 4RFOH 3SPJA 2BFGA 3LQZB 3WHXA 2P44B 1MCWM 1RUPL 3KR3H 1XZ0A 3L1GA 1VACB 3L7EA 4KTEH 2CIIB 5FYLH 3U7WH 4B50A 4KX9A 1H8NA 2R56H 5DJXA 2ITDA 4BV1A 1U95A 5D7IE 4BQ6A 2QVIA 1R4XA 1FFOA 3L3OB 1XF2B 1E4WH 2W91A 2ZNWA 1XH2A 2HWZL 3OB0K 2G5UA 1U8OA 3NQIA 4JFYA 4U6HA 3ATDA 3EOAB 3D1MC 2MQ0A 2WYZA 2J4WH 2EDTA 1J18A 3O4LA 1O9VA 1JTTA 4NP4H 3LNFA 4Z23A 1E9OB 1OSZB 2PWHA 3QULB 1XF3A 3EFFB 3QXUA 4GEJA 4XNXL 1CLYL 1T0NB 3BDYL 2P5PA 1X5LA 4DKFL 3QFJD 2ZE0A 1LEIA 1J8HD 1KIQA 4WO4B 2WQXA 2CCLA 4LL9A 3T77B 1CD9B 2BP8A 1RUKL 2J8UE 2LW3A 2AV1B 3CZJA 1QKZL 2AXWA 3GZOA 1EJOL 1BHGA 5TK4A 1SZNA 1ZT4B 4NS0A 1SVZA 3U82B 4I77H 1T2JA 5E9DE 2BNRD 3QJUB 4JR9L 3VFRB 2O61B 4LHUB 4W68A 3KPRB 5ITBH 4JM2C 5F1SA 1KCRH 3INUH 4MX7B 2OSWA 2OKMA 2E9BA 1KB3A 4J2QA 3CLEL 2CXKA 1DVYA 3QPKA 4YWGH 4P4KA 1RKRA 1RLWA 5LQBH 3U46B 1NEZB 1Q72H 3IDIB 4G9FB 4DESA 4YDLB 4GJTB 1HEJC 2LLLA 3EGSA 5J8OA 4Y5VA 3SYPA 4AENA 2DWEA 1S7WB 5I0DA 4L8DA 3ZE1F 2GABA 1U92B 5JHDE 1PZ5A 4C56A 1XSKA 3JTBA 3RWHA 5KUKA 2QADB 4NBZB 3OHXC 1FLRH 1JK9B 2OP4L 2IADB 3ZDYB 4TNFA 1UWXH 4KUZL 5FYJL 4XVJH 3V6OA 3E6HA 1S7XA 3CFQA 5HY9B 1U30A 2QSVA 3O3EA 5IEHA 2J25A 4FLQA 3P77B 1UG9A 3BUBA 1NBQA 1M6UA 4ODUA 2VKWA 3ML8A 4GYBA 3X12B 1MCKA 2NUTB 1NWOA 3H9SB 2W1NA 1U6AH 4JFEE 4FA6A 3RJOA 2FZ3A 2HJFA 4FE9A 4BHUI 1DBBL 3WEBA 1LO5B 5AOIA 1V55B 5FWRA 1UA3A 3CBKB 5GJSH 1Z9MA 2JJWA 3F7QA 2NY7H 3QWNA 2NY1B 5D2LF 3NPSC 1T20B 3RVTC 4IRSB 4Z7QF 1JCVA 5EZLB 3SKNB 3UBXA 5ADOH 1PSKH 3W82A 3FU8A 1YRKA 2PPDA 1IUZA 3B56A 3GC3A 2XICA 3IDYC 3U6XA 1CE1L 2AEQL 5IBLD 5DJAB 3PHQB 3VI3B 1X5FA 2QGDA 1GSKA 2H3NA 3FRUA 4UIKL 3UBFA 4F8NA 1KSRA 4G7YH 4XC1L 2IANA 3L5JA 1OCOB 2BVOB 1RP8A 5AVYB 4M8QA 3QP3A 5JXEC 2P3YA 4YVUA 4P2RB 3W2DL 2BHZA 1VFMA 3T2NL 5J5EA 3S9DB 3P30L 3DBXB 3ULUH 4NXSA 1PG7H 3CPUA 5IVXF 1BZ7B 4DPBX 5E5RB 2NNXA 4OZIA 4J8RA 2AV7A 2A74C 4WFFD 4K9EL 4DTGH 3QK0A 3MACH 4H0HB 4CA4A 2H32A 4Q4IA 2DWTA 1LDPH 2YGPA 2MCAA 3C2SA 3MRDA 3Q1SL 6PCYA 3WIHA 2QSTA 1E6JL 1SLWA 4F15B 1FFNA 4NZTH 3MLYH 3HC3L 1CLZL 1F1AA 5DK2A 1I8KA 2YR3A 1K85A 4DP4X 1A5FL 3OAUH 3OKEB 1YC7A 4BHUA 1UM6L 4FXKB 5IB5B 5DMYA 2ZJSH 3KLSA 5M7QA 3SBWA 4Z0BH 2AJZA 3RWHB 5A7BA 3VG0H 1F1GA 3G6JB 3V0HA 4M4PA 4GO9A 5MEPB 5C9JB 1R5VB 5F6HJ 1EEQA 9PCYA 1I8IA 1U8CA 3EDEA 3LKSA 3OLEA 4MDIB 1E4KC 4XPTL 3O3BA 4ZTEA 4ALAC 2B14A 15C8H 5I18H 3QCVH 4EKXA 3C6LA 4F7TA 2KZ1B 2DQHH 1U8LA 3CFCH 4G8EA 4ZXBD 4IOIA 3DPBA 2KC0A 1NGZB 1FG2B 2WXKA 4M43L 2KBGA 4OU3A 2FGZA 4P5TB 3H9HA 2BNRE 2P5WA 3VXUD 3CDGB 2H5UA 3T0XA 1TKWB 4P0DA 4QRQA 3C08L 5HGAA 3KYKH 2CRMA 1JPFB 2X1WL 4UV4H 4JJ5B 3GUFA 2L8AA 2NTFB 1FE8L 1D5XA 4OFQA 2PW1A 3F65A 4P2OC 5LHDA 5D71H 3A6CH 3DSFL 4FQHB 3EH1A 4U6TA 1XCQA 2HFTA 5D7JA 3FQ4A 1YC8A 4PJHF 3MLVH 2YPVL 3VI3A 1FL6B 2K9FB 4O2EB 2MNJB 5HGBA 2OJEB 3V0DA 2XFXA 3CSBA 2K4WA 3MRRB 3ABMB 1H6UA 5KOMC 3HI6L 1Y07A 1TQBC 4BSWB 3O6ML 3J07A 3L13A 3BKJH 3K3QA 5C0DA 4J3UA 1Y6KR 5D71L 1IZJA 4QRBA 5EBLA 3EG9B 1CICC 2ZP9A 1VERA 2BIOA 2O5YL 3GTVA 4WK4B 5E23A 5D5MF 5DVLA 4YE4H 5ABDE 4V11A 5CS7A 1GGTA 1E0OB 1MFNA 5EUKA 5J12B 1BQUA 1MFDL 2D3LA 5EO9B 3BN9C 1JL8A 2CM5A 4QCIB 3L81A 4U1NA 3GPEA 3STZB 3ZZLA 3S88L 1X4ZA 4P9MH 2H32B 4OCSL 4YLQT 4IBZA 1FHNA 1NGXB 4K8RD 2OM5A 1T1XB 1TZHA 3Q2WA 2VLJB 4LLDB 2YJLA 2VO5A 2WJ7A 1X7QB 3DGGA 3ZKQD 5C8JB 5CD3A 5J11B 1IQWH 3OAWA 4LCCA 43CAA 3UFIA 3B3IB 3IPEA 2CMRH 2Y5TB 1QSFD 1MEXL 1TU2B 4L2YA 1NC2D 7PCYA 3GSRA 3FNKA 1C8QA 1NBZB 2VRQA 4JPIB 1THAA 3N41B 4IGBB 5DEGB 3BUDA 4XMPL 3BP5B 3VFNB 3VX1A 5K1NA 4JM2B 4MWFA 3GXMA 1YEEH 4YQXH 1L9QA 1TLMA 3RZCD 3H9SE 1D7FA 5D7HA 3BVWA 1I8UA 4Z7QB 2BOBA 5T1DL 3FCGA 3GO1L 3VU2A 1FN4B 1YNKH 4QRSB 5E8DL 4PJHE 2WKOF 4KVNH 1GR7A 3Q9QA 3SZ6A 4PG2C 1YYCA 1RUAH 1IFHL 2YXFA 2ILLA 1UJ3A 5AB0A 1XIWB 3EYFA 2AAVA 2UY7B 3NIFB 5C08A 1OTUD 5DJ2B 3LH8A 2ARJB 4ODTL 1W91A 1SJHB 3GB7A 2H8PB 4UILL 5JOEA 4N2OA 5D1ZA 4W6WB 1ETA1 4RETB 4X99A 3STBA 5KVEE 3BGMB 2XV3A 4MDJA 4G1EB 3W2DH 1I82A 1ASPA 2PLTA 4LFHD 3U0PA 3BQUD 3BH9B 4M5TA 4N8VA 1USQA 4JVWA 3ARFD 3KPRE 4UQ2A 2YD8A 3QRLA 5F7AA 4C47A 3PV6B 3VWJB 2X5PA 2CRIA 4G3YL 3GRBA 32C2A 3CN4A 1EHLL 3GBML 2PYEA 1NTDA 4Q2ZA 3L5XL 3MOBL 5I9QC 3WY4A 4H1LH 2WLIA 3VQMA 4YIQB 2I60L 4X7CC 1SXAA 4XAWH 4M8QB 5C92A 3PE9A 3REWA 2BSCA 2Y7QB 4TYUA 4FZ8L 4PJFE 4MXVE 2JELH 4QHLA 5DO2C 1DVXA 2Z4QA 5FO7A 3KL5A 4KKBD 4HIJB 3UO8B 4MZIA 3M88A 4JPVL 1G7JA 3UC0L 2Z6FA 2I24N 3LNGA 1VADA 4I3RH 3CX5K 1NCHA 1KYOJ 4Q6YA 4WO4D 4ZYKB 4TSBL 1UFGA 4R3SA 2ADJB 3K6NA 4AH2A 4B96A 1KJ3H 4X7DC 1R3KB 4BGLA 1CGSL 2JELL 3G08B 4L3AA 4HALA 4Y16B 3HZVB 5EWIH 1T4WA 1HHHA 4FZ8H 5CLWA 1WZ1L 1P4IH 4K3EH 1MCOH 3OJVC 3D87B 2WYTA 4OUUB 1Z5YD 3G7TA 1UHVA 1YMHB 4LVOC 3HG1D 5CIPA 1FG9C 5D1ZD 5LBSL 3GSNB 2B4CL 1JFHA 2F54E 3T4AA 3I9GH 1WA1X 4XP5L 4CKQA 1KBWA 1T6WA 1VGKA 4ZUUA 3WENA 1RUML 5I66B 2JJSA 1S7UB 1ORSB 4HKXB 1X6LA 3UMNA 4YFEA 5DZLA 3TN0D 3UEZA 4TUKH 3FFCB 2XI9A 2C1PA 1XQ4A 1OARH 4L8SA 5KN5B 2AQ3A 3K6FA 1E6OL 2WSPA 4S2SA 4CW1B 1J87A 1GRWA 3AS3A 4KHXH 4PW9A 3M1CA 3PGFH 4Y5YB 4AYMC 1MJJA 4JVPA 3FSZA 5LAXA 2JCCE 3H7BB 1VENA 3ARDA 1NEUA 3JWNG 1P2CB 1IBBA 4C83A 3TZVC 1A21A 1I3RB 1SDDA 4XBGB 3IJHA 2HRPL 1IIIA 2ZWLT 4HU2A 5JXAH 1A4KB 4D0CB 1X5YA 4D3CL 1D5MA 2JJVA 2I26N 5F9JA 4CBZA 3O45A 1D5XB 3C8DA 2DM3A 2MNUA 3LRMA 3X1FA 1UH4A 2EP6A 2QHRL 4Y2NA 3DUUB 5IJKC 2WZ0A 4NP4L 1GGBH 4JO3H 1BA9A 1F0LA 1FO0L 2J4WL 2BNRB 4KROD 2W80C 4NZUH 2X09A 4L8CB 1CTMA 3PGCA 2EH7L 5KYXB 2YRZA 4P2QA 1OB1A 1S78D 1A7PH 4R4FH 4Z8FH 3MUJA 2R9HD 3ZKND 5I76B 4B3EA 2R4RH 2Y36H 3HJEA 1HXYB 5DYFA 3M1BB 3TLRA 3JTSA 3T8MA 3V0VB 5I1GH 1OT1A 1NPNA 3ABLB 3C60A 1MFUA 3QJQB 4DEPC 5T3ZL 4LVOB 3LN4A 4DUXA 8PAZA 3DWTA 1CD0A 1QLEL 4N0CC 5BPPA 3R0NA 1B9KA 5IOPA 5L4FA 4LEBA 4NCC2 5I1EL 1L5GB 5AWNH 1MRFH 1MVUB 1SVBA 3BWUF 1LO2L 1CGXA 5JIMA 1ETB1 1MFBH 1FFTB 2QADD 4PYHA 4Z78B 3TN0A 5D93B 1RZQA 5MEQB 3NCCB 3QEUA 4D8PB 4WAFA 5GRXG 3SIKA 4YE4L 2QKIA 2ZWYA 2A0LD 4IBLT 4CC1A 3NIFF 2DQTL 5L88H 3WXWH 1WBZA 2EILB 4DZBA 2YK1H 1DJSA 5E6IA 3BKJL 3FB7A 3VAEA 3UO1H 3GSNA 4JPQA 4QRRA 4FZEL 4PBWD 5EORL 4HHGA 4PJ8C 3P0GB 2ZCLH 4LLWA 5C0NC 3TFBA 2XVGA 2J8OA 2H6PA 2YPVH 5I0YA 3SE4A 4ADIA 5SWZE 2ZWZA 1JGVH 4QRSA 4N2KA 5D6CA 4ODVH 2XWBB 5AZUA 5CGBA 5HSFA 4N0YL 3R4RA 5E0FA 3WS3A 5J4MA 2X4QA 3KCPB 2WOYA 4QOKE 5F7WC 3RA7L 1QABA 1PZ5B 3FW6A 1CXHA 3NJIA 2OL3H 4FXKC 4DERA 2ZD0A 2DKSA 2QDVA 1YG9A 3G5XB 2IQAA 3WJJC 1CF1A 1ZPUA 4H0LC 4DP0X 1JWMB 4F33A 1CIUA 4W9CC 1K8IA 1T6VN 3HE7B 1G1YA 5DJ0B 2WWKT 5ICXA 3QNXA 1ECZA 1ES0A 3L3DB 1GOGA 1VFAA 5ICUA 5AUMB 1EAJA 1MRDH 4JG0L 1ORQB 4U1LA 1X5GA 4H8PA 1JNJA 3P0YL 4X80H 1KPRA 1JN6A 1BD2D 2B0SH 5E5UB 1KLGB 3A4FA 1XB8A 4OZIE 1ZCRA 4UNIA 1NINA 2ZP0T 3FF7A 3HS9A 2Z0BA 3Q8FA 2H1LM 3HMXA 4HKZA 4RCAA 3FT3B 3KEDA 4KKQA 3T0EB 4WEUD 3RDTC 5FKAB 2Q3ZA 3ZE0B 2XVLA 2NUPA 1DYZA 5JZ7D 3O6LH 3NIDF 4OLVL 2ITCA 4DKEL 3JV4A 1HAWA 1ZLVK 3DGDA 3ATAA 3KNBA 4KROB 4LSQL 4TULH 3TBVB 5CJ5A 3VRJB 4LCUB 4KRLB 3A23A 2OMZB 5HHQA 2DJ4A 2MPVA 1UM6H 4RDQF 3N42F 2D7QA 3HC0A 5IEHB 4OFPA 1DL7H 4G6AC 5E4IA 2ED9A 2BIQA 3BEVB 2F68X 4N87A 4PTTB 4G6MH 3ZDYE 4NO0B 3QWRD 3KBEA 5E00A 3O6LL 5ISZD 1U95B 4X5WB 2IXQA 1G9MH 4B9PA 1LL1A 2XKSA 4XXCA 1A6UL 5BMFH 4FTVE 1HKLH 2CDFB 2E47A 1JWSA 1VGEH 5AQ0A 2R0KH 4HISA 2MOQA 2B2XL 3MQIA 2X4PA 3RTQC 4AG4L 4PJFF 5I66A 2NMSA 4XMVA 1RJYA 3K2MC 3KLKA 3RWGA 3RWEA 3WEXA 1FV1A 2XX1A 3BAJA 2R1YA 4C4KT 3TF7C 1L9OA 5IMMA 5EZJA 1XAKA 3GMLA 2PCPA 1UWFA 3OM3B 4FQCL 4KU1A 5SV3A 3MRPA 3TIEA 1IEAB 4AMWA 4ZPVB 4LVEA 4LVNB 3HC2A 4EQ3A 2O61A 1CR9H 4Z7OF 3NCXA 1AG0A 3BKYH 4UYQA 1MCLA 5CU5A 2R83A 4TSCL 2Q8BH 2C7FA 3D69B 3VA6A 4Q14A 1PD1A 3BPCB 5DJCA 2DWDB 3EH2A 4ELMB 2YOCA 3EBAA 3BPOC 5IW6B 5KW9L 3CH1A 4LQFL 3S3SA 1E7VA 2BIPA 2WLHA 1BYNA 5B3JF 3P4OA 1L0YA 4R90H 4DZ8A 4LASL 1OGAB 1EHXA 1TJGL 4YDIH 3FTUA 2UZYA 2V17H 1PG7X 4NZDA 2O72A 1SYVA 4A7GA 1T1WA 4UB0H 2B59A 3TEYA 4B6ZA 1KENH 4U3CA 2LFEA 1RZ7L 3I74A 4G8AC 3M1OA 3QEQD 2ZG1A 5T33H 2WXRA 1RQ5A 2V5SA 5EG6C 1BWWA 4BH7B 1OZUA 2Y2WA 1OCWL 1L6PA 1BQKA 2F7QA 2ZOOA 4GFTB 5GQBA 1J5OH 4ONHB 1RK1B 1RSYA 5E9DA 3I84A 4WFHE 1FGVL 2Z34A 4HPOL 4YK4C 5D4JA 4JRYA 3S3CB 3VXRA 3FQ2A 3R7RA 3CDGA 1IC1A 1MRFL 3D30A 3VRLE 1H6FA 4AKOA 1HKFA 1I7RB 4I2XE 4HEMA 3ULVC 2EDLA 4ECNA 4A2GA 4F3FB 3ZMNA 4KXZH 1OALA 1FZMB 1LO5A 2DLTA 1CF8L 3AM8A 3GMOA 1F3DJ 4MA7H 4NO2B 5C2UB 1OP4A 1H3GA 1KFAH 4PJBF 3TO4D 4KRMB 5ADPL 1I8IB 1U8CB 1A6TB 2PP9A 2R4RL 2YS4A 3VFMB 1VZHA 3VXTB 3LNIA 1JNHB 1XTMA 1A7PL 4HJEA 4UBDD 2EH7H 4UNUA 2ZWKA 2EH8H 3NFPA 4YSRA 3KPTA 4NPYB 5MHSE 3Q06A 2D9CA 3X2QB 3W0WD 3IDXL 2WKLA 5E8EA 4ZG1A 1NPJA 3GSXB 4JFFA 4B27A 2X9YA 3VI4E 3NSYA 4JN2A 4JO8A 1MLCB 4DT2A 4TV3A 4ADGA 1C12B 3EF7A 5IMLB 1NAMA 2ZKXA 4WJKB 3B7RL 4XVUC 2H2SD 5I73C 4FI6A 5I1DA 2V0AA 3FB5A 3V4VH 4DNLA 2BP5M 5DWUH 4F8PA 3MV11 4J8RB 2V5YA 3LEVH 4G1MB 1AOHA 1E28B 2Y6TE 3QPXH 4PJFB 1ADQL 3A67H 1KYOK 1YHPA 2Q7AA 3H9ZA 3TNNB 1KXVC 1KG0A 3O8XA 2FQGA 3KWVA 1F6FB 4ZZFA 5JIIA 3DIFB 2DWDA 3QEQB 2RIKA 1T5XA 2Z35B 3ZUNC 3ELAT 3DROA 3QZLA 5E2VH 1IC0A 1WE5A 2B4CH 1ZPLA 4IKNA 5CFAA 3E3QE 1OM3L 1ZIBA 3FH8A 3GZKA 1FNEA 2VABA 4MMYB 2FYYA 2NR6C 3QQDB 4K3EL 1ED3B 4GEIA 4LNVA 2Y6SC 2B1HL 3S37H 4AY0A 2AAAA 3KNBB 4NB7A 2VN5A 2YBRB 4GSDH 4QRFA 5B7FA 4IBTA 1RV6X 3KDPB 4UQDA 2BNQB 2MQGA 4M6NH 5BW7A 5BOPA 4PCSA 5H35B 3HG1E 3B2UD 3RTQA 1FO0B 5A2AA 1ZHBA 2OMUA 3N6YA 2CR0A 3WN5A 3QW9A 4UOZA 1SBSH 3N1FC 3LIZL 1IGCH 5KG9A 1NDGA 1KTRL 3P11L 3QWOB 4M3KB 3CIAA 4JUSA 5D4QA 3ZX1A 4PLKD 4JPVH 3EH5B 2X3AA 3THML 1OCWH 3V6ZB 1JXJA 2FWLB 2FEEI 5FECB 2IXQB 4MRBA 1XBRA 4KV5E 4UNTA 4J6RH 4JM2A 4KTGA 3VDBA 2WWNA 1OPGL 1MUJB 3NP4A 4PJGA 5DQJA 2IO5A 5ERWA 3DURB 4MNHB 2AK4E 5F7UA 1WBXA 1TJGH 4ISVB 1WC7A 3QDJE 1YLBB 1TKWA 2Z8VC 5JQ6L 4CSZA 1HDMB 5ANMB 1Z9NA 1QBLH 2VLJE 4DWHA 2Q0ZX 1G9EA 4DGIL 5CNHA 2Y69B 5BS0B 5HGGS 1UKTA 3O6KH 3OR6B 1CFVL 1ZXKA 3SKJH 2D03H 4P2CG 1MNUL 5AEAA 3DX8A 5LGKA 1KV7A 5A16A 3A0OA 4X9FA 1DQTA 3LJ3A 2FB4L 3TBWA 4WI6A 3TCLA 2J57A 3E38A 4N5UA 3BSHA 4IGBC 4B9IA 1EXHA 5AW2B 1RERA 1E8XA 3CN0A 2AANA 3O4OC 1KN4L 3F8UB 4JFSA 1K72A 5EUOE 3RGVC 5I1KL 4HMCA 5D8JL 2J55A 3KS0J 2HKHH 2Z4QB 1AHWB 4NQEA 1DQQB 2OQJA 4B41A 1W6WA 3HPLA 3HRZC 3N55A 4QRPD 4TVPH 5HVGB 4GB9A 4NC1C 4ZMNA 1CD8A 4F15C 1A9VA 4IJ3C 3NCBB 5B8CA 3WJMA 4FQPA 5AKSA 2LLGA 1KDIA 1MJ8L 1NDMA 1W8NA 4XNAA 4JO4L 1R3HA 4P4KD 1X7QA 1KNOB 1T0MB 2MQCA 3DGGB 4GRWB 2WWKO 3OJ2C 3RYMA 4NI3A 1ZY9A 3FT9A 1K4CA 1FPTH 4FQ1L 1DVTA 3QQNA 3V6OC 5LDSA 1A66A 2YAEA 3MCKB 4HXAL 4JKNA 1RULL 1S7SA 3LIUA 2F54A 5BOZG 1M53A 2VR7A 2EXSA 3BOVA 4PJDA 1RZKL 4QHMB 1Y0LB 1UM5L 5CILL 1GYAA 2DS4A 5EU3A 3TONA 3S96A 3TIDB 5GRWA 3ZBMA 1WP6A 4NC0B 3K71B 4RGNE 3GDBA 3KBPA 2ADJA 2H47C 1AGEB 1A1MB 4AK2A 5AAMC 3CPLB 3CU7A 2NY6D 3D4ZA 3UYOD 5C71A 2ICWJ 5HDLA 2P5EA 1CT8B 1XH3B 2FQDA 3M86A 4LHJB 3P0YH 2C9VA 4ONOA 5J1SC 1IBFA 2C4FU 1VRSA 1JGDB 1E7UA 4FFZA 1I9JH 1GPOL 3S36X 1LEGA 3UZVA 2BMKA 4PPTA 1U8NB 1I3RA 3B83A 1SF5A 1Q0EA 3LS4H 3AUVA 4D8OA 1KLUA 1Z1WA 3HKFA 3OZ9H 5BV7C 4XBEL 2CCVA 2DLEA 4FX5A 3AY4A 1KCUL 4PGZA 2FRGP 3RA7H 5CEYB 1LDSA 1OAYL 2NY2C 4PGDA 4F7KA 2CKBB 5F72S 4X5XA 1H3UA 4QJ4B 2D0FA 3H0TA 3ASNB 4FG2A 5EBMA 3AUWB 4N5EC 1RL1A 1U58A 3PJSA 3QJTB 1BX2A 1KTLB 2XYCA 2WO4A 5F6HI 1NUFA 1SQ2N 3HBPA 1JRHH 3LZFH 2EO9A 4M8RA 1BPVA 1SYSB 1KZYA 5F7EL 3DMMB 2KYIA 3CVBA 1QOKA 1KCSL 3O41B 4Q58C 1QFWH 1FE8H 1J8SA 1NCIA 2WNGA 3IGFA 1V27A 2GUOA 2DICA 4F5CA 2NY6C 4CU7A 2IADA 3EGXA 1HQRA 4HUMB 3AXLA 3KYKL 2YAHA 1J1PH 4FHKA 4OZFH 4WWKA 5K93A 3U0WL 2VUOA 3EJZC 1M1XB 1IILE 5B8CB 4BE6A 1IM3B 1KBBA 2PN5A 3QIUA 4NQDB 4M00A 5J12C 3OSKA 3V0GA 5ECGA 5E5MA 1I9RH 1PEZA 3SGDH 5EUOB 5DJYB 3VGAC 2AJSH 3ARED 3X14B 3IRCA 4KQ3H 2YD4A 5FK9A 2P5ED 1M7DB 5IFAH 4TSAL 2ADFL 3FCUB 3K2IA 2FSDA 2GEEA 4XVOA 1QSFE 4XI5D 3UP1A 2K4AA 2PXYA 3GIVB 1T21A 5D7IF 3VO0A 4MSWB 4GXUM 2F9BT 4HK0A 3VI3E 5F1KC 5GS0H 2OMBA 4MAZA 4R3SB 4AH2B 3B34A 1J8RA 1UACH 4BZYA 2FH6A 3MLWL 2RA1A 1FSKB 3MSPA 4HPYH 4TPRL 4BZ1H 1CLZH 2P8PA 1V3JA 3ECVA 1H3PL 3M8OH 1C16A 4LSSH 3ARXA 4WFEE 5CP3H 2E7HA 3B4NA 4JKKA 3RBGA 4ANUA 3K72A 2VQUA 1MKFA 1UKQA 2WTRA 4DPAX 2BCMA 2GQHA 3D3VE 3DX7B 5D1QA 2GBAA 2D7MA 2GJ6A 4F33B 4AYDC 1QBBA 5EZOH 3F6LA 1NAMH 3ATEA 4PR5A 4CGUB 1QNIA 4IBUA 1PG7L 1JV2A 5T3XD 2X0WA 2ADGA 3QXDA 3FONB 4TUOB 2YD1A 5BUAA 1GJUA 1S6NA 4WNQB 2GAZA 3RIFK 2A77H 4OV6F 4G80A 1R3JA 1U0QA 3WNPA 3PL6A 1MJ7H 1WBXB 1KCVL 4I5BB 3JTTB 4YBLC 3HPLB 3KPSE 2LFGA 5I9QB 2XWCA 4U6XB 4UIKH 4W70A 3FU3A 4XHJC 3CG8A 3DX0A 4HJSA 3RPIB 4NGHL 4YR6B 5AKTA 1N2RB 4ZOEA 4DN4L 2P8MB 4KDTC 2NZ9C 4WU7A 5BV7H 5TDNB 1PSKL 3HAEG 3X1EA 3BLBA 3AM8C 1MCOL 4X5PA 4WCYH 1GZHA 3PUCA 1NDTA 4EUPA 2DQFA 2FVNA 3GGWA 1E4JA 4LDLB 5FHBH 1K4DA 3ES6B 1BM3H 3TASA 2YXMA 4YDMA 3DX1A 3QI9B 1QASA 1K3ZA 1TQSA 1KGJA 2WXPA 3BP6A 1GJWA 3EZ8A 2RACA 3MNZA 4G8EB 4MNGE 2NTSP 4U1IB 4QXWA 4HJ0D 4H1LG 2ZUXA 4KQ4H 5HGHA 2VRAA 4XO4A 2XWXA 3PIQA 1G9NL 1R33A 3NJJA 2VLRD 3SGKA 1SOSA 1RVFH 1EQWA 4B3VA 3NN8B 1ND0B 3KGSA 4P4RA 3L95B 4P9HL 4WVRA 2K6ZA 1JHKL 1ZK9A 1CVRA 5HDBF 4J8QA 3KJ4C 4YX2L 5J11C 3FN3A 4WI9A 1TENA 2VGLM 3OTTA 5GRZA 5MI0B 2H0FA 4FQ2H 1H9DA 4QMEA 4DKDC 2E7MA 2NY1C 4I89A 2X40A 4NAMA 4TRPH 4Q9CA 1NOLA 1CGUA 3UJTH 5HD8D 4LOEA 4PRNB 4Z0XA 2ZWSA 4GBXD 3V4UL 7TAAA 3UDWA 4YBLB 2V37A 1KIPA 5FF6B 2EXWD 3L9RA 4JVUA 4HDIA 1IC5L 2B7DT 2BW4A 5L8LB 2VDMH 4RWYH 1BVLA 3IJSA 2Q3AA 1KPUB 3VXRE 2EEAA 4QRRB 1CFSA 1CQYA 1COBA 5AFAA 1E8YA 3TF4A 2D73A 2W0LA 4XZUB 2XC8A 3PU7A 2XG5B 2OX5A 2FBJH 2BRRH 4FLHA 3OAYK 4WTQA 4YC2C 3UAAA 4HIIB 4AJ0A 1RIVH 3QXDB 1JVKA 5F1IB 1A6AB 5GGQL 4GSXA 4LESA 1W0VA 2HG0A 1VFAB 1YEHL 3ZTNL 4LPCA 1R19A 4RLDA 1T5WB 4PWIA 1OAJA 3K6DA 1U3YA 4UINL 4QXGH 1C5CH 4WI5A 2WXIA 3RNQA 2N7AA 1YPZA 5C0BB 3S36H 2OFQA 4HPYL 5KVGE 2XQYK 3F00A 4MA1B 1E9PB 3IXTB 2YGVA 1S8DA 4G7SB 1N2RA 2J1ZA 3VXSD 4EZKA 4L5FL 1HYSD 2E7LA 1HOCA 4W93A 1E4WL 4BUHA 1XGYL 3VI4A 2D3JA 1IO4C 4I1NB 3HAEB 3EF4A 2R29H 3FT3A 4OI9A 5IV2B 3DVGB 2XRAL 3T0EA 2HLFC 2CJSA 1J48A 2KZKA 1AQKH 1FUNA 1OAXH 3EJYC 4LQ1A 3UTSE 3I2CH 1ZHLA 2R56L 2X6BA 1X7SA 3MKKA 3EFDL 3O8XD 2H4EA 1SUJA 3CVCA 3WNMA 4KKNA 2W59A 2WLJA 4U0QB 1JE6A 1NGWB 4TQPA 1OF0A 1LHZA 1EHAA 1LWHA 3JVGC 2PABA 4KHTH 4RZKA 2VAJA 3P9MA 4D0DA 3ECQA 4GNKB 3KLDA 2J88H 3M45A 4O9HL 3S35H 1I3GH 4YHKL 4HS8L 4MRCA 1KGCD 3V52H 1HL4A 3DKHA 4Z77A 6TAAA 2K9UA 4R2GC 1TQUA 3N9GL 4GQQA 5FUCC 3US9A 3X13A 1KT2A 4A2FA 5IJCC 2PWFA 2PUQT 4CSTA 4LFHG 4CNIB 1KCSH 4PN6A 2FO4A 1P6AB 4ICXA 4NJAH 4ZPVA 4JFDA 1X9UA 3DI2B 1ZSHA 4N8VB 2FDBP 2P8LA 1AY1L 4TF4A 1GC1L 2Y3NA 1YEGH 1J0IA 2UZXA 4W9LC 1PD0A 4GI8A 2MOGA 2Z31A 3Q5OA 4D7PA 4MAYB 3P4LA 1VEPA 5FAAA 1BVLB 1JPTH 5D2LA 3ESUF 3A6CL 1NFDB 5KYNA 2B9AA 4FMFA 5T5FL 4PJ5A 3HN3A 1FZJA 5EOCJ 3WUZA 3T0EE 5JW4N 4XHQA 4R4BB 5F88B 1O75A 1NSNH 1E4HA 4B95C 4NQUA 3WDIA 3B43A 4CBPA 2CBQA 4OSUH 1AO7B 1A7QL 5DEZA 3SGJC 4E2OA 2AQ1A 3W56A 3LQMA 4ORGB 1SMAA 3L3KB 5FCUH 5TQ0L 5DJ8B 2WBJB 2WXHA 4RGOH 1JZ6A 2VLRE 4GW5A 3MLRH 1K5WA 3VGFA 4XP9L 4LF3A 1R47A 1RK1A 2CDEB 3SY6A 4F2MA 3QJHB 1HH9A 4UDTA 2KZBA 15C8L 1JPGA 4P8QA 3MV9B 2IBBA 2Q6WA 5I18L 3HUJA 5L7XH 3CE1A 1RFDH 4QRPB 5HI3D 5KSVB 1UT1A 4PJIF 4Y9EA 2EABA 3BD5A 4XMWA 4NWTH 1B4RA 3SDYH 1V3KA 1DQKA 2H7WA 3BUQA 4BDVB 5E8PB 3VG0L 2LR4A 5K59F 5I1JL 1KGUA 1VPOL 4NCC1 1XR8A 2B9BA 2DWEB 2EVJA 3L48A 4IHOB 5E03A 2ENJA 3SYQA 4JFOB 2VE6B 1VACA 3CN3A 3N40F 1BFVL 4YZFE 3MRJB 4XCFH 5GS2H 3D3VA 5D1QE 3FO2B 4MJIA 5KYYA 3B9DA 1VHPA 3CDZA 2ZXDA 2NY4C 3ARWA 1KJVA 1MJ8H 5FA3A 1LEKA 1P53A 1FORL 2ZOWA 3BH9A 5F9DC 3VNZA 3WUWA 2Z1PA 1FJ1A 2DQUH 2LE9A 2PWGA 1J0KA 2GSGB 1Q0XL 1U8IB 3IBOA 3SPHA 3V4VB 5D8JH 2DLFH 1SUHA 2C8NA 3QI9C 3SDDB 4HU8A 1EMTH 3VRLF 3UBHA 4OM0L 5CM1A 4XMXA 3EJTA 35C8L 3L5IA 1GCYA 1SXSA 2XG5A 3SN6N 3IMRA 4TLUA 4N8VG 4XC3H 3TCLB 2FAUA 4FQQB 4A2MA 3AY2A 4LLVA 3EOTH 2EUZA 2P5WD 1OF2A 5KYUB 1K3IA 4P23A 1CGWA 5CZXD 3ROLA 2PMZA 5E8OB 1AHWA 3DJZA 3A4DA 2Y7SA 3D8MA 2WLNA 5FF6A 5E6UB 3BO8A 1CVSC 1DJIA 3I6KB 5DR5H 2X70B 4NLAA 2A9NH 4O2CB 4TKWA 3QRFM 3LS5H 2EIBA 1MI5D 2HA1A 3ZTJH 4Q9RH 3QUHA 4MQSB 2WANA 1B3IA 1FF5A 2AJYL 4ORGA 5DD6B 1TPXC 5DJDA 3SE3C 3LZRA 2EDYA 1NC2B 1ONQA 4G9FA 4LPXA 2GBVA 1Y6NR 4P57A 1D6EA 4PV8A 3OKYA 1XGUB 1K5NA 5DS1A 4L3CA 1A6WL 5E51A 5I1IH 1UXSA 5ETUB 1SBSL 4NZFA 1QRNE 4ZMOA 2QLVB 1GL4B 3CFUA 2BMKB 3C2AH 2BS71 2QSCH 2X4TB 3Q9PA 3IWUA 1GZPB 4EUPH 5FB8A 3BWSA 2FX8H 3FQXA 3V6ZA 2BP0B 4OQ1A 3RNQB 4AGQA 4YK4B 3VD2A 4OJAA 1DSWA 5AYUH 2NX5B 4F57L 2VERN 4QY8B 3VI3F 4S2SB 2V9QA 1U8KA 2JK5A 3MRLB 1AGEA 1B4LA 2HKAA 2ZKMX 3Q8EA 2ZYSA 2HTKD 3S4SB 4LDEB 1DUYA 3VDCA 3KBFA 1TT6A 2XTJE 5GRJL 3MLTB 3F62A 1SDDB 3N06B 2H6PB 5KYYB 1DO6A 2Q7YA 1YJDC 4ODXB 4G59C 4LP8A 4KJWD 4MA1C 1RZIA 3GBLA 4LSRL 4ZOCA 4MNHA 3N04A 1U9KA 5F9OL 4K55A 5EFIB 1HNYA 4XTRD 3TEZA 1KDJA 4W6YB 3SJVB 4AM0B 5J13C 1FYTB 4KI1A 3ZTDC 3T2PA 1TZ8A 5DRXA 3EO9L 1OD7A 1ZGLB 3B2MA 3CFEB 1S7RA 1MFEL 1VJSA 2MPAL 3LHPH 2PNDA 4FMVA 1KOAA 2OI9C 2VISA 3O2VH 3RL2B 3LQAC 3N0AA 4JAMB 5DD5L 1JPFA 5JXED 3PAVA 3NJMA 5B1AB 5C0AE 1WV7T 1RCYA 4JRXB 1HSAB 2NXYB 3HNSH 2NSMA 3BP7A 3MYZA 2N0MA 5AKVA 3O0RL 3RURA 3JWOL 2KQMA 2JXMB 2SEBA 4UQ3B 3OB0H 4XE0A 4CMMA 2JJUA 1LLAA 2PO6A 2VMEA 3C60C 3TPKA 1CS6A 2GK2A 4BFOA 1BMGA 3QAQA 4YUEL 1PIFA 2HLAA 5F7DA 4WO4C 4JY6A 5CN2A 4UM8A 3H4HA 3DIVA 1UZ6F 3TBBA 2IFFL 4ZQKB 4MJHA 2GHZA 1NCCH 1OAZL 2H1XA 3U7WL 4WTWA 4JGNA 1OT4A 4MHHG 2NDFA 3STZA 5K9QI 4NUGH 5DD3L 3HBGA 4D9LH 1WIPA 1XDTT 3MV7A 4EBQH 1JXFA 2ICCA 2O5NA 1GVIA 4F2MB 3EXJA 3VA2C 4A7SA 3TO4B 3U1SH 4CU8A 4AK1A 1IKOP 2X44D 3NIFE 4Q7DA 1T6BX 4V2BA 5IKCB 5K39A 3WEXB 2GIXA 4OGXL 1MF2L 2FSEB 1SXBA 4AQ1B 4YEFA 1AGDA 5KSAA 4N2NA 5AL8A