2KI6A

The fgf1-s100a13-c2a hetero-hexameric complex structure: a component in the non-classical pathway for fgf1 secretion
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
128
structure length
128
Chain Sequence
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptotagmin-1
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 21
structure length 128
sequence length 128
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2ki6A00
3MJWA 5G55A 2K4AA 2QZQA 3NZSA 4JPSA 3W56A 2Y3AA 3ML9A 4WAFA 3JZYA 4IHBA 2A4ZA 4WWOA 4XX5A 3F01A 3RPBA 4KITB 4BGDA 4F91B 4F92B 3DPDA 4OVVA 2WXJA 4J6IA 5CCGE 2N1TE 2NCEA 1HE8A 3F05A 4KZCA 2EP6A 1DJXA 1GMIA 4NPJA 1YRKA 4EZKA 1E90A 2K45A 5JHAA 4NP9A 1RLWA 4FA6A 3TJPA 2Q3XA 1WFJA 3APCA 4URKA 2KI6A 4AOFA 3F04A 3ENEA 1TJXA 2K8MA 3HN8A 4FHKA 5JHBA 4XE0A 1RH8A 3APFA 2K3HA 3APDA 5H4YA 2LHAA 4TV3A 4FLHA 1E7UA 4PS7A 4QAMB 3QR1A 3ZW3A 3QARA 4DK5A 1UOVA 3N5AA 4EZJA 3NSJA 4LCVA 4NS0A 4PS3A 1V27A 2CHDA 4FADA 3L13A 4L2YA 1E8WA 2ENJA 5EDSA 1TJMA 2CJTA 3L16A 3SD5A 3CSTA 1DJWA 2WXPA 3T8MA 2ENQA 3L54A 2JQZA 3KWTA 2DMGA 2NSQA 3QJZA 2WXFA 4V11A 3IM1A 1DJZA 3HHMA 3M7FB 1E8ZA 2X38A 2CJSA 2YRBA 3R7QA 2RD0A 3L4CA 4KZ0A 3DBSA 1UOWA 1WFMA 4L1LA 4Y1TA 3L17A 3R7RA 4LT7A 4TS6A 4ICXA 3ZIMA 2DMHA 2ENPA 5CCHE 2V4LA 2R83A 1K5WA 1DJGA 4Y1SA 4ANVA 2WXHA 3CSFA 3OHMB 4ANWA 2ISDA 3F00A 4FJZA 1DQVA 2Z0UA 3PS6A 3TWYA 1W16A 2WXLA 2WXGA 3OAWA 2FK9A 3QAQA 2B3RA 2CHXA 1BDYA 2WXNA 4BFRA 1A25A 4L23A 1W15A 2CM6A 3FDWA 4WEEA 4MJJA 4XZ4A 1CJYA 4FJYA 4EZLA 1UGKA 4IQHA 4GB9A 4F1SA 3IBEA 4WWPA 2WXIA 3KWUA 5KJ7E 2WXQA 4NPKA 2UZPA 2WXOA 4TUUA 4OVUA 3ML8A 1BYNA 4WWNA 2CHZA 2CM5A 3QK0A 2BWQA 3NZUA 1E8XA 3QR0A 1DSYA 2A5UA 3B7YA 4ANXA 1DJIA 2ZKMX 2YOAA 5H4ZA 2CHWA 4QJ5B 3PFQA 4A55A 4F93B 3L9BA 1E8YA 4L1BA 3PREA 4FULA 2Q0ZX 4ANUA 4FHJA 2QZ5A 5T8IA 3W57A 3GPEA 3LJ3A 2D8KA 1DJYA 3P2BA 3FBKA 4ICWA 2NQ3A 3TL5A 3ZVVA 4QJ4B 2WXMA 5CCJA 1BCIA 4G11A 4AJWA 4PS8A 3PYCA 4QJ3B 2WXRA 3L08A 4HVBA 1RSYA 1DJHA 2FJUB 3PRZA 4DNLA 4GNKB 3S2AA 4LDCA 3HIZA 4HLEA 2WXKA 1QATA 5G2NA 1QASA 3RDJA 1E7VA
chains in the Genus database with same CATH superfamily
2DICA 3C6EA 5EEZA 2J55A 5GRUH 4F33B 4PLJC 2FB4L 2N3JA 4WAFA 5CIPB 3SOBH 5F6IB 5E2UH 3ZYIA 1A8JH 2MKWA 3CDYA 4LHUB 3FTWA 3GZQA 4MMZB 1G7MA 5I74C 4CDHA 6PAZA 4P3DB 1T5XB 1V55B 4LESA 2JKXA 1HQRA 1IAKB 1NL0L 4NZFA 3ROOA 3A5VA 4A6YA 1D7FA 5IW6A 4PV9B 3SE4A 5IEKB 5F72S 2HT2D 4HKZB 1R75A 1E40A 1II4E 3ENEA 1XSKA 4XPGL 5LG6A 1BXUA 3C5XA 1T0MA 1Q8MA 4PRNA 3BP4A 3OTTA 1JV5B 2X53A 2F2HA 2BP8A 1LO2H 3IB4A 2DJUA 1ZGLP 4PSPA 3K2IA 3GK8H 1HKFA 2I5YL 3O3AB 2OK0L 2NY1D 4GS7C 2PYFA 3SGDI 1ZJAA 4EI5D 4BIKA 3R06A 4Q58C 4AQAA 1A0QL 2WOYA 1A21A 2R2EA 2QVKA 1GJUA 5DZ9A 3UTQA 4FXTA 2HLAB 2ZG1A 3LX9A 4EI0A 5MHSD 4J3XA 3QEQB 3ARZA 4Y2DA 2QPDB 4JPKH 2IV8A 3I50H 1A66A 2GJ6B 4QHNA 1HL5A 1PF3A 4YDZA 1FZKA 4OF3A 4ZJ9A 1N5AB 2LABA 5SV3A 3B2DC 1KB9J 3BWSA 4ZDHB 1QUPA 4OGQC 3ARYA 3RWFB 1U9KA 4KKRA 1OM3H 43CAB 4Y2NA 3PL6C 3FFCA 5H35B 4MNGB 1ACXA 2PPCA 3ARPA 2OI9B 3LHPL 4QRSA 3ZL4L 1F3DJ 1RV6X 4F24A 1BYNA 2OCJA 3S34L 1EVTC 3PP4L 3EOBB 5LGHL 5E6SB 1QAWA 1D9KA 5BVPL 3L3JB 1K8DA 1I8LA 1YHPA 2O5ZH 2VH5L 3BJLA 1ZLDA 4PJ5D 1S4IA 3U48A 4JRLA 4LRNH 1IM9A 1AXTL 1PLGH 3GJEA 3VXUB 5DD5L 1B0GB 3FT3B 4LO9A 4C47A 2R56L 4Z0XA 1A14L 3UJIL 1LEGB 2NNRA 2XN9D 1UC6A 4PRAA 4X6CF 1NC4D 1OTUC 2AJZB 5FV1L 4ZMTA 1KBVA 1WTGT 3FUFA 3PWPD 4NJ9L 2X42A 4EN3D 3PQYB 4HMDA 3S0PA 1MHEB 3A4DA 3RWGA 2CNYA 2WLYA 5SWSA 1OM9A 4Z7VA 5IKCB 4UILH 1RUKL 3H6JA 4FNTA 2HP4A 3GBDA 1AGFB 2FIKA 2V9QA 4M8RA 2XWBA 4LSPH 1PLCA 3A21A 4FQLH 3TYGH 4CSPA 4AQEA 5ID1A 1AAJA 1JTOA 5IB2A 1S7WB 4A7GA 5D7EA 3ZRSA 4PJEB 1A7OH 3IJ7A 4AVIA 4L1TA 1YEGH 3HJ0A 2WO3B 2ZX6A 1JNLL 3BPLB 1CFSA 1JVLA 3NSFA 1X9UA 4ONOA 3TBYB 5M7QA 1U95B 4FZEL 4XMPH 3Q8AA 4KVCL 3V7AG 5C2BH 3IFLL 5HHQB 1ZHLB 4LVOB 2H3NA 5I17B 5EEVA 2WAHA 5GRWA 5IF0A 3EDFA 5A6IA 3D0LB 4W9CC 1F58L 1BVNP 2CRMA 4PS4L 4RMBA 1QVOA 1WC7A 4B9YA 3ILQC 3KBPA 2X6BA 1J05B 3AREC 4Y16D 3TN0A 4N25A 5IOKA 5EO9B 5F3HB 1I85A 1S3KL 4X5WB 3MAWA 4KK5D 4KKBC 4NJAH 2Z35A 3ARRA 2YMXH 3OKDB 4WV1C 5L7XL 3TVMC 1OGSA 1I31A 4NO0B 1LK2B 5C09E 2LU4A 3OAZK 1EXGA 4G9FB 4ZT1A 3FB8B 3GJFK 3P3YA 5F7AA 3PWJB 5C0JB 2TRYA 3ZR5A 3PV6A 3K6SA 2WBJA 2W91A 2IALB 1N70A 3SKUD 3IDXL 3IF1B 4FJZA 4MD0B 2WPGA 3BO8A 4IRZL 4JY4B 2RAMA 4OT1H 2O93L 1E4KC 2C7FA 1MJ7L 5EIIA 3D39A 1H9VA 2FUQA 4L3CA 2A77H 4S10A 2UY6A 4X42A 2YD0A 3WNIA 3DTDA 1BFTA 3R4DA 2DQUL 2Y24A 1LE9A 5J56B 4GOSA 1REIA 2HX7A 4RFEA 3QG6B 4DERA 4R84A 3QQ9D 1OARL 2DQGH 5C0BD 2JQMA 2VDNB 2D3JA 4HISA 3Q13A 5JIMA 2IAMC 1BQUA 3V0FA 3S36H 2W0FA 4YWGH 1NFDA 5E7BA 1XL4A 4HS8L 2R9HC 3IU3B 4FKEA 2WP3O 2DQEH 4LLWA 1BG9A 3S5ZA 3UXFA 5IJDC 2R0LL 1IEAA 3VWJB 5KYWB 3EHBD 1MHCB 3HB3C 2AI0L 2APVA 5FS5A 1J0JA 2FHFA 4OAWA 3EYSH 4AJWA 2F53B 2WWMD 3D18A 2YUZA 4GG8B 4BUHA 5F88B 3WD5L 2BIMA 1GGBH 4PJBE 4XNUL 3J2PA 4BK8A 4BWWA 4WRLA 2ZG3A 4DF9A 3Q6GL 4FEIA 4UQIM 5CR8A 3FU6A 2P5EB 2VERA 2VUKA 2EILB 4QR7A 4TULL 4Q97A 2HTLD 2I9LB 5AUMB 3E80A 2F5AH 4S2SA 2WMPB 2VM9A 2Y5TB 4L29A 2A9MH 5KBMA 2A6IA 3IPBA 2WVSA 3KYMB 5CLXA 1Z5YD 1EEYA 4WU5A 1L6ZA 1DBKL 4O5LH 2DWSA 3V5HB 2YMTA 3QUKB 2D3LA 3EF7A 5AVSB 1UD5A 2G30A 4HEMA 1YYML 2P45B 2BSCA 5JDSA 1HWWA 3D3VE 2GAZB 4LU5H 2WIMA 5DQ9B 4U1NB 3JTSA 3VE0A 1XCXA 2H26B 3CXDH 5HHOB 3RZCD 4XC3L 4F15B 4JQIH 4TNFA 5DR5H 1J0KA 4LMQE 3LKOA 4NO3B 3UABA 2VC2L 5JXAL 3LTVA 3VTMA 5CCKH 1E6OL 4TSBH 4HIIA 3GIVA 3WAJA 3VXMD 1AE6H 4KQ3H 4M6OL 1F4WL 4PH8A 3E8UH 3P0VL 1IJ9A 1BX2B 2EH7H 2H2PC 4JREB 4FQ1H 3CFTA 4RGMB 3L17A 3RUGE 3ATDA 5A2LH 3ZIMA 4KAQH 4GQRA 2Y2TA 1AR1B 3L7FA 3NJIA 2L3BA 1F6LL 2MFNA 2J57A 2VM3A 1NLBH 2X10A 4Q8BA 4HWEH 5DEJA 5D9SA 3S36X 4AUJA 1O6VA 3VX1A 1LP9B 4G8GA 4K3GA 3C6SB 4DP2X 5I1EH 1OGTA 1TLKA 4JPVH 1FL5A 2BNUA 2PTVA 1QUNB 2O30A 1CGUA 5C7XH 4WW1A 3HUJA 4OF0A 5BO1H 3MFFB 4B27A 1X6LA 2EDDA 1CYXA 3NK4A 3KWUA 1DL7L 4FERA 1HEZA 3TT3L 2YWYA 3AZUA 1RPUA 1CTOA 3B2MA 2F1BA 3L3DA 3R4RA 1RHHA 4R4FL 1A1MA 3HPLB 1PD0A 5HYSG 4M4RA 4BK5A 4E9XA 3MLPA 3BPOC 2EVJA 4P99A 5JUEH 4KFZC 3MRHA 4K8RL 1BIHA 3V4VB 2IH8A 3DETD 3UH8A 5C0AB 1FH5L 3J07A 4Y4HB 4I0KA 4M7LL 1CXEA 1OV8A 2OMVB 4H1LA 5DI8B 4D9QE 3AQDA 5CBEA 1CR9L 3DHJA 4LSVH 3UACA 1C7TA 4JFOB 2NLJB 4P46D 5JPNC 5IESL 3X3FL 4F8LA 4ZO9A 4PGEA 2QADC 4KITB 5EEWA 4ZAKB 3NCJL 4BSVB 3H3BC 4BM7A 5INDB 1ZS8B 2AAAA 1HN1A 4W68A 2XFXB 4AMXA 4OFYD 2VXSH 1MWOA 3MJ7A 4YAQB 4JFPA 1K5NB 4PMEA 2NSXA 3MMEA 5IT2L 5DRXA 2Q9OA 3HBPA 5LN8A 4CNIA 4GW4B 3C5ZD 5HYJD 1FNEA 2HRLA 2X4SA 2P24B 4C56A 4EXKA 2A83B 1U8PB 3NA9L 4RIRA 4YHLH 3JWDL 1A7PL 1D9KD 5F9AC 5EIVA 3T4YB 5IQ9B 2H1PL 1U92A 5C8JB 1C16A 1I3GL 1QQDB 1CL7L 1U8KB 3H9SB 3Q3GA 1YCSA 4KU1A 4EUPA 1U41A 4Y9BA 1F02I 1AKJB 2VXQA 4N0RA 4PJDF 1E5YA 1QBBA 2OR7A 2Z4QA 5BW7A 1WZLA 1DBML 2BSDA 2BNQA 4N68A 3FU9A 1MDTA 3FB5B 2XWJA 5CP7A 3ZN6A 1XF4A 2KMWA 4BFJA 1KCBA 2NSQA 4TM9A 1KJ3H 5EH1A 1LEKA 1TR7A 3MNVA 4B0MM 4NQEB 2BS71 2EXSA 1PQZB 1G9MC 5DFAA 4E9VA 4DPAX 3UDWA 3GLEA 4ODUA 4DFHA 3SCMB 1QWUA 5CGYD 3TNNA 4LSQL 2YLHA 3V4PA 5LGJA 5FV2A 5CZRA 3W0WB 1JZ8A 1GJIA 4L9LB 4HULB 3MJ9A 3SO3C 4J12A 4J2QA 4ONGL 4UAOB 5D2NE 5JXED 4E36A 1TQWA 2WLZA 3S98A 1WWWX 4G8EB 4UQBA 1KSRA 3LZNA 3QQNA 2MCMA 4Q52A 3P4NA 5DMJB 5ISZE 3QS2A 2ROYA 2Y1ZA 5C2UB 3H0TB 2QQLL 2V5TA 4FTVB 5I28A 2LV4A 4Y4FD 5D5MA 5KSAA 2R0WL 2V0AA 4YOKA 5IFJB 4HBCL 3U30B 4TLKA 5KBLA 1L7TL 3JYBA 3O4LB 4JG1H 1DEEA 4P5TB 1OY3B 2EXWD 1G5AA 2IC2A 1KXVC 5MI0B 1NUDA 3ATEA 3ZDYF 4M29A 4OD2B 1T0NA 2BNRB 5GS0H 3IDUA 4E9QA 3L2NA 5TD4A 3MCYA 2NTSP 3IRZA 2VSCA 3N43B 2DMBA 3ELQA 5FOJA 5JPMA 5F93C 3ULUD 5F1OB 4M56A 3I6GA 5HHXL 3N40F 3SDXA 3VWJC 2VERN 5L4JA 1K9TA 2I69A 2WBJD 3HFML 5I30H 4GUOA 2X2IA 2YSSA 3AB0B 4KGJA 3B5TA 4LHUG 3OB0K 1AD0A 5D7HA 5F70A 1KCSL 4PR5A 4KKNA 4PW3A 1VFBB 5EORL 1ANUA 2P42B 4JPSA 1SEBA 3KLKA 4JDTL 4YUEL 4QTIL 4F91B 4TVPD 1AC0A 2XT1B 4GRMA 3FAXA 3UTSA 1GZHA 2Y7OA 4M5YH 3VWKC 2OMUA 2ZUQB 1PG7X 1OTSD 4GSQA 2X4OB 2ICEA 5FDYA 5DZOA 1KFGA 1N2RB 3FU7A 3C5JA 3H42L 3US1A 4KJYB 1EHKB 3DMMA 1ETA1 1GGUA 3VTTA 1KJ2L 2J4WL 3N0PB 1W72B 4N5ED 4DVBA 2AMUA 2OR9L 4JJ5B 3IDYB 4OZ4B 3SE8L 1OQOA 4LASH 3ZW3A 3MVSA 2CKBH 4FF9A 4JRXA 5SWQA 4ZMXA 3MA9L 1OPGH 2PYEA 2K1MA 3B5GA 3CPUA 3E9UA 4TQIA 1U91B 1CLYL 1ET7A 5D1QB 4WKZA 4Z7UB 5IQOA 3QJZA 2Y2WA 4PJXF 2XC8A 1P69B 4HCRL 4LQFL 2X88A 5HDBE 2HVBA 3CFIC 3QDGB 4PRPB 4WFHD 4CKVX 1XCTA 1N8ZB 2MIZA 2WWNA 4NB7A 4P59L 1TPXC 1NCNA 2IV9A 3KPTA 4JREC 3NA4A 2IXQB 1TF4A 4W9HC 3VQ2C 3KLAB 2DYRB 4LL9A 1QO3B 2VL5A 1Q1JH 2OTPA 4HX1B 4UOW1 4QRUA 5HJ3B 1C8QA 1FG9C 4K15A 3B83A 3F3HA 4JO3L 2WZ0A 3U82B 3RL2A 4ATTA 4P4KB 1TQBC 1J86A 4XNZB 5AVVB 1NDMB 5E4AA 2XQYG 2VDMB 5DHEA 3SDAB 4Q9RL 3SDCA 4Z7IA 4YNYA 1SQ2N 4KVNH 3V0GA 1MHPH 4XRCB 2WBWB 4NZUL 5EV7A 1H15A 3W1ZA 2W5PA 2E6QA 2MCG1 5HI4C 5DRWB 2FX8L 1DSYA 2BP5M 1DJIA 3D69A 2Y9RT 3VXSE 1MI5B 3F12B 3PFQA 1LJMA 4ZW6A 5D93C 3B2VH 3O81A 5FYJL 1WWAX 1FZJB 5BS0D 3PXHA 4YHNB 2B4CH 5JNYB 4M7KH 3OLIA 2EZ0D 3TEXA 4POYA 3F83A 1AKPA 5I1AB 1NEUA 1CU4L 3VXNB 2FO4A 2C9VA 3CUPA 2H2SC 1IKFH 2IPKB 4LAQH 4RMRA 1ACZA 5ENWA 1OSZB 2AJXL 3O2VL 3CTTA 5JIHA 3MRCA 1VENA 2B59B 2OS7A 4RZCA 3V55A 2IANA 1U8NB 3BZEB 5EU4B 2ED6A 4G8GD 4BDVA 3VI3E 1KENH 5GRUL 4O51B 1CYGA 1ID5I 3GS0A 2W65A 4NQCB 4H13C 2XG5A 3P77A 1NLDL 2COVD 4HUKB 4MASA 4NKMA 4OFKA 4QXUH 2F7IA 4CRPA 1A47A 4Z7NB 3MGAA 4FC3E 2YD1A 2FT8A 3L5XL 3QW9A 4YHPA 1IQDB 1T0PB 4YFLF 3HZYB 4FHKA 2VDPH 1BXAA 4WDIA 3CLEH 5ABAA 1G5GA 3D2UB 1F4YH 4RFNB 2XETA 3S5LB 2VWEE 2DQMA 3QUYC 1A9BA 4YZWA 4WU7A 3AVEA 1P1ZB 4P2RB 4B9JA 4ETQA 3FQXA 2NQDA 4QYOA 1AVAA 3VFOA 2AXJA 5T5FL 2ADGA 4ENED 1FBIL 2RIKA 2G5BB 3CSTA 5DFTA 3RGVB 2ZWLT 4PRIB 3UO1H 3IDMA 3WNNA 1XB3A 2ENQA 4LDEB 3LQAL 4RISH 5EOTA 3UO8B 1MCNA 2CR3A 3MRBA 3HHMA 3ZXAC 4BCXA 2X41A 5LGYA 1TVDA 3LSOB 3AUWB 3EFOA 5FGBC 7TAAA 4CAGA 2Y5EA 3CLWA 1SUJA 3BW9A 1ZHKA 3U4EA 5JQ6H 1OSPL 2YAPA 1NDGB 3QZWA 3TU6A 3N06B 1NGPL 3I50L 5D6CA 1J8HA 1G9NL 1YEKL 1C08A 5JIPA 3WNLA 4R5XA 1KC5L 4WJKB 1WLHA 5IWLA 1YUKB 1C5CL 2WCSA 4M5TA 1RI8A 2I9TA 3DOIA 3TPUA 1R5WB 2EEBA 3HLAA 3QUZA 1OM3L 4BFIB 5L2KA 1ODUA 3T9WA 1ZXQA 1U3ZA 1HCVA 4PU2A 1TYJA 3EFDL 3S3DB 5EUKB 3NTCH 1G4RA 3QJUB 4R7NB 3GNML 4HXBL 3ZZLA 4ZFOB 3DYOA 5I6XB 1ROWA 3QH3A 4O2FB 1YEWA 1TEYA 2OR8A 2EE3A 3GSNL 2XVKA 5FCUL 4WUUE 3CN1A 3NJKA 3MRKA 1MVYA 3OKNA 5CHNA 1OT2A 5DLMH 4LLDA 2QFRA 4K5OA 1M2OA 4QAWA 3ZGHA 3PPEA 4PJEF 1PU0A 1UXLA 1YJDC 5BV7B 4KO7A 3RVWC 4L4VE 4AXWB 4FCHA 2JLPA 3SDDB 3H6AA 2Q87A 1V5JA 2TSAA 3WFDH 3WXVL 4OQTH 1YEIL 4JLRA 2IBGA 1PYWA 3MGTB 3HOGA 1A6ZB 1WA1X 4HKBB 1SGKA 4B0MB 1GCFA 1CBVH 2NX5A 2R1XA 4GKSA 5CIPH 1M2VB 3G6AA 4AYBA 5I71B 2IQ9H 4LLQA 2K3TA 3BYYA 4HH8A 2FQGA 4EZKA 1KGWA 1G87A 2A6JA 4DW2H 5JA8B 4R7XA 2J71A 3SY0B 2YRZA 2Y07L 3UZVA 2B8OT 3LH2L 5FA3A 4H2AA 3FUDA 3EO9H 1U8IA 4URTB 4XCCL 4L8BA 1T89C 4GMSH 1HL8A 1BAFH 2A9NH 1WBZA 5EIQA 2F6AA 4N2LA 3UYRH 3PNRB 3CN2A 3QFJA 1S7UB 1G7QB 2YAOA 4K23L 3DRQA 3V6ZB 3DROB 3GMMA 4Y0GA 4OFDA 5DQDH 5AW7B 1SYVB 4XX1G 2RFXA 2WXPA 4X5XB 1NMAH 2HUHA 5A2BA 3CFBB 2XV6B 5GJTH 4PJGB 3WIHH 4QNPE 3UAEA 5DUJA 3EJCA 3JT2A 4IIQC 2X5PA 5KTEL 2N4IA 2CD0A 1MUJA 2VLRB 5LBGA 4O02A 1FO0L 5B22A 4AL8H 3ZKQD 2X4PB 4NNPL 3FT2B 4OZHA 5AZ2H 3FQNB 4P23C 2B3IA 2EYSA 3KVPA 3GRWL 2WZPD 2XBZA 4ZPVA 1MVUA 4GG6F 4GIOA 5I1IL 4YDLB 4H25A 4ZX4A 3DPBB 1Z5HA 3R8BB 2GFBA 5D1XD 2JCWA 2Q7YB 2HVKB 2O5YH 5ETUB 5E99H 1GY1A 4V2CB 4NNXB 4Z3GA 2EIDA 3UBHA 2XG4B 3D4ZA 4NZRL 2ZOKB 5L6YH 1HS6A 2YMOA 7CGTA 3T3MB 5IR1A 3MJ6A 1QFWI 2HVJA 3NFNB 4UV4H 3BZ4A 2XXFA 5F0PB 4AYDC 4R83A 2VJ0A 2V3EA 1JHTB 4RFOL 3OX8B 4X6DF 1OWRM 3RA7H 5IY5B 1QSFA 2DQGL 4FE9A 3L3OC 4BZ2L 4FN0A 4P05A 5L8JB 2EO1A 2N7AA 3RIKA 4BQCA 3N85H 6PCYA 4BSWA 2EACA 2CA4A 5A2FA 2GHZA 1ND0B 2AEPH 1IBGL 4AE0A 4ODSL 4H8QA 5F7HA 3SKNB 3LEXB 3EYSL 15C8H 1JN6B 5EU7E 3EBHA 1B2YA 2GSIB 4E41A 4JDVA 4ZX3A 1VADA 3IN0A 5MHSE 1P6FA 2FH6A 5EFIA 2O5XH 2HMID 1U8CB 1UZGA 1Z3GL 2FEEL 3MREB 4XGZA 3SDCD 4MNQD 4K71C 5F3BB 1TU2B 3LPPA 4FP8H 4GRWE 1P7HL 3F2LA 3OZ9L 3E3QC 5EBLA 5F7EL 3MLTA 4B50A 1QYGH 1FN4A 3HVNA 4PP1C 3HNSL 3C60B 3T8XA 5IFAH 4BRJA 5TE4H 2AQ3A 2VL4A 2V9UA 5EO0B 5E6IB 3WY3A 1YEEL 4TUOB 3O11B 3WXWL 1BECA 1UOVA 2FT7A 3WKQA 1UT1A 3MLXL 1CFMA 3D12B 5F0JB 4K94C 3VFRA 5CJOL 4JZJB 4APXB 4ZS6C 5C92A 4M1DH 3B6SB 3SODB 5J12C 4PJ5E 3IFNL 3CBKB 4GXUN 4PTTA 4FXLA 1GR7A 1R19A 2YRPA 2P44B 3CZGA 4KQ3L 3V6OE 2PLTA 3ARQA 3O45B 1UACH 3P9WB 4TTDD 1OGAE 3D87B 1PKQB 2CDEB 4A67A 5KVFL 1U8OA 2MNUA 1XBRA 1Z3RA 3PWPE 1PD6A 3E1F1 3FQUB 3LZRA 2H8PA 5HI5C 5FOBA 4YBQC 4HPOH 4AG4H 4E42B 3SKOA 2OCCB 5I1CH 5EO1A 1J48A 1SM3L 4X8XA 3P3UA 4KAQL 4W9GC 4XPTL 1INEH 3ARFB 5E56A 6TAAA 5FO7B 4FJ6A 4GSUA 1MRCH 1FC1A 2P5WB 3S3PA 3G6JB 3M1CA 4MXWL 1NFKA 2CK2A 1E30A 3QUGA 1ZY9A 2ZYHA 1FP5A 4AK2A 5JW5B 1P7QB 1OAQH 1QLEL 4V2BA 5HVGB 4G8IB 4D0BB 1H5BA 4Z95H 2H32B 5C7XL 3VCLB 2WXQA 1PZBA 3VDBA 2R23A 1JHLH 5JOFB 1A7QL 4AC2A 2K70A 3LXUX 2RTTA 4UZUA 3RVTC 1DUZA 3HMWL 4ZXBA 1EBAA 1I1AA 2NQCA 2VDNH 4KV5E 5LCVA 4Q2ZA 2J8UB 4WWKB 1AFVH 5DUMH 1RIVH 4ORGB 3EGSA 3L45A 1HZHL 1Q9LA 4ELME 3EF4A 1GY2A 3FCSA 3CK0L 5GRYA 1XWVA 4TVUA 4OJAA 2LE9A 2PO6C 3NGBC 1ZGLA 2X1QA 4Y19B 2J5LB 2DH2A 3AXLA 2XY1A 5IHLB 4P9HC 5HGBB 2Y69B 2QGDA 5F7LB 5ACZB 2JB5H 1T1WB 3MV11 4LSVL 3O9WD 6FABL 1DVFA 4HLJA 3OL2A 3SGJA 4DO5A 1BBDH 1TXKA 1QR1B 1J8HD 3KPRB 3RWEB 5KVDL 3VFTB 4I18B 2VLKB 4LLUA 1I75A 1SOKA 5F9WC 1DJXA 4ZFQA 3VXTB 1H9DA 1L0XA 5L2KD 3CC5A 3M1OA 4DTGH 4OQ1A 1DVQA 1MW3A 2QMJA 5ACMA 3A47A 4X6FB 3QPQC 3ZT6A 4JCWA 3GMRA 2K3HA 1NUGA 1G1KA 1EPFA 4YHLL 1BFOB 4BXSV 2CMRL 3FOMB 1V3JA 1TITA 3BEWA 3NK3A 1B9KA 4FADA 4U1HA 3F85A 5C0BE 1NEPA 2IWFA 5EC2A 3MNWB 3O0LA 2R2CA 3UMTA 2JQZA 3EKCA 2OTUA 2G5UA 4FNUA 4JFYA 3ZKSD 4JMXA 3AITA 1MLBB 1F6AB 2X2HA 1Q0XH 2X38A 4WEUD 2YRBA 2YHGA 4P3WA 4CVXB 2GBTA 2VN5A 2HH0H 2DWDA 4A2LA 5CP3H 4RNRB 5HHMD 4DO6A 4Y1AD 3CZSA 3PP3K 2ENPA 2ZF8A 1PAMA 2V4LA 4QCIB 3JTTA 4U1MA 4LVEA 3FSVA 1M9SA 1R5VB 3N1GC 3QHZH 2QLYA 4ELKA 4ZOCA 3N6YA 4DN3H 2WXLA 1OW0A 1XGUA 5DWUL 5D7IA 5DJZA 4M7JH 2J8OA 4XVJH 1ZV9A 3DSFH 1RAMA 2AQPA 2B1AH 5DK0B 2KQMA 4JO2H 5GGTH 2AABL 3X1BA 5CJ5A 2HTKC 3TWCH 3N55A 3UC0L 2AGJH 3PE9A 5GRVK 1BXXA 3P4LA 4FG6D 2RALA 4L4TA 1JWSA 5LAXA 3OKKA 2F8VA 4UU9B 4M62L 5T3XD 2JCCA 4P2AA 3FHQA 2V7HA 4JG1L 4R90L 1P1VA 1VGKA 2V2TB 4PJ8D 3V4VH 1MCEA 2OXGA 2APFA 4IBYA 2PP8A 2XX0A 4V1DD 2LAAA 5IVXB 1H8OA 1UHVA 3NCMA 5GRVL 3VXME 2UZIL 1XMWA 2X6CA 3LKRA 1RSYA 3GMOB 4MCMA 3VQLA 3S2AA 4GW1A 4FNPA 3MLZL 3G04A 3AW5A 3CZEA 3RIFK 3IJ9A 3RX5A 4FFZH 3W39B 5FO8A 3JWNC 2GJJA 5TDNB 4EIUA 4AE1A 3TZVD 3PABB 3QIUC 4X6BB 3BVTA 5CCGE 3ULSA 4OGZA 3LS4L 1BREA 1L9MA 4M7ZB 1RLWA 3D09A 3S5LG 1CGYA 3EDJA 4KROD 1UXSA 4APQD 1KCRL 4QLWA 5C0EB 1YECH 2Z91A 4JFVA 5F0MB 4LOUC 2P8MA 1WJ3A 4HQQH 2AK4B 5F7NC 4U2YA 2P8PB 3P3SA 4PREA 1QSFD 2AJVH 4AIOA 3HCVA 4UT7H 1IM3B 3WKMH 4G43A 4B95C 3N2JA 3B7TA 1UA6L 3PHQB 4K3JH 4W9IC 1JZIA 1LDPH 1IGTB 2WIIA 4LFHG 4OZFB 5FO2A 5D1ZI 3MLWL 1OQXA 1YMMA 1S9WA 1KYOJ 1GSMA 5GZNC 3L3HB 1YNTB 1G1CA 3IM1A 4P5MB 1CFBA 3ISRA 4A2DA 2DLEA 3EJQA 3O8XB 2H1XA 3QXWA 4ICXA 2WN3A 1VAHA 5GGQL 1A9EB 5K1VA 3UYPB 1DFXA 5F7UA 3F7YB 5JR1L 2C4FU 3MODL 1X4YA 4F3FA 2HT2C 1PL3A 3LZFL 1CICD 4MB1A 1DBBL 4JPQA 5CNHA 5HGHA 2E27H 4HEPA 5LNDA 5ICXB 2G4EA 2C3XA 4ES9A 2BVEA 4HS6A 4IBUA 3EO1B 2Z8VC 3HG1B 3W9DB 4R7LA 3CFKA 1RZJC 3K2UH 4PV8B 1I1YB 3RX7A 3TV3H 4TUUA 1SYSB 5E2WH 1OK0A 3MRDA 3N50A 1E9OB 5EU3A 1PJWA 5HYJE 4M43H 4ZNCD 3CFUA 4FL4C 4YK4C 2NY1C 1ZIAA 3SQOH 2VKWA 3GMPB 5C0DA 4EI5C 5JORB 3GSVA 1R3KB 4FXKA 3KWWA 5EBWA 1M7UA 4UIMB 2XKUA 4GW5B 4OU3A 2EDEA 5EU7C 3MGOA 1USQA 4MD4B 2Z8SA 1J1PH 2RHEA 4LNRB 4YN3A 2PCPA 3B2VL 2GITA 3FBKA 4NQXA 5GGVL 1JZ5A 1I1CA 4M5ZH 1HQRB 4PRDA 1WHPA 4Z7NF 5K9JL 4A6YB 2P46B 2QSQA 5EBMA 3N91A 3EJYC 4AGPA 1J5OL 4LAQL 3QFGA 4G1EA 3T1WA 1QASA 1HIML 4I77L 4OB5L 3TIDA 1U33A 4UT9A 1T0MB 4Y5XC 3REVB 1FRGL 4HUWA 4Y5VB 3BP4B 3EH2A 1NAML 4M9PA 2HX9A 1A7RH 3S3CB 3ETTA 4LSUH 1T4KB 2P26A 2QDWA 2YXVA 2Z31A 4MZ2A 1Q9WB 1OCWL 2IDQA 3KL3A 4HUUB 4JRWA 4L0YA 2FQFA 3QE5A 5K9KA 3QJSB 1BVOA 3ZU8A 1NIDA 3I9GH 4AQAB 5HVHC 4Z3HA 3MV9B 2PR4L 2ITFA 2V17H 4GKLA 1NBZB 2B16A 3FF8A 1F4YL 4CN6A 1W72H 1NBVH 3STZA 1UUSA 1OSYA 2F61A 1E4HA 5DMIH 5A2AA 1X4ZA 4RA3A 1JPST 3CU1A 1XIWA 3GB7A 4BINA 2A9CA 3JYCA 2DEWX 1FZKB 5EZIL 3PGCA 2AMGA 5TQ0H 4ERSL 4HHAA 2F1AA 3W3BA 5I66B 4V11A 3QT2A 5F9JA 3GO1H 1URIA 3A3YB 4NI6A 1XD1A 1F8TL 2Z93A 2NXYD 4HJJH 4B9CA 3L4CA 3QWOA 2QQQA 1CGSL 3CVHL 5AEAA 1DVFD 3T08A 3BKCH 5J13B 1R17A 1IIIA 2UYLA 3K1KC 4NOBA 1JNNL 3ULUE 4QRSB 4HFWA 1ADQH 2ERJC 2BY0A 3JZ7A 4PJHA 4KMLB 2DQHH 5DEZA 2R1YA 1OAKH 1FL3B 5BZDB 1JZ4A 1W16A 2GB2A 3DVNA 2LLLA 4HGWA 4OZIA 1K2DB 4JKPL 2XKNB 4CUCA 3G5YA 3BWZA 3F6LA 3RWJA 1O7SA 4TVPE 4UQ9A 3ZMNA 4HIHA 3QXTA 2VDMH 1SBSL 4Z0XB 3MRLA 2G75A 3EJZD 4WI6A 1OCOB 4UZSA 3TH3T 3ESMA 4BCYA 2QHRL 3U0WH 2OMXB 2UWEA 2JJTA 3A6OA 3F8UB 1BG1A 1OCRB 1LDSA 1KJVB 4RX4D 1N64L 3S5YA 1I4FA 1XGZA 1TETL 4Y16C 1QRNA 3TBWA 1OAYH 3RWGB 5CUSL 4OM1H 2B2XL 5FAAA 4Z7VB 2YJLA 2ZNXA 4KK5C 1AQ8A 5HJGA 1SMOA 1FFPB 2DQCL 2EKJA 1NFDE 3ZE1B 2YGQA 3OR7B 4UOW0 5F71A 3BISA 1RZGA 1IARB 2JQAA 2Q3AA 4M8QB 5E5MB 4HS3B 3U9UA 2FHBA 1KB5L 1MJ8L 3KEHA 1QZNA 1KIPA 3ARSA 1X6NA 1FZOA 2G60H 4OCXH 1P7BA 3WFHB 3WN5C 4PGCA 4EI6A 3QP3A 4GYBA 1CT8B 5IV2A 1PMYA 3HS0B 1A6TA 2EDWA 4HW6A 3WEXB 4WFHE 5GS1B 3WFDL 2XRAL 1T1XA 2JIXA 4KO5A 4AGQA 4FQXA 2HUEA 2Z9TA 3EBIA 3OB8A 4QGYA 2Q7AA 4XPHH 1UM5L 2J2ZA 3B8YA 3L4XA 4QRRA 5IF0B 1GS8A 4ONFL 3WIFB 2G5RA 3L95A 4K8RD 4FNLL 1QVOB 1RJCA 5I6PA 2V8MA 3KXFA 1HYRC 3NJLA 3SGEH 5ERWB 2A9AA 2Q76B 2X12A 3POHA 3QQ9C 3KCWA 3AU1B 5KYNA 4PJGF 1IU1A 3M45A 4NQQA 4MZRA 4U1SA 3GTVA 4Y5YB 4KMTL 1IBDA 5GSVB 4KC3B 2Q5BA 4H20L 1KXTA 3UYRL 2IBBA 3D85D 4LSDA 4HIXH 1IUZA 1Z9SA 4B7LA 4BKSC 4RWYH 2RJMA 3FO0H 3O2DH 4GO8A 3VFUB 4NBXB 4OIIL 3UTPD 5H94A 3BRGC 2WWMC 3LMJH 3AAZA 3KJ6H 5DQDL 3CHSA 1YZZA 5DZLA 4KTEH 4QOKB 2F7RA 3C8DA 2EVHA 1E27B 1SJMA 2DAVA 5BS0E 2BIQA 4XMWA 5AALA 5G5DB 1JPFA 5FKPB 3QI9A 1TFHA 2HTLC 5HHPA 3R7RA 4AT6A 1INDL 4OLWL 5GIRA 1BAGA 1T1ZA 2CRYA 5IHWA 3RP1A 3TT1H 1M53A 5A7EA 4HUCA 2VZVA 2ZKWA 5HTSA 3IAGC 3ZE0E 3GHEL 4AL8L 4YXHL 1M05A 4PGZA 3SDYH 5AZ2L 5DJ8A 3UZEA 1SN2A 1WD8A 4PJAE 4HJ0C 4YGVA 1XXFC 5IBLD 1ID2A 2CLRB 2IADA 3M1BA 4FAAB 4HG4K 2ZXDA 4BFEA 1UWXK 1S9YB 1I8KA 1BEYL 3BUQA 2ZCKH 3MR9A 4W4OA 1IEAB 4JDZA 2IGFL 3T6QC 3HUJE 1MCIA 2X4RA 3K6OA 4FEMA 4R0LA 4UQCA 4YSAA 1CE6B 1L9SA 3ISWA 5AW1B 1AQMA 1PSKH 3DUUA 5H8DA 1XZWA 2VO8A 1EZSA 4U7MA 1OCZB 4HUNB 1TQCC 5HPMA 1OT1A 4F7KA 2J5WA 3HC0A 5EN2A 4NXKA 4ZOBA 4B9FA 1ZHNA 4AI7A 3S96A 1EX0A 3MX0A 4DP9X 2BMKA 2OZ4L 3V52L 2GK0B 4G9DB 2EINB 3L6FA 4UUJB 3EFFA 4ZUTA 4PCSA 3LEVH 2VKXA 2WKOA 3MPCA 4G11A 3I02A 4F58H 4FABH 1YSOA 1U2CA 4BWTA 3GRGA 4NC1C 4ZMZA 5BV7H 1ED3A 3VI4E 2YEZB 2CJUH 3LAFA 1QBML 1N5YH 4E2OA 3VD7A 2ATAA 1E42A 1KG0A 1NBQA 5C70A 1WGVA 1ZE3H 2ATKA 2D3NA 4XVSL 5DHVB 3SE4C 1FIGH 3RVVD 3U25A 4TVSa 5GISH 3CD4A 3JTSB 3VE0B 1HCFX 3HC3L 4OCSL 3EIFA 4GAGH 4ZUSA 5DRNA 4DOHB 2HLEB 3G5VA 3LKOB 3NCEB 4GIAA 1VACA 4F2FA 3TJPA 4U4IA 4URKA 1KTDA 3CLFH 3VQ1C 4HIIB 3GIVB 4OV5B 1L5GA 1NOAA 1RLBA 4AEIL 1UXWA 4G1MA 5AYUL 3BOVA 4P49A 2WSPA 1QYGL 3SQBB 5I73C 1V7NL 3OSKA 4LP5A 3VGAC 1MRFL 3P11L 4RRPA 5AOMA 5GGUA 1WG3A 3L7FB 2R2HB 1KCVL 3IJEA 5FUZH 4MJ6B 2QKIB 1AS8A 3T8MA 3I6LD 4Y2DC 4M1DL 4FG0A 3D48R 3GBNL 1KEML 5H2BB 1A6PA 5E8DL 2ZOLA 1T03L 1M7XA 1H8LA 2BNUB 4L8CB 3CGTA 4Y2OA 5KOVC 1G9ML 4WW1B 2F54D 4K9EC 4ZUWA 5BOPA 3OHXA 3WE6A 4JW3A 2ZJSH 5IK3B 2YD3A 4ANVA 1HEZB 3QZNA 1XF2B 3P02A 1JGLL 4RAVB 4DGVH 2B7DT 2W88A 3HEIB 3C5ZC 4QRPD 4X9BA 1J5DA 4IU3A 1IAOA 1Y07A 2X3BA 3MHZA 5D7KD 1N4XH 2KERA 2PXYB 4GXUM 3JUYA 2JJUA 4MAYB 1D9KC 1RIUH 1I8LC 4IKJA 3O2WH 3LPFA 1P5VB 4XP4L 3EJSA 2B77A 5HYQA 5FYLL 2KL6A 1N0XH 1NIFA 1BLNA 4PLKC 3TCTA 3D30A 2ESVA 1RZFL 4J3OD 5EZJA 5C09B 2CM5A 1YN6A 1ZVSB 2OJZH 2W81C 5BVJA 4K3EH 5LBSH 4NQDD 4XAWL 1RK1A 1SZNA 4YR6B 1IV8A 5EB9A 3GM8A 3SBRA 6CGTA 5JMOC 2VDNL 1CURA 1XD0A 2W9EL 4JAMB 4XNXH 2VABB 4OJFH 4PD4K 1HZLA 3DUSA 1HJCA 1DQMH 1FFOA 4JFPB 2HCZX 3ARDA 3BDYH 4OCWH 3L3GA 4MAZA 3MMEB 3HG4A 4XZUB 3BKJH 5CGYC 5CMAA 1MIEH 4R96A 2KKQA 1RU9H 3CMOL 2RQ8A 4QLRA 5FWRA 2HKAA 3HIZA 1SEQL 2X1OA 3RDJA 5CZKA 1JZGA 4RIRB 2IGTA 1AR2A 4X6CA 1HXYA 1T66C 3RX9A 1QEXA 3SPIA 3ML9A 1L6XA 1KGJA 1AXSA 3LKQA 4JNXA 2BRQA 3UERA 4TNWF 4ZFZB 1DN0A 4IMLB 1C16B 3QHTC 2E4FA 3BGMB 4KDVA 5HY9A 3S35H 3UPAA 3RTQB 1JDDA 5L0QB 1YY9C 1COBA 2Y22A 5FIEA 5FYJD 3QXVA 2BNQB 4NSKB 4GSDL 5D1XE 4BV1A 4JQIA 3BDBA 2EXWC 1LEKB 4JM2B 3TN0C 2WYTA 1WSST 1I1RA 3APDA 2LHAA 4N2EA 4HC1L 4OZFG 3SYCA 5JOEA 3QQ4B 1TMQA 1UOKA 3QCVH 1HQ4B 1I1FB 3BGFB 3IJ8A 3JV6A 5B3SB 4PJBB 4DCQB 3R1GH 4A2EA 1TQTA 1MHHB 4XN8A 2EDTA 4ODUB 2JKTM 4XNQA 4Y2LA 2C1OA 3V4PB 2WBJC 5BUAA 1A4BA 2FIRT 1U3JA 3BQUB 3BEVA 1ORQB 4LEXH 4XVOA 4M1GH 3ALPA 1ASPA 1DVYA 1UYWH 4IMKC 2OXHA 1KZYA 1B6UA 5L2JB 1UEMA 2V2XB 3LRKA 4UF7C 2JIXD 2WZ5A 3CSFA 3T0EB 1OF2A 1X7SA 5KSAB 5D5MB 4KHXH 3FL7A 3FCGA 2CR0A 3D3VB 3PS6A 4GUQA 2ADFL 1OTSC 3H3PH 3QHZL 5I8EB 4HU8A 4CVZB 4FLSA 1D5IH 4RA0C 1S46A 2Q86A 3TO2A 4NO5A 2VDRB 3HNTL 5EEXA 5CXPA 1T21A 4N5EC 3NIFE 3T4AB 4JO8A 4MNQE 4TF4A 5HDLA 2IAAC 5IVXF 3S37X 3U9WA 2J88L 3EOYG 2H32H 2VR6A 4YSUA 3IDJB 3SE9H 4LBEB 2AGJL 4J6RH 1ASQA 5FDWB 2H7WA 5D72L 1I3RB 3IGAA 2YSSB 1I8MA 1NUFA 3WSQH 5KG9A 4NN6B 2YPVH 5D4QA 4KQ0A 5FYKU 3Q2VA 4IGBB 4JPWL 3I75A 4DH2A 4FHJA 2AJ3B 1DQDH 5JQHC 4OCYH 3L3KB 1LVEA 1S78C 1CGWA 1SJHA 3MXWL 3UTSB 5CEXA 3IMBA 2WB7A 3QI9D 2FVNA 4GT0A 5SX4I 3EOTH 2OMUB 1HHGA 3IEAA 4C54A 2XNAA 5B3JF 2ICEB 4BZ1A 4HJGA 1CFNA 2WLKA 1QMUA 3FU7B 1SJVA 5E2TH 4AQ8A 1G6RB 3DMMB 4PB0L 3ATBA 3FH7A 3HN3A 4D7BA 4XCNB 3V4LA 4DVBB 4ZS7H 1ZLWH 1SDDB 2EUVA 1OANA 2WXJA 5CBAA 4AX3A 1HE8A 3AG2B 4F7EA 4JRXB 2M83A 2IBZX 3INUL 2Q6WA 3L1GA 3MYJB 3T71A 2UZYB 5DJDA 3FO9A 1PX4A 2OSLB 1FF5A 1UJ3A 1YNTF 3WTVA 4ODTH 4P4RB 1YECL 4N8CL 3T2PA 2WYZA 3VA2C 2R0KH 1HEJC 1WITA 4CADB 2EZ0C 1TJHH 1ZTXE 2DYPD 2XTSA 3DOHA 1A7NL 3MRIB 4OGAD 5A1AA 3H7BB 4D3CL 3CFJA 2CK0L 4NKOA 4BH7B 3LQMA 3GSRB 4QRUB 3OR6A 4KOBA 2HJFA 4LLVA 4Z6AT 3AY2A 2IH3A 3BWAB 3MRFA 1OL0A 1EBPA 5JDJA 1ONQA 1ZTMA 4P2QD 5CLYA 3VQMA 4GO6B 3EYVA 2R7EB 3SGKA 4X7DC 2F58L 2H0EA 2V3FA 3NN8A 4CN1A 5J7CC 5I19L 1YQ2A 1JPTL 5D55A 3ZZSA 2OKMA 1FFRA 1FORL 4PWKA 4KX9A 3BAEH 3N41B 12E8L 3X3GH 4I0PA 1X5FA 4NHUB 3UG5A 1BLIA 1E4XL 2EC9T 4BK5C 1ZVNA 4XMLH 4YDIL 3QDJB 4MJIA 5DF0A 1EHLH 1WUNT 5L2KE 4GRLB 2C9PA 3ECWA 1ML0A 2FO4B 1JG9A 3LIZH 2E7BA 4MSWA 2GSMB 2QQKH 4ENEC 2DQTL 3DI2B 3QR0A 5K9QI 3C6LB 3FB6A 4A7VA 2BJML 5AOLA 3OLDA 4Z23A 3DGCR 1EAOA 1S7QA 3BFWA 1XQ4A 2IANB 3CFCL 5E8NB 5TDPA 1EEQA 2FATL 3O6MH 4I9WD 4UMSA 4POZD 5KVGE 3ULVL 1ZDQA 4DVRH 3ERXA 3L7EB 4MRBA 5D2NB 4JGNA 4U2ZA 3EG9A 4HKJB 1QTPA 2VDQB 3WLWD 2XIBA 3P77B 4FFYA 2PABA 1ZT7A 4P57A 3Q5OA 4H8WH 5ISZB 4JKLA 1HYSD 4BBWA 1EO7A 5TFSH 3LB6D 1M9WA 4WDIB 3PGFL 1UGNA 1Z9PA 3W56A 1S9XA 3QJRB 5HHME 3BN3B 1Q4NX 2QKSA 4Y1AE 4JVPA 1A9BB 3GGWA 3OJDB 4PJ7E 2PWDA 4UM9D 2XZQL 5C3LD 3L4TA 4IK7A 4FNSA 2HJLA 3EADA 2IH1B 4M8VA 2E7HA 3ASOB 4LLAA 5AKTA 3FQXB 1QLRB 1Z1WA 2XX1A 3BKMH 3HR5A 2CLVB 4J4PD 4HOWA 5CU5A 5CD5D 4XODA 2XWTB 2FTAA 2BRRL 5I6KA 2ESVD 4RQQB 5KYYA 2VZSA 3BXNB 3FCTB 2CKBA 3IDNB 3IDMB 3OKEB 4L8DA 3BSZL 4RAUA 3NAAH 5BW7C 3S3JA 4WHYG 2WB1A 1B2WH 4TTGA 2W92A 3CIQA 3B9VA 5I15H 5FYKL 4ZUVA 3MBEA 1MAJA 3EFOB 1D6EB 1LWRA 3DURA 4YFLI 3UFIA 2BVQB 1JYNA 2DQIL 3RDTA 4P2OD 1INQA 3MJ8B 2D7OA 3OAUH 1ZHKB 4M03A 4OZFH 4OKDA 3CN3A 2FWOA 3QZWB 4YSEA 1F1GA 3LS5H 3UJTL 2Z1KA 3UDWC 5D6CB 1EO8L 1C08B 3VW3H 2B08A 3VD1A 5BJTB 4Z8FH 3WG7B 3M17A 4QD2E 3KYNB 3H56A 2FEDD 3QZLA 4PJDA 4PJ9D 3GO1L 3NSCA 1NMBL 1RZKH 2NW2B 3IPFA 3L9YA 1OB1A 2YBRA 3QXUA 2XA8H 3QUZB 3HLAB 1OD7A 5FLVA 1UKTA 2IVFC 4YDJA 1NAKL 3QNYA 2FCBA 3P4MA 1QEWB 3ZDXF 2VSMB 2Z0UA 2C9QA 4IRSA 4LCWD 1OAKL 1PBYA 3B43A 4H8VA 5AW0B 2V7NB 1JIBA 4YFDB 1U8MA 4EF3A 3HE7A 2HRPH 4LLMA 2WBXA 3OF6A 4H5SB 4JHZA 4F7CA 2ZSVA 1T2JA 3OKNB 1F1DA 5CHNB 3SJVA 4WSJA 2NTFA 4IQHA 4KRPC 4X8GA 5KJ7E 5KW9H 1F3RB 5KSBE 3C5SB 3NCFB 4DGIH 4HAKA 5E9AA 3UTTD 5C71A 5FHAL 3RU8H 3S9DB 2XHNA 3CQPA 2DLFL 3TLRA 2YK1H 5HYSA 5AFAA 1DO6A 5JPMC 2YAQA 1Y6MR 1T3FA 4Z76B 4JLRB 3HPJA 3PCYA 2BVTA 3F5WA 3HI5L 4OM1L 5ESAB 3JV4B 4AGLA 2AV7B 5CF3A 2NX5B 2OTWA 2R1XB 4FQIH 3O3DB 1HOCA 1IEBA 4CKQA 2JXMA 3P2BA 5I8CA 4JFDE 3MSPA 3TL5A 1BWMA 4XPFH 1TSHA 3WNOA 1QFWM 4QJ3B 2EUZA 3NEOA 3NRFA 5AQ0A 4DNLA 5HDOA 4JHWL 2VR4A 3QFDB 2YQ3A 1GZHC 3KG5A 2H47C 4NUJA 3BT2H 3VFPB 5FA3B 4XP5H 1U8IB 2P47B 2FYYA 4KNSA 4G6ML 2PTUA 5HYIA 4AMWA 3GSQA 2UVFA 4WFGD 4HOMA 1MWAB 4JGMA 5JHAA 4W70A 4HGKC 3VXSB 1E90A 1JJUA 4PP2A 5FB8A 5J3HC 2JJVA 3ZZ1A 3RPIB 2VITA 1JERA 4L0ZA 3GI8H 4WI2A 2ZZUT 1AZVA 1HSBB 3B7RL 2QGBA 3BCDA 3MBXH 5E00A 1SY6L 3ZHFA 3INOA 3F7QA 4MS6A 2ZKHH 5ALCL 2DQDL 2YD9A 3U2JA 3KNBA 1P7KA 4G5ZL 1J88A 3ROLB 1WAAA 5GQBA 1WZMA 4K94L 3N0AA 5T1DH 1HAUA 1HCYA 4YHZH 4IBLT 3W37A 3ZY7A 3O6KH 4E5XG 5K59E 1B0WA 1F90H 4WNQA 5F96L 2C3VA 4GBXB 3VI3B 4ZPVB 3WMPA 2WK2A 5KS9E 5K39B 3VGGA 1PG7W 4OTXH 2XOTA 4XPAH 3MV8B 1P84J 1N7ML 1RFDL 1UEYA 3K3QA 4FYRA 2I24N 4X99A 4U0RB 4Y1TA 1NPNA 1FWXA 1F18A 3C75A 5HYEA 1KWGA 2EIZB 2NNCA 1JVOA 1H3UA 2EE2A 5IR1B 4PJIB 4PJXA 3SDCC 2NXZB 3BLKA 1UB6A 2X3CA 3BZ4B 3BPNB 3WJLA 3MLSH 4DEWA 4MYPA 4PVBA 2C5DC 1P5UC 4QRFA 1DE4A 3X12A 3T3PB 2F8IA 4KUCF 1G7JB 1VA9A 1EAPB 3D5OF 4Z7WB 4BSWB 4X7SL 3ZTJG 1CXKA 2D31A 3C9NA 5DU7A 4MFHA 2XQBL 4K4KA 2W1NA 2N01B 1U8QB 3K81A 2R8SH 1XR8A 2CG9X 1ODAA 1I9RH 1Y6KR 4NC2B 2NPLX 3JWOH 5EWIH 4FQ2L 1J9SA 4WO4A 1GHFL 4JDVB 3AG4B 1G4MA 5CEYA 3S7GA 4GEJA 1I8IA 5L4FA 1XF3B 3BIKB 3MA7B 4OQTA 5DGRA 4XBMA 3QWNA 3DO4A 35C8H 1WFUA 4F33A 3LEVL 4EQ2A 5CIPA 3M8OH 4F57H 4LHUA 4MMZA 4X83A 5CJBA 5EA0L 2WXKA 5ANME 2UUDK 5C3TA 4YSCA 5HVFB 4LB8A 1T5XA 1GPOL 1K4DA 4P3DA 1SXZA 1FN4B 1FLRL 1HILB 2NY3D 4PV9A 5IEKA 3DPDA 4I0PD 4IRJD 4HKZA 5HD8D 1M6OB 4N9OB 4DZBB 1OF0A 2YD4A 2OL3B 1EERB 2DW5A 4OR1A 4KZDH 4MJID 4JR9L 4WUUB 3FN3A 5E1QA 3IGLA 1N26A 2HT4D 1JV5A 3FN0L 2FD6L 3ZDZE 4H88H 1H3VA 4PTTB 3ZHNA 3QUXB 1JXGA 3VG9B 1IAIH 5EU5A 4PGBB 3O3AA 4L4VB 1NCWL 1J10A 3GXIA 3NESA 4HK0B 2B14A 2NYKA 4DK5A 5FW6A 1MAMH 1A9VA 3WIHA 5LN4A 3Q9PA 4WHYH 2CGYA 1VGEL 4Q56A 4NUGL 1BF2A 4R8WL 1C12B 3GPSA 1I3VA 3NCCB 4UTAA 2EC9U 4TUJA 1P4BL 4P9MH 3QEQA 5ILTL 4BQBA 3O9WC 1DJZA 3DK2A 5IHBA 1WFIA 1N10A 4MGXA 2GJ6A 1QPKA 5AB1A 3VD3A 4Z78B 1H6FA 2D7NA 4MA7L 2AS5M 4ZDHA 5CJQL 1EJOH 1PEZA 1H5BB 3RWFA 5IWLC 5I6LA 1NCDL 2VE6B 4S1SH 4IJTA 4J3UA 2IDTA 43CAA 3VFWB 4A2MA 1P2CA 5G4OA 2WWOA 4RGNB 5H35A 4MNGA 3K0WA 5TK2A 3SB3A 3SOTA 1I1AB 4O4YH 4XB8A 3C09C 2XQYA 2JELL 4DUXA 4UWQB 3SSGA 1CL7I 3EOBA 4M9OA 3DV6B 3UJJH 2VR7A 3GUTB 3P0YH 1UGKA 3L3JA 1BAWA 3OLGA 1U8LB 1BD2E 5CZVH 1OD9A 4I3SH 4HSAC 3MBED 4PLNC 1JFQL 3VXUA 4GXFA 1B0GA 3FT3A 4JO4L 3FQ4A 3RDTD 2A5UA 2E56A 5BRPA 3QBTB 1GCYA 3L1OH 4E9SA 2EYRB 4G6JL 2AJZA 5I8KH 4A39A 5HYFA 1UM6L 2OJEB 1MCPH 3WTSA 3PQYA 1BVKA 1N0LA 1IGFH 3L1FA 3NFSL 2E9BA 2QZ5A 1MHEA 5DD6B 2NY0B 4W6XB 2I32A 2KLRA 4LLUB 4XNXL 5TE6H 4YLBA 5INCB 4OJFL 1BJMA 2IFGA 3AY4A 3UTPE 4WK2B 1R46A 1DQML 1R24B 4PS8A 2GW5A 1AGFA 2HB0A 1D5BB 3TTSA 1BFSA 2WN2A 3PGDB 3NPSB 4BFBD 1S7WA 4JM2F 5G55A 4FNRA 4PJEA 3GMRB 1ZPUA 4IRSD 4R26L 4UIKH 5DHVH 4ZMPA 4PJBF 3V0VB 4EBQL 2LFGA 3TBYA 4W9DC 4Z7QB 3WUWG 3WNMA 3VTAA 1U95A 1WTLA 2P52A 3BEWB 1FNSL 1O7DE 5BQDA 5D71H 1Z0NA 3AGWA 4U1HB 1IC1A 2P80D 2PMZA 4ZMNA 5HHQA 1ZHLA 4FG6C 3HNVH 5I17A 1V3KA 1CLOH 3DSNB 1OAXH 3D0LA 1XGRB 2H6UA 4JFYB 2K0RA 5FUCC 1M1XA 1J05A 1YEHH 3KPMA 5EO9A 2ZXWB 5F3HA 3RILA 1J0IA 3TURA 1EAQA 4X5WA 5E1IA 2R4SL 3OKDA 1SHWA 3QCVL 3T6XA 5I1GH 4N8VG 4NO0A 5MEQB 1LK2A 2NY5H 1KZQA 4DZ8A 1I8AA 1QA9B 1KXQA 3ABLB 4GQ9H 1PZSA 3FB8A 5C0JA 3FF7A 2C4XA 2J6EL 2EIBA 2IALA 4ODHL 3P54A 4HYTB 4GRWB 3H2WA 4OF6A 4MD0A 2ZWSA 1M56B 2AXWA 4JFFD 1KGUA 4X5QA 4IJ3B 2MPVA 4LCIL 3R8QA 1L9PA 1QACA 1B4RA 1J1OH 1RUQH 4O58L 4AKPA 4A2GA 3Q1SH 1JWSB 2WQAA 4NAMA 3OKKB 4QXWA 3RUGF 3VD0A 2AXHA 3CDFA 4AMKH 5BXFB 2FK9A 2CIIA 2VLJA 4JFEA 5FWQA 3KGSA 2VW6A 1VGKB 2YAMA 3ILQD 1MJUH 1P4UA 3O4OB 3P3RA 3QG6A 4KXBA 1YVLA 3IU4H 1PFOA 1BZQK 1KJMB 1VPOH 3BAJA 3KH3A 1RZJL 2O6EA 2OXGB 4KKBD 3MFGB 4GG6A 3TVMD 1RIHH 3UYOD 4ZX5A 3VFNA 2VISA 4F2MB 1OGAB 1X5LA 3IU3A 4Q6YA 5C0CA 4PFEA 5AVQB 3C2AH 3D4GA 4GW1B 1A6AB 1MHCA 3ZTJH 3K8LA 4PVLA 1KTCA 2OMZB 4EN3B 3TM6A 3DX2A 5E23A 5KEZA 1TIUA 5AVWB 3MLYH 5FO8B 5E08H 4C4UA 5A2IH 5J11C 2C9SA 4GG8A 3WJMB 5F88A 3F58L 5CWSB 4Z0BL 1MREH 4UTCA 4WTZG 2FQDA 4X6DA 1KN4L 2P5EA 4AJ0A 5DUPH 4UZGA 2QLVB 3I6LE 2ARWA 4QI3A 2I9LA 3LXBA 4ELDA 2GI7A 4N8UA 2WMPA 3RWIB 1SFDA 4OLYH 3QDMD 4R2GD 1E3ZA 3ASWA 2EICA 4DGYL 3KYMA 3WDHA 4MJ4A 3U4AA 2P8MB 2F54E 4WSGA 2W9LA 3ZKMC 2ED7A 4PREB 3IMWA 3V5HA 4D9RD 1FLTX 2DBJA 3QUKA 4UT6L 3F05A 1RUPH 5AW2B 5GGRA 2WVVA 4BEIA 2QSCL 4G72B 1P9MA 2WIIB 4QRPE 1MCOL 3LEYH 2K9UA 2GAZA 2PWEA 3FT1A 5DQ9A 3KBEA 4ELMB 5D7KE 4RBPK 1PZ2A 3QAZB 2DM2A 2H26A 1YMMB 3OJMB 3Q6FB 4HWBH 1S9WB 5HHOA 5GS2H 3NIDE 3O3UN 4NO3A 3ILEA 2E6JA 4E9WA 1XGQA 4N86A 1MH5B 4JG9A 1MAKA 1MPAH 2CE6A 3HVDA 3UTZB 1J0HA 2A73B 3WFEH 3NCWA 3RI5K 4OH2A 4NQDE 3C8HA 3HE6D 3P9MA 5CP3A 3BQVA 5C07D 3V4PH 4F3FB 3N41F 3FXIC 1DHKA 3L4UA 4NWUH 3C08L 5MP6L 5K69A 3DO3A 2AANA 2NR6A 3ARGA 3DBSA 2ZWKA 3NVQA 5EOQL 1AQKH 2MOVA 2X9WA 4BH8B 4OLVH 3B9EA 1DJGA 1LP9A 4KH2A 1KLGB 3C6SA 5AD0B 2LQRA 3MRDB 5EU3B 4PJHE 5J8OA 1M57B 4C4KT 5GGTA 2DWTA 3MFFA 1AO7D 1BMGA 3O0RL 3P40A 4IOFD 4X50A 5IGXH 2NY6C 1OE2A 2WANA 3GSVB 4L0PB 3GKWL 3KWWB 5EOCL 5AW9B 4RGNC 5C0BB 5EBWB 4ZXBC 2H1LM 3MGOB 3HPLA 3ESNA 5CLWA 1GGCL 3W5NA 1I7ZB 2PCPB 3EH4B 2R29H 4CC4A 3BP7B 1JZ3A 1NIAA 2YA1A 5FYJE 1ITCA 1AMXA 2A38A 2WWKT 3V4VA 1EHLL 2GBUA 4UQEA 3EHBB 5SWZA 3RURA 2OSYA 2ENSA 1ACCA 4XXCA 2JKSA 1CLZL 2ICCA 2OMVA 2HFGH 4K7PH 4Y88A 1GZQA 4QHUA 1XZ0A 5EN3A 3SE3C 1XGYH 4RLDA 3TEYA 4OGXH 4XR8C 4HUWB 2NXYC 1CG9A 2NLJA 5I2IA 4KZEH 1RD6A 1DVFC 3IXAA 4U1KB 5BOZG 2GJ6D 3IGFA 1TVHA 4MMYB 4FFZA 3JTBA 5I6NA 4ZAKA 2J1WA 4BSVA 5INDA 1NCTA 1ZS8A 3G08B 3QEGL 1IBBA 1JPSH 2XFXA 4HWUA 5B38G 3KZ8A 5EU6A 4GXVH 5K9KB 2ZOOA 4YAQA 1K5NA 2XTJC 4YO0B 1IFHL 5G4MA 1J1XH 3W38A 3ZRFC 4EOWL 4YZFE 4GW4A 2F68X 1G6RH 4KK6C 5I26A 3SGEI 2DQJL 2VDOH 3GI9L 3NG5A 4X0KB 4X2UA 1J87A 1GS6X 2QELA 1KELH 3T1FB 3EJZC 3LQZB 2A83A 1U8PA 3GYRA 5IFHH 1KCUH 1NINA 1XIWB 2FSDA 3U7YH 2QPEB 3ARBB 2WNGA 2AJYH 5C8JA 2APXA 4WI4A 3K74B 3AS2A 1EJFA 1QQDA 2VDKB 3EUDA 3TBCA 1U8KA 3H9SA 3MUUA 1DDTA 1CFTB 1IGCH 1M4KA 3GD1C 5F9JB 3NCYS 3VXMB 5JW4Q 4LZKA 1KACB 3VDCA 4TL4A 5GGSB 4HF5L 4PB9H 1CDYA 3QWOB 3BPCA 3MV7D 3V9CA 3RFZB 3NACH 4ZFGH 3FB5A 2J25A 2QADD 4ZYKB 1A6UL 1IC5H 1LHZA 2E46A 3RE0A 5HXMA 4GMTH 4NQEA 1IC0A 5ADOL 4MRCA 4TNGA 1NCBH 3OAUL 5I0YA 1JCVA 1GC1C 1PQZA 5SX5H 2ENYA 4F7TB 4HGWB 1EXUB 4XT1C 2WY3B 3HRZB 2NY7H 4HIHB 5I75B 1ZLUH 3W0WA 3FT4A 4L9LA 2RACA 4G71B 2YFNA 4LOVA 4TUKH 2UWEB 2XU9A 5HDBF 3SEPA 1KTKE 3UCQA 1NGXB 4G8EA 4N20A 2BXZA 3BVUA 4K8RC 4H26B 2I85A 1I4FB 3PHSA 4IJ3C 3BUYB 1SRDA 1ZPLA 3H0TA 2BHFA 4U1IA 4CVWA 3HMXH 4LPYA 4W9KC 1MZYA 4Q9QH 2WTRB 3QQDB 4OLZH 3ZE2E 3O4LA 2GTWB 4P5TA 1PIFA 1S2EA 1RZGB 3RWHB 1HL4A 4XN4A 1UJTA 4OD2A 2BNRA 1KIPB 3QK0A 4UDUB 1EFQA 2EDYA 4R4ND 2B15A 1ZWIB 2VAJA 1O9WA 4ECNA 1A6TB 4G9FD 4P46B 4DGWC 4HMCA 4JX0A 4HOXA 4XNYL 4BQ6A 3RJOA 4MWFB 2J2ZB 4FQIL 3CNKA 1VFBA 4TYUA 3ZO0A 1W9XA 2A6DB 2VDQH 3CXHK 3T2OA 3KXFB 4M48L 4ZW8A 1AG0A 4M93B 2RH0A 2Q8BL 2NNFA 4NUPA 1OP3H 4A6YL 4FX5A 1IGIH 4G3YH 2CIKB 3GRBA 3BT2L 2AVFA 3ES6B 3LNDA 4P2QE 5HYJB 5IBLC 1N9PA 3HZMB 3K8MA 3ZK0A 5C0IA 5JIDA 3CHXA 3K6DA 4PPTA 1DLHB 1N2RA 3LD8C 2WOBA 4XXDA 1JXFA 4KJYA 3I74A 1UKSA 2ED9A 1W72A 1FUNA 4L3EA 3LVTA 5D1ZB 2WCGA 1FNGB 2KI6A 5H94B 4KQ4H 3VI3F 5JMRA 3D9AH 5JHBA 1NC2B 4YPGA 2IF7A 5AVTB 3TGXA 5I1DA 1YEFH 4X7TA 5LBVA 3QORA 4RMWA 3VWJD 2HFFA 2DDQL 3QCTH 2J73A 4FD0A 5L9DL 1QP1A 4PTUA 5HHPB 1U91A 5D1QA 2D73A 2F53D 2ZP0T 3NZHH 4NS0A 5B8CB 2GEQA 2P3YA 4Y8AA 1V05A 3IETB 3UBFA 3QDGA 3WEOA 4FA8A 1M05B 1CE1L 3OBAA 4ZZFA 1N8ZA 4YHZL 3Q7JA 1YDPB 5ICUA 1JI1A 3JSSA 3WIIH 3O6KL 1ADQA 4ANKA 3IJYB 3HS8A 4YGVB 2V5RA 1RL1A 4I9WE 3KLAA 1QO3A 4MCZB 2EE6A 4EKJA 4HX1A 3BD4A 5IHUL 2FEEI 4K9EL 3RVVC 2Z7WA 4G83A 1XFPA 1RK0B 2E7DA 2NY4C 4JDZB 4N2GA 4TL5A 4Y1SA 2X4RB 5I23A 4MA3A 4YXKL 1NDMA 2NY2B 3DUUB 4EEEA 1T6BX 3SDAA 3FUMA 1XV8A 2B1HH 4PUBL 5HPMB 4PCKA 4LGSB 4XRCA 3HC0B 1ZLSL 2CHXA 4PVNA 1PLBA 2F15A 1DBAL 2MPAH 3FONB 4KOCA 2YXWA 3ECBB 4DKAA 5DVLA 4WF7A 2HYMA 4OW6A 5HHOD 1HKLL 1FDLH 3TX4A 2JKNA 5DRWA 4FXKC 4XBEL 3FTZA 3MRQB 3EFFB 2CDGA 1YNKL 1I9JH 3KCPB 1FYTD 2XZCL 1D5MB 1U2HA 2DKSA 2IOMA 4Z3IA 2ESVE 2ZX7A 3LNFA 4WKXA 4A37A 4TLTA 4YHNA 5JNYA 1X7TA 2O6PA 1AOHA 3PU7A 4P3CH 3K7UA 1KG0B 5I1AA 2XACC 4DQOH 3EO0B 3VXNA 1GOGA 3V6BR 2ATKB 3BAXA 5D8JH 3QUMH 1JGVH 4JN2B 5I1HL 1JRHI 4KXZI 3J7HA 4OIBA 4E9YA 1OSZA 5IB3B 1GIGL 3KPLB 2ITCB 2B59A 5DRNB 1U8NA 4KFMA 4H0IA 2K6YA 5EU4A 5CJ8A 3A4AA 4KTYA 2DI7A 1B4JL 4JHUA 1KB9K 4O51A 4YSDA 1BPLB 2QPUA 1ZOXA 5LB1A 3AADB 1UXWB 4OGYH 2Z31C 4P06A 3DX1A 2JK5B 4R6UA 5C08E 1IT9L 1B3IA 1CLVA 1N6VA 1T7ZA 4F37K 5HI4D 1OB0A 3VB8A 4ADGA 2KZBA 3UIYA 4N2FA 4F8NA 1LQBC 2DJ4A 1DVTA 5F9OL 3VD9A 3HZYA 2JKWA 4NLAA 1OEZW 4TPRH 1OGPA 1YRKA 1MWAH 2ZT9C 3D2UA 3A23A 3STBA 4LCWE 3S5LA 3IJEB 2QPSA 4OD1H 1HL9A 5I5JA 3WFBH 3L4VA 4P2RA 3ZTNH 1HXMA 4IEFB 3K72B 4NM8L 1SFHA 5C0AD 3O2DA 4BELD 3MLVH 2H2SD 4Y4HD 4LSSL 2BCKB 4PY8I 3GLDA 3RGVA 5IMKB 2N56A 4PRIA 4AQOA 3UTTE 1QBLL 3ZT5A 3KPSD 1YYLL 1DTUA 1VCAA 2A9BA 5KVFE 5LDUA 1Z0MA 3AMLA 2QSVA 4NOFA 5LQBH 4XNAA 1T1YB 1MF2H 3VA6A 3HZKB 3RY4A 4ZAKD 1LO3L 3N1QC 1CBJA 4IU3B 4PJFE 1IAOB 2AJUH 1KEGH 5K1NA 1BFVH 5IVOA 1HH9A 1G94A 1K6QH 3IDGB 5TQ2L 4XO9A 3UBXG 5DJAB 3UAJD 1MFAH 1FGVL 1IC4L 4QNPF 1BLNB 3VFGL 3BAIA 1K3ZA 3QUYD 5TPWL 5B1JA 4B41A 4LVNC 4TLUA 3U4BH 5FGCE 1R5WA 1XXDC 4WQOA 4ZMYA 3QHFH 2JJTC 4Q4EA 1XR9B 4UV7H 1BW8A 1J18A 4AQ1C 4WFGE 3HG0A 4PY7B 2GKIA 1GYVA 3IBOA 1W15A 2BOBB 4Z7OE 2X2JA 4WEEA 5EUKA 4F20A 1FE8H 4ZFOA 4GB9A 4H7VA 2X9XA 3DUSB 1AKJD 1FFOB 3ARDB 3P0YL 3L3GB 1DP0A 1BA9A 4W6YB 3UPRB 2NYZA 4R96B 1W91A 4ISVB 4PLOB 3SN6N 2VGLM 4NQED 1HXYB 4LKCB 3SDDA 4FKHA 1P4IL 4RMTA 3SCMD 4PWHA 3I85A 1DN0B 4PJAB 1WIPA 4DEPB 5KVDE 3MGTA 5ANHA 1A6ZA 4FQXC 2XCMC 4NN7C 4MD5A 2JTYA 1ETZB 1CF8L 1M2VA 3UZQB 1A6WL 3H3KA 4U6VL 2FH8A 3HBGA 5F7WC 3WO4C 3NZSA 1HVXA 4X80L 2X7LA 1ACYH 2KZWA 3CVIL 4JG0H 4FTVD 4JFHD 3SY0A 3CV5A 1X5KA 1R3IH 2OL3H 4NHCH 2W0KA 4WW2B 3WTXA 4AVHA 1QFUH 3I2CL 1NCGA 1WBYB 3NH7H 4XNQB 3NIGE 4KXAA 3ULVD 5DZNA 1G7QA 3V6ZA 3BLBA 2BNRD 2DQFA 3ZQXA 3Q43A 1IFGA 3DROA 1CLOL 2GEEA 3ILPB 1OAXL 5E2JA 4A2FA 4RGOL 1FAIL 3RVWD 4G8FB 1QSVA 2EAEA 3VI4B 1D7DA 2ZF9A 4WGWB 4W93A 2VJXA 2ZAIA 1G84A 2OXHB 5AL0A 3UG3A 5I0XA 5FGSA 5EDSA 2ZCHL 5KN5B 4L2YA 4PJGA 1HNYA 4OM0H 3QI9C 1IKNA 5AW6B 3LOWA 1OF2B 4MKTA 4N2IA 3B3BA 5GS3A 3BWUC 4PHZA 5CKGA 2O4EA 2VLRA 4EE2A 4M6MH 3CSBA 4AKQA 3NABL 2X4PA 4OLUL 3L5JA 5K1JA 1A6VL 3FT2A 3U9PL 5KSVB 4HXAL 2MQCA 5BRQA 3FQNA 3NYKA 2Q86B 3BZDA 2CRIA 1BM7A 4G2AA 3B9KB 3DPBA 3K6NA 1W6LA 1BIIA 1YAIA 2HVKA 5ETUA 4TKWA 4W4OC 4HPHA 4NNXA 3AFLA 3AQXA 1GTNA 1S7XB 4R0LC 4F9PA 2FGWL 3DJZA 2XG4A 3Q1SL 2ZOKA 1I8MB 4QMEA 5J1TC 1KPUA 3V95A 5KG9B 4UTBH 3C87A 4A66A 1YPZE 3NFNA 3BVDB 5EZLB 2HLFD 25C8H 5LBSA 3ZKXB 3LZQA 5IB4A 1JHTA 3MYZA 4MJIE 3VX0A 2WQRA 1KMGA 2O6FA 1UKQA 2EDLA 4KI5C 5D1QD 3ZRCC 1RZQA 1MFCL 4OGAC 2LVCA 3HS9A 1GL4B 1R3LB 3ZQ9A 2XNAB 4BFNA 3N44F 5CKAA 1ND0A 3QDGD 4LPVA 4PRPD 1AYRA 1CFNB 2KDYA 2YBGA 2A6KB 1CDGA 2XXMB 4I8DA 2VR5A 3CX2A 3SKNA 4OI8A 1JZFA 1WBXB 2QVTA 3LEXA 1ZLEA 4KV5F 2AK1L 3KYAA 4F7EB 5CBAB 1MSPA 4HVBA 2GSIA 3U6RB 4ELMF 1TZOA 2MWCA 4P4KD 4R4BB 3FO9B 3LPOA 1U8CA 3QYCA 3MREA 5JW4N 2Z6FA 2EUWA 1FA4A 2Y3AA 2APTA 4ZTPH 1TU2A 4IHOB 3WTYA 4K5PA 4XO3A 4FOMA 5DC9B 2NCEA 4MX7A 1N6QL 1PFCA 3C60A 4QF1B 1QFOA 3CFJB 1MVFA 1MI5D 5EO0A 5E6IA 5CEZL 3OR6B 4TUOA 3RHWK 5F89B 2E74C 2VXQL 3L81A 4LLVB 4RWHA 1RY7B 5IUCA 3WGVB 4HWBL 5F1SA 4JZJA 4APXA 1B3JA 1NGZB 2B0SH 2DN7A 3PNWA 4JN1L 1CZ8L 3B6SA 5EUOE 4TSAL 3W2DH 1TJGL 4POZC 4TSCH 4EZJA 1C1EH 3NN8B 2DQ6A 1KNOB 2DF3A 1MPAL 2K78A 2N0KA 3O45A 4G80B 3KPQB 4QTFA 5E4EC 1M1SA 3EAKA 5LJYH 1PKQA 3WLWC 3OHXC 3VUAA 3DIFA 5E2VL 3DV4B 1KIRB 3WFEL 3FQUA 4N28A 4ZMVA 1HYSC 2YPLD 3V4PL 1WAEA 2DD8H 1WVZA 3ZGIA 2ZXGA 5ALBH 1NCOA 3MJ9L 3ARFA 3MLRL 4GRWH 5TE7L 5FO7A 2CALA 3SYAA 4NQCD 4YJZL 2P5WA 3G6JA 5D1XB 4C4KO 1KIQA 3H9ZA 3VFSB 3V0WH 1EFXD 2HFEB 1P7QA 1QFWH 3G9AB 2ZUTA 5CD5C 1RZ8B 4D0BA 1KFAL 2XZAL 3D2UD 5J1AB 3FB6B 2X2UA 2H32A 1CK0L 2EQDA 3VCLA 4CBZA 1VSCA 2OW6A 3QDAA 3CJJA 8PAZA 3RIAF 5IGXL 5JOFA 2YO3A 5I18H 2BIPA 4XZ4A 3WOVA 3EGXB 4OZGE 2WWKO 5DEFB 4JHVA 1P0SE 2XDHA 2VDRL 2C7UA 2CZNA 2L04A 4WWKA 2YPVA 3WKNA 1V7MH 4B7IA 2LU7A 2VMCA 2DI8A 3S88L 3HJEA 5DGQA 2X4TA 5HGAB 4FQHA 3G5ZA 1JGUH 2BC4B 4ZQKB 4BHUA 3BVXA 3ARDC 5JHDD 4P57B 4XCEB 5HI5D 2KPNA 4YBQD 3TPKA 1HDMB 2IG2H 1E8YA 1YQVL 3EXLA 1HCZA 4FQCH 4YH6A 1O5DT 2HFGL 3RKPA 1OAUH 3KW8A 4KTDH 2FEDC 3HI6H 3GBMH 3GGWB 4NRXA 4PJ9C 1HSAB 4RSYA 5ACZA 1CC3A 5GHWL 2HJLB 3OQRA 4JFXA 5K93A 4ELKB 1QR1A 4FFWD 3KPRA 5EF3A 4WEBL 1UA7A 5K33A 1OCCB 2VLKA 3X14A 4YMPA 5JTWA 2YUWA 3NIFB 5EPMB 3U6XS 4MNQB 4WK4B 1QX1A 4L8DB 2CKBB 3O3BB 2QZQA 1G9HA 4UMGA 2BFVH 3VXTA 4JFFE 2VZTA 4RAHA 5T33L 2K8QA 2VW4A 5KVEH 5TH2B 2YA0A 5EZOL 5CN2A 1JS4A 4ZUVB 4X6FA 5F6HI 4MA1C 5DD0H 2IQAB 2X2YA 3VXQB 1NJ9A 5FHBL 1BFOA 1E4WL 1P4LA 2HRHA 2DTSA 3HN8A 5F1IB 5JYLA 3FOMA 3D51A 4G7QB 3OJVC 2AJYL 3O6LH 2PO6D 2X89A 4W81A 5SX5K 1YNLL 5DO2D 4PJDB 3OD3A 5IHZA 4HHWA 3QARA 3RY6A 4PS3A 1EK3A 3SDDD 4JUSA 2ENJA 1LO0L 2ZCLL 3QJQB 5T1LB 5D4IA 3AWEA 1F6AA 3QIWA 4G7SB 3VVVA 3QO0B 4CVXA 5CINL 5BZWB 4GMTL 4RNRA 2DMGA 1UQSA 1U21A 2EDNA 5DS8B 4QCIA 1U8MB 3OKMB 2OMWB 5ADPL 4MJHA 1GRWA 3HI1B 2EVGA 1ZT1B 3VYOA 1R5VA 3M6DA 4PBVC 4F7CB 3IE4A 2L4OA 4HA1A 3BGAA 4H8PA 3SJVB 2QHLA 4YVUA 3QPQD 4YDKH 4XPBL 3QGVA 4HK3J 4ANWA 2DM7A 4LGPB 1UD2A 1VERA 1JGDA 3QDME 4N0UE 5J4MA 5DK0A 3DI3B 3QZMA 1RULL 1QOKA 4HSCX 1S6NA 4IIZA 3GTNA 2NZ1A 2JTDA 4I1PA 1XO8A 3HPJB 1BVNT 3K8KA 3LIZA 1URLA 4D9RE 4HFUH 1NMCB 1EXHA 3OPZL 1MCCA 4ZSOE 4EO5A 4UU9A 2OTWB 4WI3A 5I1JL 2NW3B 1QHQA 4RMQA 1UD8A 4OLZL 3KDMB 4RVBA 4G7VL 2V2TA 3AG3B 2NMSA 3PWNB 2W9DH 5F0LB 1HJBC 1JCKA 1BM3H 1OP9A 4NUJB 5TK4A 3N9GL 4WI8A 5A16B 1MQ8A 3ETBF 4WNSA 1CFVL 4ZUUB 5IVXA 1Y18B 4WFED 3IWVA 2FYYB 2EJ1A 2VLRD 2XPYA 3SKMA 3GSQB 1X7QA 2X0UA 3GMOA 3CZNA 3GPEA 3QNXB 3SPVA 3T65B 4FQPA 5HJDA 4G7RB 2X0WA 4S1QH 1SXSA 4AQ8C 5C07E 4AEEA 3W39A 5AOIA 5TDNA 5I6MA 3DGDA 3PABA 5ID0B 2WLIB 5MEND 1PEWA 2HTKD 5G2NA 1GGYA 4X9IA 5DHXB 1PX3A 3BN9D 3RWDB 3U79A 3KJ4C 1JAEA 5D7LD 3FSOA 2IWKA 3BJ91 4R7VA 5CFHA 1IGIL 1L9RA 4X9FA 2VXVL 1UJ3C 5C0EA 1UM4H 3GWJA 4U1LB 1IAII 3V0IA 1E50A 2CLZB 4LARH 1F2QA 3TA3A 1AO7E 4GI8A 4LCUB 2E5EA 4LRIA 2P8PA 5I0DA 5GJSH 2C3VB 3MRNB 3Q01A 1IM3A 3TO4B 1E3FA 2VDKH 1YEJH 2FRGP 2FL5B 3FFDA 4KQ4L 3PHQA 4WHTB 4XE5B 5PCYA 2EH8H 4OZFA 3PDDA 1L9NA 1U4EA 4X99B 2E9JA 3NPZB 1E7UA 1MFEL 5H37G 3VGDA 1NCAH 1CD1A 3L3HA 1YNTA 3K2KA 1MEXL 3HZ3A 4MBRA 4P5MA 3UTOA 3LZPA 3QRGH 3Q8CA 3QRLA 1RUMH 4PJXB 3CH1B 1MG3C 4QXGL 1C5BL 3QIUD 4NNYA 4MZIA 4Y1AB 5F6HJ 5GGRY 3SGKC 4EIZC 5J6GA 3O8XA 3P69A 5LO7A 2AITA 2VMFA 3E2HB 3UYPA 3M7FB 1NM9A 3F7YA 3DC0A 4XP1L 5AG8A 5E94B 1OT4A 2NY3C 1GJWA 3ZYJA 1EEZB 1WZ1H 4QEGA 1XCQB 4I0PC 5HD8C 2AEQH 2D31B 4K2UH 3TCLB 4LOUD 1L9OA 1SXBA 2E76C 1QTSA 4PYGA 3W9DA 3ULUF 4YSPA 3MOBL 3NJMA 3OSVA 4PV8A 1I1YA 3IAPA 5GS0C 1SYSA 4WO4B 2QVIA 5CEYB 3FHEA 3DWTA 1DQQB 3GSXA 1S9KC 2BX5A 1ZDSA 3GMPA 5GZND 5JORA 1JHKH 1R3KA 4OVUA 3N42F 4PJ8B 3O6FB 1D6VH 4UIMA 1J9TA 4GW5A 3T2LA 5JO5B 4V1DB 4MD4A 1S5IH 4LNRA 2EUXA 1BMWA 1TFPA 4ZZKA 3FHAA 1K4DB 3MV7E 2F5BH 2DBLH 2YUVA 4P3CL 3MUGB 1CI3M 1T6WA 4ICWA 4MDIA 1T0OA 5D8JL 2BWDA 2DOCA 3MCLH 2K6WA 4LP8A 4L37A 5F8RC 3TZVB 1NFDF 2P5WD 3REVA 4Y5VA 1ECYA 4LDCA 1QSED 4J3BA 4F8TA 4IOSA 2BDNH 5DZVA 4WUKH 3MI6A 5KSBB 1E28A 4CGUB 2RQEA 1T4KA 4KROB 4FG4A 4APQB 4FZ8H 3DXAB 1Y7VA 5EU5B 1Q9WA 3AU0A 4HUUA 4MHHG 1WUZA 1DQLH 2G3XA 3LN4B 4POUB 4X7CC 5I0WA 3MV9A 5E0FA 2W0LA 4I3RH 5F9DC 4C8XA 1NBZA 3H53A 4TPRL 5HGGS 1JE6A 3MBEC 4WTQA 3GMNB 1E43A 4Q6IC 5IBTH 4WWKD 4D9LH 3RDTC 5HDQH 5T3XL 4OD1L 4TUJB 4OCMC 8FABB 4JFDB 2BSEA 3P73B 2FBJH 4XCYB 4JM4H 1DVXA 4N0YL 2K6ZA 3TC9A 3EJYD 4UI2A 1L3NA 4CSTA 4Y19D 5I66A 2EKSB 2CHDA 3U0TB 2V2WB 3NP3A 2A74C 1KTBA 4FLOA 3RPKA 1KBKA 2FX7H 1P2CB 4O02L 2G2RB 2HKHL 2J7LA 3EYUL 1KXQE 4G9FE 4U3SB 3T2NL 3ZBMA 2BWIA 2F8OA 1VFMA 3KPRD 4LVHB 1X5YA 1XX9C 2VLKD 5LWYL 3RPBA 1FL3A 5DZPA 4IRSC 5BZDA 3H55A 3QJHB 5KBPA 4M1CD 1CICB 4HD5A 1DLFH 3ULAB 1X3DA 3HE7C 1K2DA 2XKNA 1HC1A 1JBJA 3NDZE 3NFPB 5ECJE 1FFQA 1LO5B 3MRJB 4N1HB 3IWUA 4P48A 1JWUA 4GP4B 5FYLE 2WSKA 3UEZA 2OYKA 3RRQA 2OMXA 3NP4A 2QFPA 2B4CC 3ZE0F 3JXAA 4UV7L 1KJVA 3GHPA 4HLZH 1BVKB 1N0LB