2KI7A

The solution structure of rpp29-rpp21 complex from pyrococcus furiosus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
111
structure length
111
Chain Sequence
QGSYQEIIGRTWIFRGAHRGRVNKKNIVWHELIGLKVRVVNSTHPGYVGIEGYVIDETRNMLVIAGENKVWKVPKDVCIFEFETWDGTKIKISGEKLVGRPEMRLKKRWRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 1
publication title Solution structure of an archaeal RNase P binary protein complex: formation of the 30-kDa complex between Pyrococcus furiosus RPP21 and RPP29 is accompanied by coupled protein folding and highlights critical features for protein-protein and protein-RNA interactions.
pubmed doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
total genus 15
structure length 111
sequence length 111
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 2ki7A00
2KI7A 1PC0A 1OQKA 1V76A 1TSFA 1TS9A 2ZAEA
chains in the Genus database with same CATH superfamily
1D1AA 1QQJA 2CZ6B 1AWXA 4HT9A 4E7SA 2P0PA 2PUOB 1G3SA 1P92A 4VUBA 3VUZA 2AZVA 2JTMA 2F2VA 3UT1A 5FROA 3HP9A 1VA7A 4IUQA 1NPPA 3UDCA 2MIOA 1X6OA 5IXFA 3E9FA 4KGXB 1IGQA 7AT1B 4N4GA 4M75C 3FRNA 2K7AA 1QVFA 4PJOB 4DBQA 2AIRB 2MWPA 4KBMB 1KQ2A 3G6ET 4XTUA 3QSUA 1T3LA 3M0SA 2DL3A 2MPXC 3WXMB 4DBHA 3VKIA 2X51A 3CXCS 1YCSB 4QVDA 4M7AF 2ZGWA 1LJOA 5GAOn 2K6DA 1K4US 1N5ZA 1SEMA 4DEYA 1TTHB 3MEUA 4M77D 4QT7A 4CC3A 4JJCA 2C06A 2JM9A 1PD0A 3CPWS 1JO8A 2K79A 1WHMA 3A8GB 2F2WA 1G5VA 4M7DC 4J83A 2HKNA 1LCKA 4OMOA 1KD1U 2CZ1B 1KD1C 3GF5A 2KVQG 3V8JA 1D3BA 1JJ2S 1W1FA 1PG5B 3EGDA 1OI1A 2D6FA 3I35A 3CCMA 3C12A 5GAN3 4HT8A 3SB2A 2DNUA 3HKSA 4C0ZA 2DXBA 4OMQA 4AFZC 4RTXA 2B8AA 4M75B 3I55A 1VOMA 4DQ2A 2FB7A 4E7ZA 2DEQA 2KY9A 5J3BA 4FSXA 3JCMe 4ZN1A 1C6VX 4OGEA 1VQ8Q 1YWPA 3L42A 2C0TA 3JCMg 2ZPGB 3N5BB 4ESRA 3JCMP 5GJVB 4A4EA 4V2SA 3VS5A 3PFSA 1VQKQ 5KYUB 2MOXA 2YRVA 4F7UE 1HXDA 2LX9A 3LWHA 2V8IA 1KQSA 2RQTA 1VQ4A 1SG5A 4M7DB 4ATOA 3WVDB 1BCMA 4D6WA 4E47A 4XAXB 3Q1JA 1H92A 4PLLA 4IUVA 2Y4XA 4IUUA 4KRTA 2EGAA 1OZ3A 3CMEA 3CCRT 2OX7A 1BU1A 2EKHA 3CCJQ 2HDAA 3VV0A 5IN1A 5CKDA 1QP3A 1NLPC 2HQHA 3ZFJA 1UHFA 4N4IA 2J6FA 1VQOT 4J6XA 4MZTA 5KCOA 3CCSA 4XK8E 3M53A 1SRLA 1ZBXA 2E3HA 1WZOA 3EH2A 2B86A 2DD4A 1IHWA 5D6YA 2HSEB 3M4YA 4C92C 1X01A 1RAFB 1OZ2A 1FX7A 1YITQ 2WSFE 4E6RA 1OX9A 1G2BA 2K4YA 4WCIA 1NYGA 4O5VA 4OMPA 3VU3C 2FYKA 3QBYA 2E65A 2FO0A 2QQSA 1SPKA 2OAWA 1YBYA 2JOYA 2X4JA 4J6YA 4M7AE 1M3AA 3JCMf 4N4HA 3CCVQ 3A8MB 3L2ZA 2KEAA 2ZPFB 1BIAA 4Z8AA 5GANd 1K73C 3QJ6A 2FZKB 4FYXB 1KIKA 3QWYA 3J81E 2XDPA 5EG2A 2JS2A 3OYBA 1B34A 2VV5A 2D8JA 3H9NA 5LJ3d 2KK4A 2QGFB 2BZYA 5GMKh 4C92B 1HYOA 5FU7C 3BDUA 3JCMc 2X4WA 1Q81C 1TXQA 2OAUA 1BI0A 3P8BB 2HQEA 2EYXA 4XU2A 1QCOA 1DJ7B 1WJRA 4PL6A 3JAME 3PVQA 4LE9A 1M9SA 1NM7A 1AOJA 1G3TA 4NS5A 5AYFA 1AWWA 2L2PA 3OW2A 2CKKA 2LX7A 3JRZA 4J9EA 4TVRA 5HCKA 5A0GA 1SRMA 2NUPB 3X26B 2D0NA 1M1KR 2DE0X 2LNVA 4EMKA 1PRLC 2DX1A 1Q86R 2A08A 2G3RA 1YI2T 1YFNA 2ED0A 1GFDA 1MNEA 3PIOA 2COZA 1PCXA 2K57A 2QASA 2WSEE 4JLGA 5GAOl 1N27A 3A8OB 1VQKA 2YRCA 2JN0A 4OB2B 1S72Q 2I2LA 2BTTA 2EYWA 5I2SA 2HL5C 4IKFA 3M0RA 4J9DA 1M2VA 4OVAA 2M51A 5FU7B 1VQLT 1PKTA 3CXCP 2DL4A 3LH5A 4AG2C 3S3MA 2RK1A 1I5LA 3OYAA 2GNCA 3PE0A 1EZZB 1YJ9Q 3CCET 4RTWA 5LJ3h 2DLPA 1G8XA 1OPLA 3OS1A 4Z88A 2E4HA 5LJ5d 4BI8B 2QTXA 5GAOr 2O4XB 1OULA 4FM4B 1FMWA 4JRKA 1E6GA 4MDXA 1O75A 2SEMA 1Q7YU 2CT3A 5HK0A 3CCJA 2NUZA 2YLBA 3OYYA 4C8QF 3M59A 1NLOC 2XIDA 2HQXA 1TUGB 4M77A 1HSQA 4JZ4A 4EIKA 1K0XA 5GMKl 3I5RA 3I9QA 4J7IA 1WXBA 1G83A 1M90U 4KULA 1ARKA 2L3QA 3EFSA 2CSQA 2FG0A 2K3BA 3H8ZA 4L6V5 5IT9E 3FLGA 2EQMA 3OYGA 3CCRQ 3JCMW 3PNWC 1QKXA 5CO7A 3DLMA 4HCBA 1EIFA 1RLPC 4OMNA 3VRYA 2JUFA 1N8RU 4XU3A 4RKUE 1ABOA 3TU4K 4DEXA 4E7KA 3INZA 2DYIA 4YTLA 1H8KA 1X6BA 2VC8A 4OMLA 3CBOA 1D1BA 4RG2A 2KSSA 4A4HA 2QAZA 4PJJA 4XTXA 3RIRA 2DF6A 5D6WA 5FWCA 5ECAA 4BD3A 8ATCB 3U23A 4GY5A 3VS3A 3GLXA 2KNBB 2HL3A 3RR6A 1D3BB 1GCQA 2GQVA 3KUFA 3AHUA 3EGDB 3RMSA 4E7JA 5FU6C 1VQ6A 1M1FA 3M0TA 4XTVA 1VUBA 3EH1A 1OOTA 3QPHA 2YUOA 3G71A 5FRNA 5L23A 3RKXA 3OQ5A 3SWNA 5CKFA 2LRQA 3LGFA 2RB6A 2VVKA 1W6XA 2DRMA 2BIVA 1VQPA 2F5TX 1KQ1A 1AZGB 4MMKA 2DL7A 1VQKT 1IZ6A 2M1HA 1X27A 2YWWA 1BB9A 1AWOA 1KD1R 1S72A 2COYA 4F16A 1N9SA 5CAIA 2XD0A 2RQWA 3AT1B 3FC3A 9ATCB 1JQQA 3CCMQ 4BB7A 2LQWA 4KT0E 1K1ZA 3QIIA 2E5KA 3VJPA 5GJWB 2KDSA 2E6ZA 1WQ7A 2EYQA 4C8QE 3I55Q 3L1AA 4BDZA 4MZMA 3CCJT 1WHLA 2CP2A 2EQKA 1E6HA 5CK9A 2M02A 4PKCC 2L3SA 2R5MA 2JZ2A 2HEQA 2RM4A 1UG1A 2EQJA 2V26A 4F7UG 5GAN6 1BKBA 1FWZA 4QQ6A 2DRKA 2DTOA 2LC4A 3VUBA 1YITT 2XDBA 4C5IA 3E9GA 2GFAA 4C0FA 2KMTA 4Q5WA 2XI9A 1SSHA 3LYIA 1VQ4Q 1BCOA 1BI2A 2DFUA 3RNJA 3SHWA 4FYWB 2ZPIB 5CR2A 3CCLA 1VQMA 1MV0B 2RHIA 4PJOC 1PWTA 3CCVT 2DXCA 1KHCA 2LQ8A 2PUKB 3CMEQ 1M5Q1 1QVGP 5GANj 2CP6A 4FCYA 5KYNA 4LXCA 1AZEA 3C95A 3OSVA 1KG1A 4EMKC 3A8HB 3NHNA 2EW3A 3JB9J 1PSEA 1QW1A 3C0CA 2E10A 3CCSQ 4PNOA 2A0FB 1R0CB 5LJ3j 2O01E 5GAMd 1B34B 2DPPB 1KC8U 2KGTA 1D09B 4PFZA 2OTLA 4X34A 1WHJA 1X2KA 5I2MA 3HFOA 3FJ5A 1I8FA 3CQTA 2CH4W 4JS5A 3CCUA 1N9RA 2IPOB 1Y96B 4OB0B 4ZGEB 3OBYA 2M0OA 3META 2DERA 2W10A 4M7AG 3OYHA 1M2OA 1Z9QA 1MNDA 1ZX6A 5CKEA 1ZLMA 4ZTJA 1NG2A 3G71T 4J7FA 2QA4A 2R58A 3X20B 2PVGB 1M8MA 5KYWA 3EG9A 2BE9B 2QI2A 4BE0A 3KBGA 5EC7A 1K73R 2RHZA 4LD9K 4M78G 2F2XA 1VQPT 3RDVA 1RLQC 1Y07A 4EMKB 3J7AF 2IG0A 5HY6A 2DK3A 2KBTA 3OYMA 4BI3A 3QXEB 2IVWA 1UB4A 2BZXA 1GL5A 1RAEB 3L2UA 1RACB 3EG0A 1S72T 2A7YA 1WYXA 3JCMd 1YJNA 1Q81R 1S1NA 2PNIA 3L2VA 1VQ5A 4M77C 5D6XA 2GCXA 1MMNA 2OTJA 2L8DA 4M78F 1M2VB 2DVJA 4N0AA 1RUWA 4HVVA 1GBQA 2P84A 3EG1A 3I5SA 2DXTA 3GPLA 3M56A 5GAMh 5LJ5j 1YJ9T 1SHFA 4RMOA 1E7OA 3BY7A 1WGSA 2ZPEB 1YJWA 1MHNA 1BYMA 1NZ9A 3C94A 4GLKA 3M58A 3TEEA 4AFUC 2LP5A 4JJNK 1UJ0A 3VYHB 3LWIA 4XTYA 3EGXB 3VS4A 2EYYA 2L0AA 4F7UA 2LTOA 1JRIA 2VGNA 1UFFA 3PT9A 1WJSA 3OMGA 2K3YA 1K8AU 4ME7A 1VQ9Q 2ECZA 2E5QA 3OYCA 2JVVA 1GCPA 2DL8A 1PC0A 2F1LA 2RJCA 2X9HA 4FL6A 3CCQA 4KH1B 2QTVA 2YUQA 5CIUA 4E2FB 5IXBA 2K2VA 2E12A 2GGRA 3OYNA 4RTVA 4WF2A 4ZGJB 1WFWA 4M77B 2EJFA 5HKCA 1MMGA 1MMAA 3CCLT 3SEMA 3QG1A 3E1SA 1GCQC 4BE1A 1JXOA 4QW2A 3JCMh 3OSSC 3CPWA 5A0DA 1X6GA 2RI5A 3MEVA 4JRPA 3TSWA 1YIJQ 1WJQA 2O88A 4DA4A 2VUBA 3CC7A 2QQRA 4RTZA 1JJ2A 1WQWA 4CC4B 3SWNC 2ZPBB 3LW5E 2XK0A 4PJOF 1QCNA 1UEBA 3G1JA 1MGQA 1CKAA 5DLQE 1RAGB 3D7SB 3GP8A 1NEBA 2V1QA 1Y0MA 4ANJA 3HRSA 3HTRA 2WSCE 1Z9ZA 3QHSA 1WXTA 2KRMA 3M9QA 3V7RA 3TVTA 4C5GA 4C8QD 1UTIA 4FYVB 3V7CA 5A2QE 4LD6A 3TSZA 3L2RA 4M7AA 2MI6A 4Z89A 1I5OB 4PFPA 5KE2A 4M75G 4II1A 2VYTA 4HKEA 5GAOm 1EX4A 1K9MU 4IUPA 2AKKA 2HNIA 2QA4T 5IHKA 1YHQA 2RHYA 1Q82U 2K5FA 2ZZDA 3PTAA 4QQGA 1TG0A 4HVWA 4JJBA 3EFOA 4LDXA 4OGCA 1WDXA 3GNFB 4XTZA 2EIFA 3SWNB 2KT8A 4M75F 1U06A 3QJYA 2QK0A 2DXUA 3OW2S 1U8RA 1ABQA 2PTKA 4M78E 4LUDA 3SFMA 3TQ7P 1YJNT 2HZYA 4LDYA 5D7UA 2OTJT 3M4GA 2JTEA 2DIGA 4X9DA 1NEGA 4FT2A 1QVFP 4RUGA 2VGMA 1UECA 3NTIA 2DKGA 1YJWT 3CCMT 1CKBA 2HKQB 3RMQA 3VS0A 3OYEA 2KYBA 4M7DF 3I55T 1VQ6Q 3H41A 1JBMA 2A3LA 5CQYA 1J3TA 1OQKA 2P0QA 4J9HA 5KH6A 3MP6A 1YNZA 2VASA 3NGPA 1PM3A 3FEOA 3DLLA 3G71Q 1PD1A 4IIOA 1I1JA 1TUCA 1TS9A 2X3WD 3CD6A 4OF1A 4PJMA 1ACMB 2R5AA 2QQBA 1OX8A 1VQPQ 2K9GA 3CCQT 2LCSA 1VYTA 2QQAA 5FW9A 5GANe 1CSKA 1VQ9A 3REBB 2D0QB 2F5KA 1NE8A 2GBQA 5HK3A 2EBPA 4RG8A 1VQ4T 1MV3A 5GANg 1QVGS 2MK5A 2FZCB 3I56A 2M16A 2AZSA 4HCZA 2RMOA 4P5NA 3THKA 2O2OA 3UATA 2RJEA 1UUEA 3KFVA 1D0YA 1BBZA 1MMDA 1D0XA 1NPRA 1HK9A 1WLPB 4MZPA 1F1BB 4C8QG 4PJOE 1YN8A 4PFOA 2QEXA 3L2QA 1W2BA 4C5HA 3CMET 1PHTA 2FPEA 4BE2A 1YIJA 3CPFA 5FRMA 2GF7A 2FRWA 5I22A 1UJYA 3RESA 2DEUA 2A28A 2HSPA 2J7IA 3A5ZB 3BDLA 3CCST 1Q7YC 2COWA 3LX7A 3TREA 1ZUUA 5GAMj 4C92G 1AEYA 4BACA 1KQSP 4DBFA 3BW1A 5GAN2 3X25B 2EYZA 4A4GA 4A53A 2DBKA 4ZTFA 1VYUA 4EDUA 4RTUA 1H641 2YDLA 3C4SA 4N0AC 1ZQ1A 3H6ZA 3CMAA 3A1PA 4PK4A 4XQ3A 1WXUA 1QWEA 1Q95G 3VYGA 2RO0A 4C92F 1WNLA 1YHQT 2BUDA 2K3XA 1KK7A 4X1VA 3MPUB 3CCLQ 1VQMQ 3JV3A 4M75E 3F70A 2KXDA 1M90C 3HFNA 4IURA 1YCYA 5LL6S 1PRMC 1YP5A 5C6SA 3M54A 4L5GA 4E7IA 1RI9A 4NL2A 2CGHA 3EG9B 2CYZB 5KYWB 5LJ5e 2QYZA 2YLCA 3MP1A 3NTHA 5GANf 3S6WA 5LJ5g 2Y4YA 1N8RC 1KC8R 3G4SQ 1NJIU 2CP5A 3P8HA 3UA7A 2E70A 1NJIC 3HSBA 1M4ZA 3JCMV 1W4SA 2AHJB 2OTLQ 4RCBA 2CUDA 3OY9A 3PMIA 2J06A 4M7DE 1TOVA 2MYSA 2VKNA 2DAQA 3CCUQ 2E1HA 1B7TA 2EAYA 4EMGA 2CP0A 1M1GA 2VB6A 4XU1A 1C1AA 2QA4Q 4LN2A 3CD6T 3PMTA 2YSQA 5FLXE 4ZGDB 1TUDA 5GAN4 1UGSB 4QVZA 4F7UB 4R55A 1RAHB 4OP0A 1VQ9T 4HVUA 4KGVB 2EKOA 2GFUA 4OB3B 3R6OA 4A4KA 2CS7A 4QVCA 3V8KA 1VQ7Q 2L3RA 1AWJA 1VQNQ 1YJNQ 4M7AD 3QWXX 1M8VA 3L2WA 1VQ5Q 1VIFA 4CRIA 4C8QA 2OTJQ 4XTWA 3VRZA 3UPUA 2YT6A 3RBBB 3LGLA 2RJDA 3OW2P 1Y7XA 2QEXT 2MMPA 1M1KU 4M78D 1QKWA 2KT1A 2E41A 3OA6A 1YIJT 1YJWQ 4UC4A 5LJ5f 3QZ5B 5GMKj 3MO8A 2DZCA 3M57A 1D1CA 3M0PA 3EG2A 3ASKA 1LOJA 2I0NA 3URGA 1T0HA 2Z0WA 1FMVA 2LT1A 3QYGB 2EVRA 2H3EB 4DBRA 1QMCA 1BI1A 1NBEB 4BDYA 3PIPA 2CREA 2D8HA 2JMCA 2ROTA 2JJ9A 4F14A 2PU9B 4C92E 2M9UA 3CCQQ 2PVDB 3UF4A 3BE3A 1BI3A 3CMAT 4BY6C 3WVEB 1G3WA 1ZUYA 1PNJA 4MMLA 2CSIA 4B9XA 1NYFA 4R0KA 1WHKA 1B3QA 2JNGA 2A37A 1M30A 4OMFB 2YUNA 1G3YA 2EJ9A 4JUVA 3P8DA 3UWNA 1SHGA 4HXJA 2VWFA 1K76A 3UA6A 1AD5A 3CC7Q 1SSFA 2KR3A 3J80E 1K9AA 3QKJA 3RUXA 1IB8A 4M4ZA 3EFOB 3S3NA 5GAN5 3X28B 1JB0E 2LJ3A 1Y71A 2EJGA 1YWOA 1QVFS 2KXCA 2AT1B 3FB9A 2DILA 3LH0A 5CVIA 3REAB 4JJDA 4B6MA 2RJFA 2HD0A 3EGUA 3G4SA 1GBRA 4ZN3A 5J26A 2D9TA 2O4XA 4IUTA 2W0ZA 2C0IA 3QDRB 3SD4A 1B07A 1KC8C 3MEWA 3OYJA 4NL3A 4BY6B 3OYLA 2DYBA 1K9MR 4CI0C 1TSFA 4ELZC 3EG3A 3FIFA 1V1CA 1TU0B 1RAIB 2MCNA 1VQ6T 3QZ9B 1C0MA 1YHQQ 4FW2A 2YUPA 1K0SA 3M0UA 1OEBA 4LDUA 4CC7A 3DKMA 1IREB 2EFIA 2O31A 3RKYA 3OYFA 1IHVA 2ZPHB 3OMCA 1U5SA 4M75D 3EFRA 2BE7D 4K11A 2CT4A 2MWOA 2PVOB 2RI2A 2XG8D 2RF0A 1RI0A 2CZ7B 1VQ7A 1VQNA 1X2QA 5GAMe 2CP3A 1R77A 3HL8A 2Y90A 2MF2A 2GTJA 3MKDA 1QLYA 3GIBA 3TCJA 4RCCA 5GAMg 3ULRB 2VXEA 1RABB 1ZSGA 1KQSS 3JB9I 1UGPB 4L59A 1GFCA 2EWNA 4M7DD 1OYXA 1SKUB 2NUTA 1GRIA 1MUZA 2FVUA 3GNGA 2RNAA 1H3HA 3CD6Q 4R56A 2RH2A 1OPKA 2CUBA 1TH7A 2JT4A 3S3OA 3M5AA 1UHCA 2RN8A 4HCCA 3JB9G 2ENMA 1JEGA 4JDSA 5A0LA 1K8AC 4J9CA 2D1XA 1IXDA 2M0YA 3H0IA 1OU9A 1BIBA 1UE9A 1HJDA 4KH0B 1WIEA 1WPYA 2P4RA 3CXCA 3FJPA 3V7SA 1V76A 3I56Q 2CH4A 1PSFA 4PJOG 4AT1B 1AT1B 1U1SA 1VQMT 2RK2A 2FZGB 3JB9F 4KUIA 3NMZC 5KYXA 4KGZB 2ABLA 3SDZA 2QEXQ 3V8LA 2XDDA 4A4FA 1U3OA 4Y28E 1YI2A 4GBQA 2KE9A 2JS0A 2C0OA 1Q7YR 5KE3A 3HRTA 1W70A 2L5QA 2KYMA 3E2UA 3M0QA 3G4ST 3ZBDA 3QDFA 1VQLA 1ZSZA 3EHRA 4OMMA 3CC2A 3MP8A 2OTLT 2XU8A 5GAMf 1M3CA 3CC4A 2F69A 2E6NA 2RQRA 2ROLA 3CCEA 4C8QC 2ZCFB 3CCUT 5KYYA 1KSWA 5CKHA 3CMAQ 5I21A 5FWBA 4BI4A 5DM7R 1M90R 1AHJB 2KROA 3OS5A 1K9MC 2LQNA 2LQKA 2YXYA 4C92D 5GMKi 2DIQA 4M78A 2ATCB 1KJWA 1Q82C 1X69A 4QQDA 2LMJA 5IHIA 2CZ0B 2FEIA 1R0BG 2SRCA 1N8RR 1LNXA 1VIEA 1H3ZA 1I81A 2IIMA 4AG1C 1NJIR 4M77G 1QVPA 5GMKe 1ZA1B 1VQ7T 1VQNT 2P4TA 4M7DG 1IGUA 1KHIA 3BFMA 1VQ5T 3JSCA 2CDTA 1A0NB 3EHQA 3LLRA 2OI3A 4E7LA 3ME9A 1O9SA 2HMAA 4FSSA 4C8QB 2J6OA 2JW4A 1K73U 2WACA 2K5LA 4JRIA 1AVZC 3O5ZA 3QUIA 5IAYA 4M77F 4BUGA 2X35A 1KFZA 5L8RE 1EFNA 3JCMJ 2P0KA 2QDYB 1T0JA 2OJ2A 2RQUA 5I11A 4J5YA 4QKUA 2XMFA 4WTOB 2X3XD 1X75C 5GMKm 2DA9A 4D8KA 1Q81U 2O9SA 5C0MA 2BZ8A 1W2BS 1XJWB 1Y96A 2MAMA 1RADB 2YHTA 3R6NA 1UGQB 3MJXA 5DY9A 3O8VA 1ZUKA 5CCAA 2QG9B 1T3SA 4PLIA 3ZL7C 1M3BA 3GBQA 3H0HA 2K5IA 2FPFA 3VS7A 4PJOA 4J9BA 1VYVA 1QWFA 1FYNA 1X43A 1N6AA 1VQ8A 4C0DC 1WA7A 2DL5A 5CKBA 5LJ3e 3OYKA 2DO3A 3G6EQ 2LCLA 3G7ZA 2X4XA 2HBPA 2QDLA 5GAOp 2LCCA 3HRUA 5CQXA 3ZEHA 1JXMA 3CC7T 1I07A 2RA2A 5LJ3g 3OBWA 4FW1A 4J6WA 4JS4A 2DBMA 1XOVA 3X24B 2KRNA 3DB3A 3T9NA 5GANh 4FU6A 1IO6A 4PJLA 2X4YA 2HCKA 3JCMQ 3CC2T 4X9CA 4JLIA 4LNPA 1OU8A 3CC4T 2YRDA 4KUDK 2LT4A 4C5EA 3OS2A 3CBMA 4AFSC 4RTTA 3RERA 2K2MA 4RTYA 4M75A 2DTHA 3CPWP 1UDLA 2DJQA 3EGXA 1LVKA 3H0FA 3KXTA 2EGCA 1QP2A 2H8HA 1IRXA 4J9FA 4ORZA 1JJ2P 4C0DB 1RAAB 1WX6A 4HA8A 4Y92A 4Y91A 2KAFA 2L3PA 3OB9A 1HD3A 4XU0A 1V29B 4CC2A 3HPWA 3CBPA 1QVGA 2DETA 1M27C 4HCKA 3IQLA 3RKWA 5KYUA 3MHXA 5AT1B 2A36A 4ELYC 3QO3A 3VS2A 1XQHA 1LPLA 2L89A 3A98A 1YITA 5GAOq 1WHGA 4M7DA 2HBWA 3HHTB 2RI3A 2H3JA 3QYHB 1ZA2B 5J39A 4AFQC 3M55A 2R57A 5KCHA 4M77E 4B9WA 2EGEA 2DD5A 2LZ6B 4NOYA 2RD1A 3VS6A 4JPBW 5LJ3f 2NYSA 3CCVA 3OYDA 4O6JA 1Y57A 1JU5C 2DJZA 1RL2A 2V8KA 4E7HA 4EPCA 1TWBA 2V1RA 1WHHA 2DVEA 2J6KA 1I0CA 4AMCA 3PVLA 5LJ5h 1VQOQ 2AKLA 2NWMA 1R8OB 8AT1B 3JB9H 4EMHA 4F17A 4FIBA 2LJ1A 3NTKA 3MCAB 4LDVA 1UGVA 2NUTB 2FHDA 2E64A 2FL7A 4GLMA 4JZ3A 1U1TA 1ZSZC 4J9GA 4PJNA 1BK2A 2AK5A 4FYYB 2QQ9A 2J05A 2RPNA 2DMOA 2RHXA 2EQUA 2XICA 4LDWA 2JTFA 1VQ8T 3I56T 2PQWA 4M7AC 3VS1A 2BKDN 2DTIA 1SF9A 1I4K1 1UGRB 1GXIE 5GAN8 2ED1A 3EAEA 3G6EA 4D8DA 2EQIA 3DB4A 1M1KC 2GQIA 5KYXB 2CP7A 4M78C 4ZNXA 2G6FX 1Q86U 1ZBJA 4A54A 2V8JA 3E19A 1Q86C 3ER0A 1XNIA 3JCMb 4C92A 5IHNA 3OYIA 3A8LB 2LNHB 3FDRA 3MEAA 1XTDA 4J9IA 5DLOA 2LJ0A 1K8AR 4LUEA 1ZSZB 1FMKA 2QGGA 1YJ9A 2DZ9A 5FU6B 4DOVA 2JXBA 1W2BP 2EPDA 2ESWA 2ZAEA 2GTOA 5GAN7 3OS0A 2NUPA 1ZHIA 3CEYA 3JCMX 4M7AB 4A63B 5KYYB 2E3IA 4DOWA 4IIMA 2KRSA 2VXFA 1QCFA 4C0GA 1YI2Q 3JB9D 1WI7A 4M78B 2LDMA 1D0ZA 4FT4A 2JM8A 1PKSA 4OB1B 2DM1A 4F04B 5IH2A 3GOXA 1OV3A 4J8OA 2JMAA 2FRYA 4MDWA 1VQLQ 2O9VA 3CC2Q 2HAXA 2XKOC 2QXFA 4PJOD 4F7UF 2KI7A 3CC4Q 2RQVA 2LVMA 4Z02A 3CCEQ 3PGGA 2FPDA 3CCRA 2KQWA 5M9OA 1FXXA 4JRQA 3NPFA 2NLUA 6AT1B 2RHUA 1Q82R 2XHCA 1VQOA 3NFCA 2PZ1A
chains in the Genus database with same CATH topology
2KI7A 1PC0A 1OQKA 1V76A 1TSFA 1TS9A 2ZAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI7 A;  1PC0 A;  1OQK A;  1V76 A;  1TSF A;  1TS9 A;  2ZAE A; 
#chains in the Genus database with same CATH topology
 1D1A A;  1QQJ A;  2CZ6 B;  1AWX A;  4HT9 A;  4E7S A;  2P0P A;  2PUO B;  1G3S A;  1P92 A;  4VUB A;  3VUZ A;  2AZV A;  2JTM A;  2F2V A;  3UT1 A;  5FRO A;  3HP9 A;  1VA7 A;  4IUQ A;  1NPP A;  3UDC A;  2MIO A;  1X6O A;  5IXF A;  3E9F A;  4KGX B;  1IGQ A;  7AT1 B;  4N4G A;  4M75 C;  3FRN A;  2K7A A;  1QVF A;  4PJO B;  4DBQ A;  2AIR B;  2MWP A;  4KBM B;  1KQ2 A;  3G6E T;  4XTU A;  3QSU A;  1T3L A;  3M0S A;  2DL3 A;  2MPX C;  3WXM B;  4DBH A;  3VKI A;  2X51 A;  3CXC S;  1YCS B;  4QVD A;  4M7A F;  2ZGW A;  1LJO A;  5GAO n;  2K6D A;  1K4U S;  1N5Z A;  1SEM A;  4DEY A;  1TTH B;  3MEU A;  4M77 D;  4QT7 A;  4CC3 A;  4JJC A;  2C06 A;  2JM9 A;  1PD0 A;  3CPW S;  1JO8 A;  2K79 A;  1WHM A;  3A8G B;  2F2W A;  1G5V A;  4M7D C;  4J83 A;  2HKN A;  1LCK A;  4OMO A;  1KD1 U;  2CZ1 B;  1KD1 C;  3GF5 A;  2KVQ G;  3V8J A;  1D3B A;  1JJ2 S;  1W1F A;  1PG5 B;  3EGD A;  1OI1 A;  2D6F A;  3I35 A;  3CCM A;  3C12 A;  5GAN 3;  4HT8 A;  3SB2 A;  2DNU A;  3HKS A;  4C0Z A;  2DXB A;  4OMQ A;  4AFZ C;  4RTX A;  2B8A A;  4M75 B;  3I55 A;  1VOM A;  4DQ2 A;  2FB7 A;  4E7Z A;  2DEQ A;  2KY9 A;  5J3B A;  4FSX A;  3JCM e;  4ZN1 A;  1C6V X;  4OGE A;  1VQ8 Q;  1YWP A;  3L42 A;  2C0T A;  3JCM g;  2ZPG B;  3N5B B;  4ESR A;  3JCM P;  5GJV B;  4A4E A;  4V2S A;  3VS5 A;  3PFS A;  1VQK Q;  5KYU B;  2MOX A;  2YRV A;  4F7U E;  1HXD A;  2LX9 A;  3LWH A;  2V8I A;  1KQS A;  2RQT A;  1VQ4 A;  1SG5 A;  4M7D B;  4ATO A;  3WVD B;  1BCM A;  4D6W A;  4E47 A;  4XAX B;  3Q1J A;  1H92 A;  4PLL A;  4IUV A;  2Y4X A;  4IUU A;  4KRT A;  2EGA A;  1OZ3 A;  3CME A;  3CCR T;  2OX7 A;  1BU1 A;  2EKH A;  3CCJ Q;  2HDA A;  3VV0 A;  5IN1 A;  5CKD A;  1QP3 A;  1NLP C;  2HQH A;  3ZFJ A;  1UHF A;  4N4I A;  2J6F A;  1VQO T;  4J6X A;  4MZT A;  5KCO A;  3CCS A;  4XK8 E;  3M53 A;  1SRL A;  1ZBX A;  2E3H A;  1WZO A;  3EH2 A;  2B86 A;  2DD4 A;  1IHW A;  5D6Y A;  2HSE B;  3M4Y A;  4C92 C;  1X01 A;  1RAF B;  1OZ2 A;  1FX7 A;  1YIT Q;  2WSF E;  4E6R A;  1OX9 A;  1G2B A;  2K4Y A;  4WCI A;  1NYG A;  4O5V A;  4OMP A;  3VU3 C;  2FYK A;  3QBY A;  2E65 A;  2FO0 A;  2QQS A;  1SPK A;  2OAW A;  1YBY A;  2JOY A;  2X4J A;  4J6Y A;  4M7A E;  1M3A A;  3JCM f;  4N4H A;  3CCV Q;  3A8M B;  3L2Z A;  2KEA A;  2ZPF B;  1BIA A;  4Z8A A;  5GAN d;  1K73 C;  3QJ6 A;  2FZK B;  4FYX B;  1KIK A;  3QWY A;  3J81 E;  2XDP A;  5EG2 A;  2JS2 A;  3OYB A;  1B34 A;  2VV5 A;  2D8J A;  3H9N A;  5LJ3 d;  2KK4 A;  2QGF B;  2BZY A;  5GMK h;  4C92 B;  1HYO A;  5FU7 C;  3BDU A;  3JCM c;  2X4W A;  1Q81 C;  1TXQ A;  2OAU A;  1BI0 A;  3P8B B;  2HQE A;  2EYX A;  4XU2 A;  1QCO A;  1DJ7 B;  1WJR A;  4PL6 A;  3JAM E;  3PVQ A;  4LE9 A;  1M9S A;  1NM7 A;  1AOJ A;  1G3T A;  4NS5 A;  5AYF A;  1AWW A;  2L2P A;  3OW2 A;  2CKK A;  2LX7 A;  3JRZ A;  4J9E A;  4TVR A;  5HCK A;  5A0G A;  1SRM A;  2NUP B;  3X26 B;  2D0N A;  1M1K R;  2DE0 X;  2LNV A;  4EMK A;  1PRL C;  2DX1 A;  1Q86 R;  2A08 A;  2G3R A;  1YI2 T;  1YFN A;  2ED0 A;  1GFD A;  1MNE A;  3PIO A;  2COZ A;  1PCX A;  2K57 A;  2QAS A;  2WSE E;  4JLG A;  5GAO l;  1N27 A;  3A8O B;  1VQK A;  2YRC A;  2JN0 A;  4OB2 B;  1S72 Q;  2I2L A;  2BTT A;  2EYW A;  5I2S A;  2HL5 C;  4IKF A;  3M0R A;  4J9D A;  1M2V A;  4OVA A;  2M51 A;  5FU7 B;  1VQL T;  1PKT A;  3CXC P;  2DL4 A;  3LH5 A;  4AG2 C;  3S3M A;  2RK1 A;  1I5L A;  3OYA A;  2GNC A;  3PE0 A;  1EZZ B;  1YJ9 Q;  3CCE T;  4RTW A;  5LJ3 h;  2DLP A;  1G8X A;  1OPL A;  3OS1 A;  4Z88 A;  2E4H A;  5LJ5 d;  4BI8 B;  2QTX A;  5GAO r;  2O4X B;  1OUL A;  4FM4 B;  1FMW A;  4JRK A;  1E6G A;  4MDX A;  1O75 A;  2SEM A;  1Q7Y U;  2CT3 A;  5HK0 A;  3CCJ A;  2NUZ A;  2YLB A;  3OYY A;  4C8Q F;  3M59 A;  1NLO C;  2XID A;  2HQX A;  1TUG B;  4M77 A;  1HSQ A;  4JZ4 A;  4EIK A;  1K0X A;  5GMK l;  3I5R A;  3I9Q A;  4J7I A;  1WXB A;  1G83 A;  1M90 U;  4KUL A;  1ARK A;  2L3Q A;  3EFS A;  2CSQ A;  2FG0 A;  2K3B A;  3H8Z A;  4L6V 5;  5IT9 E;  3FLG A;  2EQM A;  3OYG A;  3CCR Q;  3JCM W;  3PNW C;  1QKX A;  5CO7 A;  3DLM A;  4HCB A;  1EIF A;  1RLP C;  4OMN A;  3VRY A;  2JUF A;  1N8R U;  4XU3 A;  4RKU E;  1ABO A;  3TU4 K;  4DEX A;  4E7K A;  3INZ A;  2DYI A;  4YTL A;  1H8K A;  1X6B A;  2VC8 A;  4OML A;  3CBO A;  1D1B A;  4RG2 A;  2KSS A;  4A4H A;  2QAZ A;  4PJJ A;  4XTX A;  3RIR A;  2DF6 A;  5D6W A;  5FWC A;  5ECA A;  4BD3 A;  8ATC B;  3U23 A;  4GY5 A;  3VS3 A;  3GLX A;  2KNB B;  2HL3 A;  3RR6 A;  1D3B B;  1GCQ A;  2GQV A;  3KUF A;  3AHU A;  3EGD B;  3RMS A;  4E7J A;  5FU6 C;  1VQ6 A;  1M1F A;  3M0T A;  4XTV A;  1VUB A;  3EH1 A;  1OOT A;  3QPH A;  2YUO A;  3G71 A;  5FRN A;  5L23 A;  3RKX A;  3OQ5 A;  3SWN A;  5CKF A;  2LRQ A;  3LGF A;  2RB6 A;  2VVK A;  1W6X A;  2DRM A;  2BIV A;  1VQP A;  2F5T X;  1KQ1 A;  1AZG B;  4MMK A;  2DL7 A;  1VQK T;  1IZ6 A;  2M1H A;  1X27 A;  2YWW A;  1BB9 A;  1AWO A;  1KD1 R;  1S72 A;  2COY A;  4F16 A;  1N9S A;  5CAI A;  2XD0 A;  2RQW A;  3AT1 B;  3FC3 A;  9ATC B;  1JQQ A;  3CCM Q;  4BB7 A;  2LQW A;  4KT0 E;  1K1Z A;  3QII A;  2E5K A;  3VJP A;  5GJW B;  2KDS A;  2E6Z A;  1WQ7 A;  2EYQ A;  4C8Q E;  3I55 Q;  3L1A A;  4BDZ A;  4MZM A;  3CCJ T;  1WHL A;  2CP2 A;  2EQK A;  1E6H A;  5CK9 A;  2M02 A;  4PKC C;  2L3S A;  2R5M A;  2JZ2 A;  2HEQ A;  2RM4 A;  1UG1 A;  2EQJ A;  2V26 A;  4F7U G;  5GAN 6;  1BKB A;  1FWZ A;  4QQ6 A;  2DRK A;  2DTO A;  2LC4 A;  3VUB A;  1YIT T;  2XDB A;  4C5I A;  3E9G A;  2GFA A;  4C0F A;  2KMT A;  4Q5W A;  2XI9 A;  1SSH A;  3LYI A;  1VQ4 Q;  1BCO A;  1BI2 A;  2DFU A;  3RNJ A;  3SHW A;  4FYW B;  2ZPI B;  5CR2 A;  3CCL A;  1VQM A;  1MV0 B;  2RHI A;  4PJO C;  1PWT A;  3CCV T;  2DXC A;  1KHC A;  2LQ8 A;  2PUK B;  3CME Q;  1M5Q 1;  1QVG P;  5GAN j;  2CP6 A;  4FCY A;  5KYN A;  4LXC A;  1AZE A;  3C95 A;  3OSV A;  1KG1 A;  4EMK C;  3A8H B;  3NHN A;  2EW3 A;  3JB9 J;  1PSE A;  1QW1 A;  3C0C A;  2E10 A;  3CCS Q;  4PNO A;  2A0F B;  1R0C B;  5LJ3 j;  2O01 E;  5GAM d;  1B34 B;  2DPP B;  1KC8 U;  2KGT A;  1D09 B;  4PFZ A;  2OTL A;  4X34 A;  1WHJ A;  1X2K A;  5I2M A;  3HFO A;  3FJ5 A;  1I8F A;  3CQT A;  2CH4 W;  4JS5 A;  3CCU A;  1N9R A;  2IPO B;  1Y96 B;  4OB0 B;  4ZGE B;  3OBY A;  2M0O A;  3MET A;  2DER A;  2W10 A;  4M7A G;  3OYH A;  1M2O A;  1Z9Q A;  1MND A;  1ZX6 A;  5CKE A;  1ZLM A;  4ZTJ A;  1NG2 A;  3G71 T;  4J7F A;  2QA4 A;  2R58 A;  3X20 B;  2PVG B;  1M8M A;  5KYW A;  3EG9 A;  2BE9 B;  2QI2 A;  4BE0 A;  3KBG A;  5EC7 A;  1K73 R;  2RHZ A;  4LD9 K;  4M78 G;  2F2X A;  1VQP T;  3RDV A;  1RLQ C;  1Y07 A;  4EMK B;  3J7A F;  2IG0 A;  5HY6 A;  2DK3 A;  2KBT A;  3OYM A;  4BI3 A;  3QXE B;  2IVW A;  1UB4 A;  2BZX A;  1GL5 A;  1RAE B;  3L2U A;  1RAC B;  3EG0 A;  1S72 T;  2A7Y A;  1WYX A;  3JCM d;  1YJN A;  1Q81 R;  1S1N A;  2PNI A;  3L2V A;  1VQ5 A;  4M77 C;  5D6X A;  2GCX A;  1MMN A;  2OTJ A;  2L8D A;  4M78 F;  1M2V B;  2DVJ A;  4N0A A;  1RUW A;  4HVV A;  1GBQ A;  2P84 A;  3EG1 A;  3I5S A;  2DXT A;  3GPL A;  3M56 A;  5GAM h;  5LJ5 j;  1YJ9 T;  1SHF A;  4RMO A;  1E7O A;  3BY7 A;  1WGS A;  2ZPE B;  1YJW A;  1MHN A;  1BYM A;  1NZ9 A;  3C94 A;  4GLK A;  3M58 A;  3TEE A;  4AFU C;  2LP5 A;  4JJN K;  1UJ0 A;  3VYH B;  3LWI A;  4XTY A;  3EGX B;  3VS4 A;  2EYY A;  2L0A A;  4F7U A;  2LTO A;  1JRI A;  2VGN A;  1UFF A;  3PT9 A;  1WJS A;  3OMG A;  2K3Y A;  1K8A U;  4ME7 A;  1VQ9 Q;  2ECZ A;  2E5Q A;  3OYC A;  2JVV A;  1GCP A;  2DL8 A;  1PC0 A;  2F1L A;  2RJC A;  2X9H A;  4FL6 A;  3CCQ A;  4KH1 B;  2QTV A;  2YUQ A;  5CIU A;  4E2F B;  5IXB A;  2K2V A;  2E12 A;  2GGR A;  3OYN A;  4RTV A;  4WF2 A;  4ZGJ B;  1WFW A;  4M77 B;  2EJF A;  5HKC A;  1MMG A;  1MMA A;  3CCL T;  3SEM A;  3QG1 A;  3E1S A;  1GCQ C;  4BE1 A;  1JXO A;  4QW2 A;  3JCM h;  3OSS C;  3CPW A;  5A0D A;  1X6G A;  2RI5 A;  3MEV A;  4JRP A;  3TSW A;  1YIJ Q;  1WJQ A;  2O88 A;  4DA4 A;  2VUB A;  3CC7 A;  2QQR A;  4RTZ A;  1JJ2 A;  1WQW A;  4CC4 B;  3SWN C;  2ZPB B;  3LW5 E;  2XK0 A;  4PJO F;  1QCN A;  1UEB A;  3G1J A;  1MGQ A;  1CKA A;  5DLQ E;  1RAG B;  3D7S B;  3GP8 A;  1NEB A;  2V1Q A;  1Y0M A;  4ANJ A;  3HRS A;  3HTR A;  2WSC E;  1Z9Z A;  3QHS A;  1WXT A;  2KRM A;  3M9Q A;  3V7R A;  3TVT A;  4C5G A;  4C8Q D;  1UTI A;  4FYV B;  3V7C A;  5A2Q E;  4LD6 A;  3TSZ A;  3L2R A;  4M7A A;  2MI6 A;  4Z89 A;  1I5O B;  4PFP A;  5KE2 A;  4M75 G;  4II1 A;  2VYT A;  4HKE A;  5GAO m;  1EX4 A;  1K9M U;  4IUP A;  2AKK A;  2HNI A;  2QA4 T;  5IHK A;  1YHQ A;  2RHY A;  1Q82 U;  2K5F A;  2ZZD A;  3PTA A;  4QQG A;  1TG0 A;  4HVW A;  4JJB A;  3EFO A;  4LDX A;  4OGC A;  1WDX A;  3GNF B;  4XTZ A;  2EIF A;  3SWN B;  2KT8 A;  4M75 F;  1U06 A;  3QJY A;  2QK0 A;  2DXU A;  3OW2 S;  1U8R A;  1ABQ A;  2PTK A;  4M78 E;  4LUD A;  3SFM A;  3TQ7 P;  1YJN T;  2HZY A;  4LDY A;  5D7U A;  2OTJ T;  3M4G A;  2JTE A;  2DIG A;  4X9D A;  1NEG A;  4FT2 A;  1QVF P;  4RUG A;  2VGM A;  1UEC A;  3NTI A;  2DKG A;  1YJW T;  3CCM T;  1CKB A;  2HKQ B;  3RMQ A;  3VS0 A;  3OYE A;  2KYB A;  4M7D F;  3I55 T;  1VQ6 Q;  3H41 A;  1JBM A;  2A3L A;  5CQY A;  1J3T A;  1OQK A;  2P0Q A;  4J9H A;  5KH6 A;  3MP6 A;  1YNZ A;  2VAS A;  3NGP A;  1PM3 A;  3FEO A;  3DLL A;  3G71 Q;  1PD1 A;  4IIO A;  1I1J A;  1TUC A;  1TS9 A;  2X3W D;  3CD6 A;  4OF1 A;  4PJM A;  1ACM B;  2R5A A;  2QQB A;  1OX8 A;  1VQP Q;  2K9G A;  3CCQ T;  2LCS A;  1VYT A;  2QQA A;  5FW9 A;  5GAN e;  1CSK A;  1VQ9 A;  3REB B;  2D0Q B;  2F5K A;  1NE8 A;  2GBQ A;  5HK3 A;  2EBP A;  4RG8 A;  1VQ4 T;  1MV3 A;  5GAN g;  1QVG S;  2MK5 A;  2FZC B;  3I56 A;  2M16 A;  2AZS A;  4HCZ A;  2RMO A;  4P5N A;  3THK A;  2O2O A;  3UAT A;  2RJE A;  1UUE A;  3KFV A;  1D0Y A;  1BBZ A;  1MMD A;  1D0X A;  1NPR A;  1HK9 A;  1WLP B;  4MZP A;  1F1B B;  4C8Q G;  4PJO E;  1YN8 A;  4PFO A;  2QEX A;  3L2Q A;  1W2B A;  4C5H A;  3CME T;  1PHT A;  2FPE A;  4BE2 A;  1YIJ A;  3CPF A;  5FRM A;  2GF7 A;  2FRW A;  5I22 A;  1UJY A;  3RES A;  2DEU A;  2A28 A;  2HSP A;  2J7I A;  3A5Z B;  3BDL A;  3CCS T;  1Q7Y C;  2COW A;  3LX7 A;  3TRE A;  1ZUU A;  5GAM j;  4C92 G;  1AEY A;  4BAC A;  1KQS P;  4DBF A;  3BW1 A;  5GAN 2;  3X25 B;  2EYZ A;  4A4G A;  4A53 A;  2DBK A;  4ZTF A;  1VYU A;  4EDU A;  4RTU A;  1H64 1;  2YDL A;  3C4S A;  4N0A C;  1ZQ1 A;  3H6Z A;  3CMA A;  3A1P A;  4PK4 A;  4XQ3 A;  1WXU A;  1QWE A;  1Q95 G;  3VYG A;  2RO0 A;  4C92 F;  1WNL A;  1YHQ T;  2BUD A;  2K3X A;  1KK7 A;  4X1V A;  3MPU B;  3CCL Q;  1VQM Q;  3JV3 A;  4M75 E;  3F70 A;  2KXD A;  1M90 C;  3HFN A;  4IUR A;  1YCY A;  5LL6 S;  1PRM C;  1YP5 A;  5C6S A;  3M54 A;  4L5G A;  4E7I A;  1RI9 A;  4NL2 A;  2CGH A;  3EG9 B;  2CYZ B;  5KYW B;  5LJ5 e;  2QYZ A;  2YLC A;  3MP1 A;  3NTH A;  5GAN f;  3S6W A;  5LJ5 g;  2Y4Y A;  1N8R C;  1KC8 R;  3G4S Q;  1NJI U;  2CP5 A;  3P8H A;  3UA7 A;  2E70 A;  1NJI C;  3HSB A;  1M4Z A;  3JCM V;  1W4S A;  2AHJ B;  2OTL Q;  4RCB A;  2CUD A;  3OY9 A;  3PMI A;  2J06 A;  4M7D E;  1TOV A;  2MYS A;  2VKN A;  2DAQ A;  3CCU Q;  2E1H A;  1B7T A;  2EAY A;  4EMG A;  2CP0 A;  1M1G A;  2VB6 A;  4XU1 A;  1C1A A;  2QA4 Q;  4LN2 A;  3CD6 T;  3PMT A;  2YSQ A;  5FLX E;  4ZGD B;  1TUD A;  5GAN 4;  1UGS B;  4QVZ A;  4F7U B;  4R55 A;  1RAH B;  4OP0 A;  1VQ9 T;  4HVU A;  4KGV B;  2EKO A;  2GFU A;  4OB3 B;  3R6O A;  4A4K A;  2CS7 A;  4QVC A;  3V8K A;  1VQ7 Q;  2L3R A;  1AWJ A;  1VQN Q;  1YJN Q;  4M7A D;  3QWX X;  1M8V A;  3L2W A;  1VQ5 Q;  1VIF A;  4CRI A;  4C8Q A;  2OTJ Q;  4XTW A;  3VRZ A;  3UPU A;  2YT6 A;  3RBB B;  3LGL A;  2RJD A;  3OW2 P;  1Y7X A;  2QEX T;  2MMP A;  1M1K U;  4M78 D;  1QKW A;  2KT1 A;  2E41 A;  3OA6 A;  1YIJ T;  1YJW Q;  4UC4 A;  5LJ5 f;  3QZ5 B;  5GMK j;  3MO8 A;  2DZC A;  3M57 A;  1D1C A;  3M0P A;  3EG2 A;  3ASK A;  1LOJ A;  2I0N A;  3URG A;  1T0H A;  2Z0W A;  1FMV A;  2LT1 A;  3QYG B;  2EVR A;  2H3E B;  4DBR A;  1QMC A;  1BI1 A;  1NBE B;  4BDY A;  3PIP A;  2CRE A;  2D8H A;  2JMC A;  2ROT A;  2JJ9 A;  4F14 A;  2PU9 B;  4C92 E;  2M9U A;  3CCQ Q;  2PVD B;  3UF4 A;  3BE3 A;  1BI3 A;  3CMA T;  4BY6 C;  3WVE B;  1G3W A;  1ZUY A;  1PNJ A;  4MML A;  2CSI A;  4B9X A;  1NYF A;  4R0K A;  1WHK A;  1B3Q A;  2JNG A;  2A37 A;  1M30 A;  4OMF B;  2YUN A;  1G3Y A;  2EJ9 A;  4JUV A;  3P8D A;  3UWN A;  1SHG A;  4HXJ A;  2VWF A;  1K76 A;  3UA6 A;  1AD5 A;  3CC7 Q;  1SSF A;  2KR3 A;  3J80 E;  1K9A A;  3QKJ A;  3RUX A;  1IB8 A;  4M4Z A;  3EFO B;  3S3N A;  5GAN 5;  3X28 B;  1JB0 E;  2LJ3 A;  1Y71 A;  2EJG A;  1YWO A;  1QVF S;  2KXC A;  2AT1 B;  3FB9 A;  2DIL A;  3LH0 A;  5CVI A;  3REA B;  4JJD A;  4B6M A;  2RJF A;  2HD0 A;  3EGU A;  3G4S A;  1GBR A;  4ZN3 A;  5J26 A;  2D9T A;  2O4X A;  4IUT A;  2W0Z A;  2C0I A;  3QDR B;  3SD4 A;  1B07 A;  1KC8 C;  3MEW A;  3OYJ A;  4NL3 A;  4BY6 B;  3OYL A;  2DYB A;  1K9M R;  4CI0 C;  1TSF A;  4ELZ C;  3EG3 A;  3FIF A;  1V1C A;  1TU0 B;  1RAI B;  2MCN A;  1VQ6 T;  3QZ9 B;  1C0M A;  1YHQ Q;  4FW2 A;  2YUP A;  1K0S A;  3M0U A;  1OEB A;  4LDU A;  4CC7 A;  3DKM A;  1IRE B;  2EFI A;  2O31 A;  3RKY A;  3OYF A;  1IHV A;  2ZPH B;  3OMC A;  1U5S A;  4M75 D;  3EFR A;  2BE7 D;  4K11 A;  2CT4 A;  2MWO A;  2PVO B;  2RI2 A;  2XG8 D;  2RF0 A;  1RI0 A;  2CZ7 B;  1VQ7 A;  1VQN A;  1X2Q A;  5GAM e;  2CP3 A;  1R77 A;  3HL8 A;  2Y90 A;  2MF2 A;  2GTJ A;  3MKD A;  1QLY A;  3GIB A;  3TCJ A;  4RCC A;  5GAM g;  3ULR B;  2VXE A;  1RAB B;  1ZSG A;  1KQS S;  3JB9 I;  1UGP B;  4L59 A;  1GFC A;  2EWN A;  4M7D D;  1OYX A;  1SKU B;  2NUT A;  1GRI A;  1MUZ A;  2FVU A;  3GNG A;  2RNA A;  1H3H A;  3CD6 Q;  4R56 A;  2RH2 A;  1OPK A;  2CUB A;  1TH7 A;  2JT4 A;  3S3O A;  3M5A A;  1UHC A;  2RN8 A;  4HCC A;  3JB9 G;  2ENM A;  1JEG A;  4JDS A;  5A0L A;  1K8A C;  4J9C A;  2D1X A;  1IXD A;  2M0Y A;  3H0I A;  1OU9 A;  1BIB A;  1UE9 A;  1HJD A;  4KH0 B;  1WIE A;  1WPY A;  2P4R A;  3CXC A;  3FJP A;  3V7S A;  1V76 A;  3I56 Q;  2CH4 A;  1PSF A;  4PJO G;  4AT1 B;  1AT1 B;  1U1S A;  1VQM T;  2RK2 A;  2FZG B;  3JB9 F;  4KUI A;  3NMZ C;  5KYX A;  4KGZ B;  2ABL A;  3SDZ A;  2QEX Q;  3V8L A;  2XDD A;  4A4F A;  1U3O A;  4Y28 E;  1YI2 A;  4GBQ A;  2KE9 A;  2JS0 A;  2C0O A;  1Q7Y R;  5KE3 A;  3HRT A;  1W70 A;  2L5Q A;  2KYM A;  3E2U A;  3M0Q A;  3G4S T;  3ZBD A;  3QDF A;  1VQL A;  1ZSZ A;  3EHR A;  4OMM A;  3CC2 A;  3MP8 A;  2OTL T;  2XU8 A;  5GAM f;  1M3C A;  3CC4 A;  2F69 A;  2E6N A;  2RQR A;  2ROL A;  3CCE A;  4C8Q C;  2ZCF B;  3CCU T;  5KYY A;  1KSW A;  5CKH A;  3CMA Q;  5I21 A;  5FWB A;  4BI4 A;  5DM7 R;  1M90 R;  1AHJ B;  2KRO A;  3OS5 A;  1K9M C;  2LQN A;  2LQK A;  2YXY A;  4C92 D;  5GMK i;  2DIQ A;  4M78 A;  2ATC B;  1KJW A;  1Q82 C;  1X69 A;  4QQD A;  2LMJ A;  5IHI A;  2CZ0 B;  2FEI A;  1R0B G;  2SRC A;  1N8R R;  1LNX A;  1VIE A;  1H3Z A;  1I81 A;  2IIM A;  4AG1 C;  1NJI R;  4M77 G;  1QVP A;  5GMK e;  1ZA1 B;  1VQ7 T;  1VQN T;  2P4T A;  4M7D G;  1IGU A;  1KHI A;  3BFM A;  1VQ5 T;  3JSC A;  2CDT A;  1A0N B;  3EHQ A;  3LLR A;  2OI3 A;  4E7L A;  3ME9 A;  1O9S A;  2HMA A;  4FSS A;  4C8Q B;  2J6O A;  2JW4 A;  1K73 U;  2WAC A;  2K5L A;  4JRI A;  1AVZ C;  3O5Z A;  3QUI A;  5IAY A;  4M77 F;  4BUG A;  2X35 A;  1KFZ A;  5L8R E;  1EFN A;  3JCM J;  2P0K A;  2QDY B;  1T0J A;  2OJ2 A;  2RQU A;  5I11 A;  4J5Y A;  4QKU A;  2XMF A;  4WTO B;  2X3X D;  1X75 C;  5GMK m;  2DA9 A;  4D8K A;  1Q81 U;  2O9S A;  5C0M A;  2BZ8 A;  1W2B S;  1XJW B;  1Y96 A;  2MAM A;  1RAD B;  2YHT A;  3R6N A;  1UGQ B;  3MJX A;  5DY9 A;  3O8V A;  1ZUK A;  5CCA A;  2QG9 B;  1T3S A;  4PLI A;  3ZL7 C;  1M3B A;  3GBQ A;  3H0H A;  2K5I A;  2FPF A;  3VS7 A;  4PJO A;  4J9B A;  1VYV A;  1QWF A;  1FYN A;  1X43 A;  1N6A A;  1VQ8 A;  4C0D C;  1WA7 A;  2DL5 A;  5CKB A;  5LJ3 e;  3OYK A;  2DO3 A;  3G6E Q;  2LCL A;  3G7Z A;  2X4X A;  2HBP A;  2QDL A;  5GAO p;  2LCC A;  3HRU A;  5CQX A;  3ZEH A;  1JXM A;  3CC7 T;  1I07 A;  2RA2 A;  5LJ3 g;  3OBW A;  4FW1 A;  4J6W A;  4JS4 A;  2DBM A;  1XOV A;  3X24 B;  2KRN A;  3DB3 A;  3T9N A;  5GAN h;  4FU6 A;  1IO6 A;  4PJL A;  2X4Y A;  2HCK A;  3JCM Q;  3CC2 T;  4X9C A;  4JLI A;  4LNP A;  1OU8 A;  3CC4 T;  2YRD A;  4KUD K;  2LT4 A;  4C5E A;  3OS2 A;  3CBM A;  4AFS C;  4RTT A;  3RER A;  2K2M A;  4RTY A;  4M75 A;  2DTH A;  3CPW P;  1UDL A;  2DJQ A;  3EGX A;  1LVK A;  3H0F A;  3KXT A;  2EGC A;  1QP2 A;  2H8H A;  1IRX A;  4J9F A;  4ORZ A;  1JJ2 P;  4C0D B;  1RAA B;  1WX6 A;  4HA8 A;  4Y92 A;  4Y91 A;  2KAF A;  2L3P A;  3OB9 A;  1HD3 A;  4XU0 A;  1V29 B;  4CC2 A;  3HPW A;  3CBP A;  1QVG A;  2DET A;  1M27 C;  4HCK A;  3IQL A;  3RKW A;  5KYU A;  3MHX A;  5AT1 B;  2A36 A;  4ELY C;  3QO3 A;  3VS2 A;  1XQH A;  1LPL A;  2L89 A;  3A98 A;  1YIT A;  5GAO q;  1WHG A;  4M7D A;  2HBW A;  3HHT B;  2RI3 A;  2H3J A;  3QYH B;  1ZA2 B;  5J39 A;  4AFQ C;  3M55 A;  2R57 A;  5KCH A;  4M77 E;  4B9W A;  2EGE A;  2DD5 A;  2LZ6 B;  4NOY A;  2RD1 A;  3VS6 A;  4JPB W;  5LJ3 f;  2NYS A;  3CCV A;  3OYD A;  4O6J A;  1Y57 A;  1JU5 C;  2DJZ A;  1RL2 A;  2V8K A;  4E7H A;  4EPC A;  1TWB A;  2V1R A;  1WHH A;  2DVE A;  2J6K A;  1I0C A;  4AMC A;  3PVL A;  5LJ5 h;  1VQO Q;  2AKL A;  2NWM A;  1R8O B;  8AT1 B;  3JB9 H;  4EMH A;  4F17 A;  4FIB A;  2LJ1 A;  3NTK A;  3MCA B;  4LDV A;  1UGV A;  2NUT B;  2FHD A;  2E64 A;  2FL7 A;  4GLM A;  4JZ3 A;  1U1T A;  1ZSZ C;  4J9G A;  4PJN A;  1BK2 A;  2AK5 A;  4FYY B;  2QQ9 A;  2J05 A;  2RPN A;  2DMO A;  2RHX A;  2EQU A;  2XIC A;  4LDW A;  2JTF A;  1VQ8 T;  3I56 T;  2PQW A;  4M7A C;  3VS1 A;  2BKD N;  2DTI A;  1SF9 A;  1I4K 1;  1UGR B;  1GXI E;  5GAN 8;  2ED1 A;  3EAE A;  3G6E A;  4D8D A;  2EQI A;  3DB4 A;  1M1K C;  2GQI A;  5KYX B;  2CP7 A;  4M78 C;  4ZNX A;  2G6F X;  1Q86 U;  1ZBJ A;  4A54 A;  2V8J A;  3E19 A;  1Q86 C;  3ER0 A;  1XNI A;  3JCM b;  4C92 A;  5IHN A;  3OYI A;  3A8L B;  2LNH B;  3FDR A;  3MEA A;  1XTD A;  4J9I A;  5DLO A;  2LJ0 A;  1K8A R;  4LUE A;  1ZSZ B;  1FMK A;  2QGG A;  1YJ9 A;  2DZ9 A;  5FU6 B;  4DOV A;  2JXB A;  1W2B P;  2EPD A;  2ESW A;  2ZAE A;  2GTO A;  5GAN 7;  3OS0 A;  2NUP A;  1ZHI A;  3CEY A;  3JCM X;  4M7A B;  4A63 B;  5KYY B;  2E3I A;  4DOW A;  4IIM A;  2KRS A;  2VXF A;  1QCF A;  4C0G A;  1YI2 Q;  3JB9 D;  1WI7 A;  4M78 B;  2LDM A;  1D0Z A;  4FT4 A;  2JM8 A;  1PKS A;  4OB1 B;  2DM1 A;  4F04 B;  5IH2 A;  3GOX A;  1OV3 A;  4J8O A;  2JMA A;  2FRY A;  4MDW A;  1VQL Q;  2O9V A;  3CC2 Q;  2HAX A;  2XKO C;  2QXF A;  4PJO D;  4F7U F;  2KI7 A;  3CC4 Q;  2RQV A;  2LVM A;  4Z02 A;  3CCE Q;  3PGG A;  2FPD A;  3CCR A;  2KQW A;  5M9O A;  1FXX A;  4JRQ A;  3NPF A;  2NLU A;  6AT1 B;  2RHU A;  1Q82 R;  2XHC A;  1VQO A;  3NFC A;  2PZ1 A; 
#chains in the Genus database with same CATH homology
 2KI7 A;  1PC0 A;  1OQK A;  1V76 A;  1TSF A;  1TS9 A;  2ZAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...