2KI7A

The solution structure of rpp29-rpp21 complex from pyrococcus furiosus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
111
structure length
111
Chain Sequence
QGSYQEIIGRTWIFRGAHRGRVNKKNIVWHELIGLKVRVVNSTHPGYVGIEGYVIDETRNMLVIAGENKVWKVPKDVCIFEFETWDGTKIKISGEKLVGRPEMRLKKRWRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of an archaeal RNase P binary protein complex: formation of the 30-kDa complex between Pyrococcus furiosus RPP21 and RPP29 is accompanied by coupled protein folding and highlights critical features for protein-protein and protein-RNA interactions.
pubmed doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 1
total genus 15
structure length 111
sequence length 111
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 2ki7A00
1TSFA 1TS9A 2ZAEA 1V76A 1OQKA 2KI7A 1PC0A
chains in the Genus database with same CATH superfamily
3CMEA 3ZEHA 1PHTA 3PMIA 4A53A 1PKTA 3LWHA 1KC8R 3J7AF 1NG2A 3A8MB 1ZUYA 4PJNA 3EHQA 5FU7C 4M7DE 4F7UE 2DM1A 2FPFA 1YBYA 4C92A 2FG0A 5A2QE 4ANJA 4KUDK 2J6OA 1IGQA 4ZNXA 4DBFA 2WSFE 1RAAB 4QVCA 2L3SA 2EJGA 2FZKB 3QO3A 4XU3A 1C6VX 4LN2A 4C8QE 1C0MA 5GMKl 1U3OA 1TTHB 4J9IA 2K57A 2XKOC 1LCKA 4PJLA 3DB3A 2RHXA 5LJ3e 4R55A 1WGSA 2WSCE 3HPWA 1NEBA 4XAXB 2ZGWA 2DE0X 1B34B 1WI7A 2K7AA 3JCMQ 3CPWS 2GNCA 3CC7A 1GL5A 5KYUA 2V8IA 3E1SA 2DL8A 4IUTA 2H3EB 3CCMQ 1D1AA 2O2OA 3C0CA 3MKDA 4J9HA 1Y7XA 3FJPA 4J8OA 2ZZDA 3VV0A 3OBWA 1NBEB 2X4WA 8AT1B 5LJ3g 2M0YA 1Y0MA 4N4IA 1JJ2S 1SKUB 3I35A 2L89A 2AZVA 4EMKC 4LDWA 1GCPA 4JRIA 2IIMA 1KHCA 3OYAA 3EHRA 2CP6A 3E19A 1N6AA 2QYZA 3A8GB 3BW1A 1QVFA 5GAMe 2MYSA 2QEXA 4MMKA 1AEYA 3OYNA 5LJ5e 2RJEA 1OEBA 5GAOl 2CZ0B 2YRVA 2QTVA 2F5TX 4QVDA 5GANf 3CCVT 2RHZA 4M7DF 2D9TA 3VS2A 3CCSA 1NJIU 1KD1C 3VS0A 5DY9A 4A54A 2JXBA 1ZSZB 2KDSA 2BE9B 1YJWA 1Y07A 3QJYA 3EFOA 4JJDA 3CCUT 3V8LA 3M4YA 2ZPHB 1ZX6A 1XNIA 4C5IA 4J9FA 5GAN4 1VQ9Q 3LWIA 5GMKi 4FIBA 4FW1A 1FYNA 4OVAA 5KH6A 1VQNA 3BY7A 2DMOA 3R6NA 3EG3A 1ACMB 4PJOF 3TSZA 3QDRB 2YDLA 3CCLQ 2EJ9A 3I56T 1G83A 1Q95G 2L5QA 2M1HA 4J6YA 3RKWA 5CKBA 4KGVB 4QT7A 1FX7A 4FYYB 3DLLA 1QVPA 4PNOA 2CSQA 3CD6T 3VYHB 3OA6A 1VQ7T 5KCHA 3ZFJA 1M9SA 2D8JA 2QDLA 4LXCA 4XU2A 1AZGB 1FMKA 1PCXA 1YWOA 2W10A 3FJ5A 4M4ZA 1W2BS 3EG9A 1XJWB 2V26A 1D1BA 3CCEA 3P8HA 1K73C 2D1XA 2QK0A 2QQAA 3QJ6A 5IAYA 1KK7A 5GAN5 4XQ3A 3RKXA 2E6ZA 3MP1A 4PFPA 2LQKA 5D6YA 4ORZA 1QVFS 1N8RC 1G3TA 3OS5A 2KRMA 3OYFA 1QVGS 2DA9A 2BKDN 4B9WA 1OI1A 5IHKA 4L59A 2RJFA 5GJVB 1I1JA 1MNEA 3A8OB 3FDRA 2KXDA 4N0AA 3LH0A 1MMAA 4PJJA 4OB1B 3JCMc 2QDYB 4M7AA 1H641 4BI8B 3CPWP 5FROA 1JO8A 1NZ9A 2A37A 1VQLQ 2Y4YA 5LJ5j 2PU9B 2QA4Q 3M54A 1HYOA 3SWNC 1EIFA 4C92G 5GAN3 1NJIR 2O88A 3PIOA 1IREB 2SRCA 3EGXB 2LJ3A 2DTOA 4M78F 1PM3A 3M0UA 1VQOA 1I07A 2X3XD 1JU5C 5CIUA 5D6XA 1BI0A 4ELZC 2DEUA 4E7LA 1VQPT 3PTAA 2HKQB 5IT9E 4FYWB 1UGQB 3L2RA 1Q82R 3RMSA 2ZAEA 2FRYA 4Z88A 1X69A 5A0LA 5LJ5f 1U06A 3OS1A 4V2SA 4XTYA 3JB9F 3JCMX 3PFSA 1VQ6T 2JTMA 4OMNA 4M75E 3RNJA 3KXTA 5GAMj 3CCJT 4XTXA 1K9MC 1NYFA 5KE3A 4CC3A 3VS4A 1S72Q 3E2UA 4CI0C 2CP7A 3OQ5A 2KGTA 4Y28E 7AT1B 1PD0A 4OMLA 2NWMA 4X9CA 4F17A 1RLPC 4R0KA 3TREA 1X01A 1TG0A 1X43A 4J7IA 4JDSA 2EBPA 2QTXA 1X2KA 4MZTA 2FVUA 3OMCA 4M7AG 1VQ9A 2CT3A 5KYYA 4M77F 5FU7B 1UHFA 2YXYA 4PJOG 3HHTB 2KY9A 4BY6B 3BFMA 2V1QA 1N8RU 2RI5A 1YJNQ 3WVDB 2R58A 4GY5A 2FZCB 1ZUUA 4D8KA 1NJIC 3QDFA 2E41A 4KULA 2QEXQ 1FMVA 2O4XA 4ZN3A 4M78B 4M78E 3NGPA 2QXFA 1U8RA 2OX7A 2DEQA 1M90R 2RHUA 4TVRA 1OOTA 4GBQA 3CCRA 4QVZA 3UT1A 3CCRT 4PFOA 2X4YA 2X3WD 2DLPA 4CC4B 3AT1B 1OYXA 2XHCA 1GXIE 1UTIA 4M75F 2GTJA 2O9SA 1UJYA 2A08A 1YIJT 3VYGA 3RESA 2ROTA 3SWNB 1F1BB 4AMCA 4ZGJB 4AG2C 5CKDA 3CCVQ 2ZCFB 1VQMQ 1H8KA 4ELYC 5HY6A 1SG5A 1M2OA 4IIOA 3CCUQ 1RI9A 5GAOn 4C0DB 4M77B 2DTHA 4MMLA 3F70A 1VQ9T 1X6BA 5DLOA 2H8HA 1NLOC 3SEMA 1OPLA 3TU4K 5I2MA 1QCFA 5KYNA 2M02A 3JSCA 3G71Q 1BI1A 4PKCC 3CCLT 1PD1A 5J26A 3I56Q 3J80E 1WHJA 2MOXA 2GFAA 4LDYA 1JXOA 3PNWC 1QP3A 2MF2A 4F14A 1V29B 2LX9A 1S72A 4RTVA 4CC7A 1JQQA 2K2MA 3CD6Q 2CZ6B 1H92A 1WFWA 1WHLA 1KHIA 1VQ7Q 2EQUA 1Q81C 2EYQA 1MHNA 1U5SA 1RAFB 1G5VA 1WLPB 3X28B 4PJOB 5IXBA 2RJCA 2DRKA 2HD0A 2DKGA 3THKA 1M90U 3OW2S 2E3IA 2DVJA 2HZYA 1YJ9A 3OSSC 1BBZA 3PGGA 1Q7YR 4OF1A 4LNPA 2HDAA 2D6FA 3UPUA 1UG1A 4BY6C 3QUIA 1RUWA 3HFNA 1QP2A 3NPFA 4WTOB 3NMZC 3I9QA 2FPDA 2JM8A 1M8VA 4M78D 3WXMB 1QWEA 3CBMA 2F2WA 1W2BA 4C8QG 1RAHB 3M5AA 4A4EA 2KBTA 2QA4T 2HKNA 2BZXA 2E10A 1RI0A 4VUBA 3LW5E 2HQXA 4C8QB 2KQWA 5GANd 2NUTB 3L2QA 1G2BA 1AD5A 1S1NA 2VASA 3TQ7P 1M3BA 1SRLA 4J83A 3RKYA 2ZPIB 3S3OA 1VQPQ 4EMKB 1WNLA 2L3QA 1TUGB 2FYKA 3J81E 2DPPB 2P84A 3RDVA 1PG5B 1E6HA 3CEYA 5IH2A 3L1AA 2DETA 2M16A 3N5BB 4D8DA 5FU6C 3EG1A 4RMOA 1VQ6Q 1AWWA 3MP6A 1W70A 2RK1A 3JV3A 3HSBA 4M7DC 5LJ3h 3M0RA 1NPRA 3CD6A 4Y92A 2M9UA 1E6GA 1S72T 4LD9K 1H3ZA 4XTVA 9ATCB 3LGLA 3VUZA 4AFUC 4QKUA 3PMTA 1RADB 2AT1B 2MAMA 3EGDB 5IXFA 4N4HA 1WDXA 5M9OA 3UWNA 3L42A 5KCOA 4XU0A 1I5LA 2HL5C 2PZ1A 2R5MA 4Z8AA 2A36A 1BK2A 1QMCA 4LD6A 4KBMB 4J5YA 1BB9A 2FEIA 3GBQA 4OMFB 2RJDA 1DJ7B 3QSUA 1YJWT 1VOMA 2EAYA 4J6XA 5GAOr 1M90C 1YJNT 3JCMh 4X9DA 2VYTA 2RM4A 2ZPGB 2K3BA 2V8KA 2QEXT 2WACA 2WSEE 2CP3A 1GCQC 1YIJA 5KYXB 2HQHA 4RTXA 1GCQA 2RI2A 4OMPA 3M4GA 1VQ8T 2P0KA 2R57A 1KD1U 1K9AA 2J06A 5CCAA 2P4TA 3SD4A 4M78C 3L2VA 2DERA 1WJSA 4M77G 1YCSB 4OMMA 2KT8A 3CCRQ 1AWJA 5I22A 3FIFA 2LJ1A 2LP5A 2QQBA 4JPBW 2QQ9A 2KAFA 4BD3A 4MDWA 3SFMA 2K6DA 2YUNA 1IRXA 1B3QA 5FLXE 3CBOA 1V1CA 1VA7A 4JJNK 3UA6A 5J39A 1X75C 2X35A 3CPFA 1Y57A 2PTKA 4FSXA 1YIJQ 2B8AA 4E7IA 3CCQQ 4ME7A 4O5VA 3EFSA 2C0TA 5GAOm 2RHIA 3H0FA 4C0ZA 1IGUA 5EC7A 2B86A 1TH7A 4A4GA 3MHXA 2PVOB 3GOXA 3OYBA 5GAN2 1VQMT 3A8HB 1YJ9Q 1CKAA 3H9NA 3IQLA 3QXEB 4JJBA 2MWOA 4KGZB 4C92E 4E7SA 4M7DA 2OAWA 1VIEA 1NM7A 1UGVA 4OGCA 5GAMf 4ESRA 2CP0A 4BE0A 1WHMA 3RUXA 4AFZC 2ED1A 3G71T 2YHTA 4HVUA 2JT4A 2HEQA 5LJ5d 2DILA 1GBRA 1K76A 2M51A 3E9GA 1TWBA 2K2VA 5GAOq 2V8JA 2RQUA 3EFOB 4KH0B 3M0SA 4J9BA 3OYKA 5KYWA 1BCMA 2E65A 2G6FX 5GANg 2HMAA 4M75G 1ZUKA 4RG8A 4PLIA 2JMAA 3OS2A 4N4GA 1TSFA 3I55Q 5GAN6 2IG0A 2ESWA 4C0GA 4C0FA 2D0QB 1PSEA 3QBYA 1IHVA 1W2BP 2CUDA 2RF0A 3MEUA 4FL6A 1AWXA 4BI4A 3SDZA 1W4SA 1M1FA 1RAEB 1ZLMA 3S6WA 1AT1B 4HT8A 2EQJA 3FRNA 4OB3B 2DF6A 1LVKA 4FYXB 3GNFB 2X4JA 1K9MU 2CS7A 2JVVA 4M7AE 5CKFA 5LJ3j 2RA2A 2XG8D 1EZZB 4NL2A 3REAB 2KK4A 4PJOE 2VGMA 1VUBA 2P0QA 4QW2A 4HKEA 2QASA 3I5RA 4OMQA 2DXBA 3CMAQ 2QI2A 2P4RA 3JB9G 2YWWA 3MO8A 3VRZA 4HCZA 4EMHA 3GPLA 4F7UB 3EG0A 3MP8A 1D3BA 2RQTA 5IHIA 3UATA 5GAN7 2L0AA 2FRWA 5C6SA 5D7UA 1JXMA 2DO3A 3JB9I 3QWXX 4M78G 2CSIA 1UJ0A 4Z89A 2DD5A 1K0XA 4Y91A 2BZYA 2JOYA 2A3LA 2SEMA 3MEVA 2VGNA 4RTWA 1D0YA 4C8QC 4JLGA 1BU1A 1M30A 4M7AB 1KQSA 1WHHA 3G6ET 3JCMW 1YN8A 3INZA 5FWCA 1YJNA 2XD0A 1M3AA 5FW9A 4C8QF 2KXCA 4O6JA 3EGXA 1D0ZA 5KYYB 3JCMg 2C06A 2VWFA 1MV0B 4LDVA 4RKUE 4EPCA 2OTLQ 2EFIA 1EFNA 4JJCA 1T0HA 4A4KA 2CH4W 2DYBA 1G8XA 1D0XA 3I56A 1SSFA 4RG2A 1M1GA 1TOVA 1I0CA 3ZL7C 4M7AF 1M3CA 3M59A 5GMKh 2RI3A 1PNJA 1T3SA 4FU6A 4MZMA 3CCUA 1YJWQ 1Y96B 1B7TA 2YUQA 5LJ5h 2OTJQ 3S3NA 1K8AU 4PLLA 2FZGB 4M77C 2VB6A 5GJWB 1R8OB 2XDDA 1X27A 3C95A 1X2QA 2V1RA 3UF4A 1GFDA 3PE0A 2A28A 1KQSP 2QQRA 4PJOC 3ME9A 3TSWA 2FO0A 2KT1A 2K4YA 4LDXA 2YRCA 1XOVA 4BI3A 1CSKA 1PWTA 1Z9QA 3VS1A 4ZN1A 5CQYA 1VQ8Q 2F1LA 1K8AR 1VQ4T 4JRPA 3OBYA 2YRDA 1QLYA 3H41A 4AT1B 1JRIA 2EQKA 2DTIA 1HSQA 2QA4A 1LNXA 2O4XB 2DXUA 2GGRA 1BIAA 4JZ3A 3DLMA 2CGHA 3U23A 3LX7A 4DEXA 3CCQT 3JCMe 1VQKQ 3BDLA 3KUFA 4KRTA 3URGA 4NS5A 4HVWA 4JS5A 2EPDA 3V7CA 5KYUB 3CC2A 2HNIA 2EGAA 2CP2A 4OMOA 1YJ9T 3OW2A 3TVTA 5GAMg 1ZA1B 2Z0WA 2Y90A 3C4SA 2KYMA 1WJRA 2F2XA 4F7UA 1UEBA 3LYIA 1D3BB 4M77D 2K5IA 2LDMA 2J6KA 2HBWA 1ZHIA 3SWNA 3CXCA 2AK5A 1JJ2A 1QCNA 4IIMA 3RMQA 2LCSA 2LRQA 3QHSA 4J9CA 1YI2T 2QGGA 2VC8A 3G71A 1VIFA 2EKHA 3JCMP 1ZSZC 3I55T 3V7SA 1CKBA 3M9QA 3VU3C 1WA7A 3PT9A 3X25B 4EIKA 2LCCA 5FU6B 5CKEA 1UUEA 1D1CA 2HAXA 1VQMA 4QQDA 2JNGA 2RH2A 5GANh 4E7HA 3OYCA 1TXQA 3NFCA 1TS9A 1RACB 3OW2P 1SHGA 3RR6A 3CC4T 2COZA 2J6FA 1K73U 3TCJA 2RQRA 2LQ8A 3JCMV 1K8AC 3OYYA 1ZSZA 2J7IA 5HK0A 3CMAT 2BUDA 2QQSA 3EG9B 3HKSA 4HVVA 1H3HA 2PVGB 4KH1B 1TU0B 4RTYA 2K5FA 1WQWA 5GANj 2EQIA 3HL8A 1YNZA 1KJWA 1MNDA 5CQXA 5GMKm 2LJ0A 2DK3A 1KQSS 1HD3A 4J6WA 1VQ8A 3MEWA 1RAGB 4XK8E 3X20B 2RB6A 2DAQA 2EW3A 1NPPA 4C5EA 1VYTA 1JBMA 2KSSA 3ZBDA 3LH5A 1AOJA 4M77E 1I4K1 2E1HA 4M75B 3G6EQ 4ZTFA 1BI3A 4NOYA 1WHGA 1YP5A 2F2VA 1J3TA 5GAMd 3C12A 3GNGA 5HK3A 2Y4XA 4JUVA 2HBPA 2LZ6B 4HCBA 3M0TA 4DA4A 2DBKA 2AKKA 2XIDA 4CRIA 3A8LB 1XTDA 4XTUA 3VS7A 3JCMb 4B6MA 1PSFA 2OTLT 3OYDA 4N0AC 2C0IA 4EMKA 2CP5A 1RLQC 1OU8A 2JM9A 3GF5A 3I5SA 4FW2A 3CPWA 1YHQA 2AKLA 4AFSC 4PJOD 3CXCS 2MPXC 3NTKA 4LUEA 3OYMA 4II1A 3QYGB 2E6NA 2OJ2A 3CCJA 3EAEA 2KRSA 4PJMA 3PVQA 2MK5A 5LJ3d 3MCAB 2OTJT 4X34A 3SB2A 2P0PA 2CYZB 4RTUA 4QQ6A 1K1ZA 3NTHA 2DIGA 2JUFA 3A1PA 1MMGA 2LCLA 2KR3A 1ZBXA 2LQWA 1GBQA 2NYSA 3FC3A 2MIOA 2ED0A 1O75A 1WXBA 1W1FA 1RAIB 5I11A 1OX8A 1VQOT 1AWOA 1UECA 4ATOA 2MI6A 4J9GA 1VQ4Q 1YITQ 1OPKA 4KGXB 1Q86U 3V8JA 3LLRA 1IZ6A 1KFZA 4C92F 2J05A 2K5LA 3H0IA 1K9MR 5FRMA 3P8DA 2RQVA 2DYIA 4FT2A 1EX4A 2LTOA 1N27A 2NUZA 3T9NA 2ENMA 5I21A 5AYFA 2COWA 1KG1A 1Y71A 1BYMA 4DBHA 1G3WA 3Q1JA 5IHNA 3JB9D 5GAN8 3A5ZB 1VQKT 1UE9A 3ULRB 1KC8C 4C92C 4JS4A 1IO6A 1SF9A 2JTFA 3G1JA 5GANe 2K79A 3QYHB 2DX1A 3P8BB 3L2UA 2RHYA 2NUPB 3BE3A 3G4ST 1G3YA 2LMJA 2LNVA 1B07A 4C92B 3EH2A 2KROA 2DVEA 1QW1A 2YLBA 2FHDA 3M57A 3KFVA 2CKKA 4XU1A 4RCBA 3FLGA 2VKNA 1MMDA 4DBQA 3FB9A 2XK0A 2HL3A 2DL5A 5A0DA 2PQWA 4BACA 3EFRA 3MPUB 2YSQA 4M78A 2GCXA 1ABOA 2JN0A 1YI2Q 1UGSB 3O5ZA 4RUGA 4HT9A 3CCLA 5HKCA 4DOWA 1U1TA 1VQNT 2VXFA 3HP9A 1KD1R 1N9RA 3O8VA 4M7AC 3VUBA 1B34A 3MEAA 4HCKA 2GQVA 2EYZA 1VQ5A 1A0NB 2EKOA 3RBBB 2GF7A 3RIRA 2YUPA 2EQMA 3ER0A 1YCYA 3M55A 3OYJA 1OZ3A 3QPHA 2DJZA 4C0DC 2MCNA 3G4SA 3DKMA 3EH1A 2CH4A 3CC2Q 3CCSQ 2LC4A 3ASKA 2HQEA 1X6OA 4HCCA 2W0ZA 2BIVA 1LPLA 3CC4Q 2CDTA 2JMCA 2DBMA 2L3PA 4F7UF 1GFCA 4LUDA 2BZ8A 2KNBB 1WYXA 2PVDB 4A63B 2D0NA 4LE9A 2C0OA 3EG2A 2E4HA 3HRTA 1Z9ZA 1ZBJA 4OP0A 1VYVA 3JCMd 2BTTA 2JZ2A 3VJPA 2PUOB 3CQTA 3OYIA 2LT4A 4DOVA 4JRQA 4KUIA 1KQ1A 2D8HA 3CC7Q 2I0NA 4FYVB 1XQHA 3CBPA 2DL3A 1JJ2P 3TEEA 4FSSA 3H6ZA 1ZQ1A 1U1SA 2NLUA 2ZPFB 3OYGA 4AG1C 3R6OA 4JRKA 3HFOA 2EYWA 2RQWA 4F04B 1I5OB 1M1KU 3HRSA 4J7FA 1W6XA 1ZSGA 2E3HA 4M7DG 4F7UG 2JS0A 1R0BG 2DL7A 2LVMA 3HRUA 1WIEA 5AT1B 2E5KA 2X4XA 1ARKA 3NHNA 3VS3A 1K4US 3UA7A 8ATCB 4BE2A 2F5KA 5L8RE 1Q81U 1SPKA 1SHFA 4C8QA 1PRLC 1UGPB 1Y96A 4J9EA 3AHUA 4OB0B 3VRYA 2DIQA 2EGEA 1YHQT 1LJOA 1P92A 3MJXA 1UDLA 4FT4A 2O31A 4D6WA 2XDBA 2CREA 2OTLA 5CKHA 2F69A 3VS5A 2XI9A 1HK9A 3CMET 4IUUA 4RCCA 2DNUA 2H3JA 1VQ6A 2X9HA 2JW4A 2XICA 2DL4A 4WF2A 3WVEB 2DXCA 4QQGA 3JCMf 2ZPBB 2KEAA 1OV3A 2PNIA 4L6V5 4BE1A 4ZGEB 3S3MA 1FXXA 1VQPA 2CZ7B 1AVZC 2AIRB 3EGDA 4P5NA 1MUZA 4J9DA 1VQOQ 2ZPEB 3SHWA 3E9FA 1QVGA 1SEMA 1Q82U 2JS2A 3H0HA 3V7RA 1YITT 5LJ5g 4E47A 4UC4A 1SRMA 4NL3A 1I8FA 2PUKB 4C5GA 2YLCA 2EYXA 1VQLA 1WHKA 1M8MA 2VUBA 3CMAA 4LDUA 4M7AD 4KT0E 2RN8A 1N8RR 3M56A 4ZGDB 1OQKA 5IN1A 4B9XA 1TUDA 2EVRA 5CK9A 3QKJA 3QZ5B 2M0OA 5GAMh 3CC4A 4PK4A 1N5ZA 1D09B 4C5HA 1G3SA 3V8KA 2ATCB 2KI7A 3PIPA 4FM4B 1I81A 2K3XA 2CT4A 1Q81R 3M58A 3GP8A 2EJFA 3G4SQ 1C1AA 4YTLA 4AFQC 2DZ9A 4RTTA 4IURA 5CR2A 1VQ5T 3I55A 4GLMA 3CCET 3M0QA 4CC2A 1UFFA 4MZPA 1YFNA 3QIIA 2X51A 4HXJA 4Q5WA 4BDYA 5L23A 1M27C 3L2WA 1QKWA 1VQ7A 3GLXA 2DRMA 4HA8A 1AZEA 1M2VA 1QVGP 3OY9A 1YI2A 5C0MA 1T3LA 2GTOA 4IUVA 3JAME 1KQ2A 2EYYA 1LOJA 1IXDA 2CZ1B 5KYXA 1AHJB 1ZA2B 1NEGA 3H8ZA 1QWFA 3QG1A 1VQNQ 2QG9B 3JRZA 1YWPA 2E64A 2LX7A 3META 2DD4A 2KMTA 2XMFA 1PKSA 2AHJB 1Q86C 5CAIA 4F16A 4M7DD 1BIBA 4E7ZA 1FWZA 2A7YA 3CCST 3CC2T 4MDXA 1K0SA 3CCVA 3NTIA 1MV3A 2I2LA 2DFUA 1VQKA 3CCQA 5CO7A 5GMKj 3JCMJ 3QZ9B 1SSHA 1WXTA 5KYWB 4C92D 3CXCP 3CCMT 1PRMC 2ROLA 1UB4A 1ABQA 4IUPA 3DB4A 2KYBA 2JTEA 2LQNA 4M75A 2JJ9A 3OYHA 4M7DB 1HJDA 3X24B 1NLPC 2IPOB 3D7SB 3OYEA 1VYUA 2HSPA 2XDPA 1VQ4A 1OULA 2DZCA 3BDUA 3CCMA 5LJ3f 2HCKA 4XTWA 1Q7YC 3CC7T 2A0FB 1OU9A 1O9SA 2L2PA 2VVKA 4RTZA 3UDCA 2GQIA 1WJQA 4E7JA 1BCOA 1X6GA 1K73R 4DQ2A 3VKIA 2IVWA 4EDUA 3M0PA 1KIKA 2OTJA 2HSEB 1QKXA 2EIFA 3JB9H 2YUOA 1IHWA 3X26B 3OB9A 2COYA 5DLQE 2BE7D 2RO0A 2YT6A 4WCIA 4FCYA 4JZ4A 1OZ2A 3OS0A 5LL6S 1PC0A 3EGUA 4BB7A 3HTRA 1BI2A 3FEOA 3OMGA 2AZSA 1Q7YU 2KE9A 2QAZA 1YHQQ 2GFUA 4Z02A 1HXDA 1V76A 2O9VA 5CVIA 5I2SA 2VV5A 2FL7A 4PL6A 4OGEA 1OX9A 1WXUA 1BKBA 2EGCA 2LNHB 1NE8A 4A4FA 1WX6A 1MMNA 2K9GA 2OAUA 3CMEQ 2KRNA 1WZOA 1KC8U 4M77A 4GLKA 1N9SA 4M75C 2QGFB 5GAOp 4JLIA 2GBQA 1GRIA 1QVFP 1TUCA 4IUQA 3G7ZA 1QQJA 2KVQG 1Q86R 2E12A 4DEYA 1M2VB 2MMPA 3G6EA 5DM7R 3QWYA 4IKFA 1JEGA 4DBRA 1FMWA 2MWPA 2VXEA 2RK2A 2EWNA 5ECAA 1UGRB 3KBGA 3OYLA 4PFZA 1R77A 3M53A 2DJQA 6AT1B 2RMOA 3OSVA 1E7OA 3REBB 4E6RA 5J3BA 2G3RA 3PVLA 1RABB 3A98A 2RD1A 4PJOA 3RERA 3L2ZA 2OI3A 4XTZA 4EMGA 3VS6A 1M1KC 2DXTA 2NUPA 5D6WA 4L5GA 1WPYA 3C94A 2O01E 2ABLA 1VQLT 4M75D 5HCKA 5FWBA 5FRNA 2RPNA 2XU8A 4ZTJA 5KE2A 1IB8A 1WQ7A 5GMKe 4A4HA 3JB9J 1YITA 1T0JA 4C8QD 1QCOA 1Q82C 1JB0E 2E70A 1NYGA 3GIBA 2LT1A 2K3YA 1KSWA 4OB2B 2R5AA 2RNAA 4BDZA 1M4ZA 4BUGA 2CUBA 4E2FB 4X1VA 4E7KA 5A0GA 1MGQA 2FB7A 2FPEA 2ECZA 2L8DA 1R0CB 4K11A 1VQ5Q 3CCEQ 1M5Q1 1RL2A 1UHCA 2E5QA 5EG2A 2NUTA 3LGFA 4R56A 1M1KR 2L3RA 3CCJQ
chains in the Genus database with same CATH topology
1TSFA 1TS9A 2ZAEA 1V76A 1OQKA 2KI7A 1PC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TSF A;  1TS9 A;  2ZAE A;  1V76 A;  1OQK A;  2KI7 A;  1PC0 A; 
#chains in the Genus database with same CATH topology
 3CME A;  3ZEH A;  1PHT A;  3PMI A;  4A53 A;  1PKT A;  3LWH A;  1KC8 R;  3J7A F;  1NG2 A;  3A8M B;  1ZUY A;  4PJN A;  3EHQ A;  5FU7 C;  4M7D E;  4F7U E;  2DM1 A;  2FPF A;  1YBY A;  4C92 A;  2FG0 A;  5A2Q E;  4ANJ A;  4KUD K;  2J6O A;  1IGQ A;  4ZNX A;  4DBF A;  2WSF E;  1RAA B;  4QVC A;  2L3S A;  2EJG A;  2FZK B;  3QO3 A;  4XU3 A;  1C6V X;  4LN2 A;  4C8Q E;  1C0M A;  5GMK l;  1U3O A;  1TTH B;  4J9I A;  2K57 A;  2XKO C;  1LCK A;  4PJL A;  3DB3 A;  2RHX A;  5LJ3 e;  4R55 A;  1WGS A;  2WSC E;  3HPW A;  1NEB A;  4XAX B;  2ZGW A;  2DE0 X;  1B34 B;  1WI7 A;  2K7A A;  3JCM Q;  3CPW S;  2GNC A;  3CC7 A;  1GL5 A;  5KYU A;  2V8I A;  3E1S A;  2DL8 A;  4IUT A;  2H3E B;  3CCM Q;  1D1A A;  2O2O A;  3C0C A;  3MKD A;  4J9H A;  1Y7X A;  3FJP A;  4J8O A;  2ZZD A;  3VV0 A;  3OBW A;  1NBE B;  2X4W A;  8AT1 B;  5LJ3 g;  2M0Y A;  1Y0M A;  4N4I A;  1JJ2 S;  1SKU B;  3I35 A;  2L89 A;  2AZV A;  4EMK C;  4LDW A;  1GCP A;  4JRI A;  2IIM A;  1KHC A;  3OYA A;  3EHR A;  2CP6 A;  3E19 A;  1N6A A;  2QYZ A;  3A8G B;  3BW1 A;  1QVF A;  5GAM e;  2MYS A;  2QEX A;  4MMK A;  1AEY A;  3OYN A;  5LJ5 e;  2RJE A;  1OEB A;  5GAO l;  2CZ0 B;  2YRV A;  2QTV A;  2F5T X;  4QVD A;  5GAN f;  3CCV T;  2RHZ A;  4M7D F;  2D9T A;  3VS2 A;  3CCS A;  1NJI U;  1KD1 C;  3VS0 A;  5DY9 A;  4A54 A;  2JXB A;  1ZSZ B;  2KDS A;  2BE9 B;  1YJW A;  1Y07 A;  3QJY A;  3EFO A;  4JJD A;  3CCU T;  3V8L A;  3M4Y A;  2ZPH B;  1ZX6 A;  1XNI A;  4C5I A;  4J9F A;  5GAN 4;  1VQ9 Q;  3LWI A;  5GMK i;  4FIB A;  4FW1 A;  1FYN A;  4OVA A;  5KH6 A;  1VQN A;  3BY7 A;  2DMO A;  3R6N A;  3EG3 A;  1ACM B;  4PJO F;  3TSZ A;  3QDR B;  2YDL A;  3CCL Q;  2EJ9 A;  3I56 T;  1G83 A;  1Q95 G;  2L5Q A;  2M1H A;  4J6Y A;  3RKW A;  5CKB A;  4KGV B;  4QT7 A;  1FX7 A;  4FYY B;  3DLL A;  1QVP A;  4PNO A;  2CSQ A;  3CD6 T;  3VYH B;  3OA6 A;  1VQ7 T;  5KCH A;  3ZFJ A;  1M9S A;  2D8J A;  2QDL A;  4LXC A;  4XU2 A;  1AZG B;  1FMK A;  1PCX A;  1YWO A;  2W10 A;  3FJ5 A;  4M4Z A;  1W2B S;  3EG9 A;  1XJW B;  2V26 A;  1D1B A;  3CCE A;  3P8H A;  1K73 C;  2D1X A;  2QK0 A;  2QQA A;  3QJ6 A;  5IAY A;  1KK7 A;  5GAN 5;  4XQ3 A;  3RKX A;  2E6Z A;  3MP1 A;  4PFP A;  2LQK A;  5D6Y A;  4ORZ A;  1QVF S;  1N8R C;  1G3T A;  3OS5 A;  2KRM A;  3OYF A;  1QVG S;  2DA9 A;  2BKD N;  4B9W A;  1OI1 A;  5IHK A;  4L59 A;  2RJF A;  5GJV B;  1I1J A;  1MNE A;  3A8O B;  3FDR A;  2KXD A;  4N0A A;  3LH0 A;  1MMA A;  4PJJ A;  4OB1 B;  3JCM c;  2QDY B;  4M7A A;  1H64 1;  4BI8 B;  3CPW P;  5FRO A;  1JO8 A;  1NZ9 A;  2A37 A;  1VQL Q;  2Y4Y A;  5LJ5 j;  2PU9 B;  2QA4 Q;  3M54 A;  1HYO A;  3SWN C;  1EIF A;  4C92 G;  5GAN 3;  1NJI R;  2O88 A;  3PIO A;  1IRE B;  2SRC A;  3EGX B;  2LJ3 A;  2DTO A;  4M78 F;  1PM3 A;  3M0U A;  1VQO A;  1I07 A;  2X3X D;  1JU5 C;  5CIU A;  5D6X A;  1BI0 A;  4ELZ C;  2DEU A;  4E7L A;  1VQP T;  3PTA A;  2HKQ B;  5IT9 E;  4FYW B;  1UGQ B;  3L2R A;  1Q82 R;  3RMS A;  2ZAE A;  2FRY A;  4Z88 A;  1X69 A;  5A0L A;  5LJ5 f;  1U06 A;  3OS1 A;  4V2S A;  4XTY A;  3JB9 F;  3JCM X;  3PFS A;  1VQ6 T;  2JTM A;  4OMN A;  4M75 E;  3RNJ A;  3KXT A;  5GAM j;  3CCJ T;  4XTX A;  1K9M C;  1NYF A;  5KE3 A;  4CC3 A;  3VS4 A;  1S72 Q;  3E2U A;  4CI0 C;  2CP7 A;  3OQ5 A;  2KGT A;  4Y28 E;  7AT1 B;  1PD0 A;  4OML A;  2NWM A;  4X9C A;  4F17 A;  1RLP C;  4R0K A;  3TRE A;  1X01 A;  1TG0 A;  1X43 A;  4J7I A;  4JDS A;  2EBP A;  2QTX A;  1X2K A;  4MZT A;  2FVU A;  3OMC A;  4M7A G;  1VQ9 A;  2CT3 A;  5KYY A;  4M77 F;  5FU7 B;  1UHF A;  2YXY A;  4PJO G;  3HHT B;  2KY9 A;  4BY6 B;  3BFM A;  2V1Q A;  1N8R U;  2RI5 A;  1YJN Q;  3WVD B;  2R58 A;  4GY5 A;  2FZC B;  1ZUU A;  4D8K A;  1NJI C;  3QDF A;  2E41 A;  4KUL A;  2QEX Q;  1FMV A;  2O4X A;  4ZN3 A;  4M78 B;  4M78 E;  3NGP A;  2QXF A;  1U8R A;  2OX7 A;  2DEQ A;  1M90 R;  2RHU A;  4TVR A;  1OOT A;  4GBQ A;  3CCR A;  4QVZ A;  3UT1 A;  3CCR T;  4PFO A;  2X4Y A;  2X3W D;  2DLP A;  4CC4 B;  3AT1 B;  1OYX A;  2XHC A;  1GXI E;  1UTI A;  4M75 F;  2GTJ A;  2O9S A;  1UJY A;  2A08 A;  1YIJ T;  3VYG A;  3RES A;  2ROT A;  3SWN B;  1F1B B;  4AMC A;  4ZGJ B;  4AG2 C;  5CKD A;  3CCV Q;  2ZCF B;  1VQM Q;  1H8K A;  4ELY C;  5HY6 A;  1SG5 A;  1M2O A;  4IIO A;  3CCU Q;  1RI9 A;  5GAO n;  4C0D B;  4M77 B;  2DTH A;  4MML A;  3F70 A;  1VQ9 T;  1X6B A;  5DLO A;  2H8H A;  1NLO C;  3SEM A;  1OPL A;  3TU4 K;  5I2M A;  1QCF A;  5KYN A;  2M02 A;  3JSC A;  3G71 Q;  1BI1 A;  4PKC C;  3CCL T;  1PD1 A;  5J26 A;  3I56 Q;  3J80 E;  1WHJ A;  2MOX A;  2GFA A;  4LDY A;  1JXO A;  3PNW C;  1QP3 A;  2MF2 A;  4F14 A;  1V29 B;  2LX9 A;  1S72 A;  4RTV A;  4CC7 A;  1JQQ A;  2K2M A;  3CD6 Q;  2CZ6 B;  1H92 A;  1WFW A;  1WHL A;  1KHI A;  1VQ7 Q;  2EQU A;  1Q81 C;  2EYQ A;  1MHN A;  1U5S A;  1RAF B;  1G5V A;  1WLP B;  3X28 B;  4PJO B;  5IXB A;  2RJC A;  2DRK A;  2HD0 A;  2DKG A;  3THK A;  1M90 U;  3OW2 S;  2E3I A;  2DVJ A;  2HZY A;  1YJ9 A;  3OSS C;  1BBZ A;  3PGG A;  1Q7Y R;  4OF1 A;  4LNP A;  2HDA A;  2D6F A;  3UPU A;  1UG1 A;  4BY6 C;  3QUI A;  1RUW A;  3HFN A;  1QP2 A;  3NPF A;  4WTO B;  3NMZ C;  3I9Q A;  2FPD A;  2JM8 A;  1M8V A;  4M78 D;  3WXM B;  1QWE A;  3CBM A;  2F2W A;  1W2B A;  4C8Q G;  1RAH B;  3M5A A;  4A4E A;  2KBT A;  2QA4 T;  2HKN A;  2BZX A;  2E10 A;  1RI0 A;  4VUB A;  3LW5 E;  2HQX A;  4C8Q B;  2KQW A;  5GAN d;  2NUT B;  3L2Q A;  1G2B A;  1AD5 A;  1S1N A;  2VAS A;  3TQ7 P;  1M3B A;  1SRL A;  4J83 A;  3RKY A;  2ZPI B;  3S3O A;  1VQP Q;  4EMK B;  1WNL A;  2L3Q A;  1TUG B;  2FYK A;  3J81 E;  2DPP B;  2P84 A;  3RDV A;  1PG5 B;  1E6H A;  3CEY A;  5IH2 A;  3L1A A;  2DET A;  2M16 A;  3N5B B;  4D8D A;  5FU6 C;  3EG1 A;  4RMO A;  1VQ6 Q;  1AWW A;  3MP6 A;  1W70 A;  2RK1 A;  3JV3 A;  3HSB A;  4M7D C;  5LJ3 h;  3M0R A;  1NPR A;  3CD6 A;  4Y92 A;  2M9U A;  1E6G A;  1S72 T;  4LD9 K;  1H3Z A;  4XTV A;  9ATC B;  3LGL A;  3VUZ A;  4AFU C;  4QKU A;  3PMT A;  1RAD B;  2AT1 B;  2MAM A;  3EGD B;  5IXF A;  4N4H A;  1WDX A;  5M9O A;  3UWN A;  3L42 A;  5KCO A;  4XU0 A;  1I5L A;  2HL5 C;  2PZ1 A;  2R5M A;  4Z8A A;  2A36 A;  1BK2 A;  1QMC A;  4LD6 A;  4KBM B;  4J5Y A;  1BB9 A;  2FEI A;  3GBQ A;  4OMF B;  2RJD A;  1DJ7 B;  3QSU A;  1YJW T;  1VOM A;  2EAY A;  4J6X A;  5GAO r;  1M90 C;  1YJN T;  3JCM h;  4X9D A;  2VYT A;  2RM4 A;  2ZPG B;  2K3B A;  2V8K A;  2QEX T;  2WAC A;  2WSE E;  2CP3 A;  1GCQ C;  1YIJ A;  5KYX B;  2HQH A;  4RTX A;  1GCQ A;  2RI2 A;  4OMP A;  3M4G A;  1VQ8 T;  2P0K A;  2R57 A;  1KD1 U;  1K9A A;  2J06 A;  5CCA A;  2P4T A;  3SD4 A;  4M78 C;  3L2V A;  2DER A;  1WJS A;  4M77 G;  1YCS B;  4OMM A;  2KT8 A;  3CCR Q;  1AWJ A;  5I22 A;  3FIF A;  2LJ1 A;  2LP5 A;  2QQB A;  4JPB W;  2QQ9 A;  2KAF A;  4BD3 A;  4MDW A;  3SFM A;  2K6D A;  2YUN A;  1IRX A;  1B3Q A;  5FLX E;  3CBO A;  1V1C A;  1VA7 A;  4JJN K;  3UA6 A;  5J39 A;  1X75 C;  2X35 A;  3CPF A;  1Y57 A;  2PTK A;  4FSX A;  1YIJ Q;  2B8A A;  4E7I A;  3CCQ Q;  4ME7 A;  4O5V A;  3EFS A;  2C0T A;  5GAO m;  2RHI A;  3H0F A;  4C0Z A;  1IGU A;  5EC7 A;  2B86 A;  1TH7 A;  4A4G A;  3MHX A;  2PVO B;  3GOX A;  3OYB A;  5GAN 2;  1VQM T;  3A8H B;  1YJ9 Q;  1CKA A;  3H9N A;  3IQL A;  3QXE B;  4JJB A;  2MWO A;  4KGZ B;  4C92 E;  4E7S A;  4M7D A;  2OAW A;  1VIE A;  1NM7 A;  1UGV A;  4OGC A;  5GAM f;  4ESR A;  2CP0 A;  4BE0 A;  1WHM A;  3RUX A;  4AFZ C;  2ED1 A;  3G71 T;  2YHT A;  4HVU A;  2JT4 A;  2HEQ A;  5LJ5 d;  2DIL A;  1GBR A;  1K76 A;  2M51 A;  3E9G A;  1TWB A;  2K2V A;  5GAO q;  2V8J A;  2RQU A;  3EFO B;  4KH0 B;  3M0S A;  4J9B A;  3OYK A;  5KYW A;  1BCM A;  2E65 A;  2G6F X;  5GAN g;  2HMA A;  4M75 G;  1ZUK A;  4RG8 A;  4PLI A;  2JMA A;  3OS2 A;  4N4G A;  1TSF A;  3I55 Q;  5GAN 6;  2IG0 A;  2ESW A;  4C0G A;  4C0F A;  2D0Q B;  1PSE A;  3QBY A;  1IHV A;  1W2B P;  2CUD A;  2RF0 A;  3MEU A;  4FL6 A;  1AWX A;  4BI4 A;  3SDZ A;  1W4S A;  1M1F A;  1RAE B;  1ZLM A;  3S6W A;  1AT1 B;  4HT8 A;  2EQJ A;  3FRN A;  4OB3 B;  2DF6 A;  1LVK A;  4FYX B;  3GNF B;  2X4J A;  1K9M U;  2CS7 A;  2JVV A;  4M7A E;  5CKF A;  5LJ3 j;  2RA2 A;  2XG8 D;  1EZZ B;  4NL2 A;  3REA B;  2KK4 A;  4PJO E;  2VGM A;  1VUB A;  2P0Q A;  4QW2 A;  4HKE A;  2QAS A;  3I5R A;  4OMQ A;  2DXB A;  3CMA Q;  2QI2 A;  2P4R A;  3JB9 G;  2YWW A;  3MO8 A;  3VRZ A;  4HCZ A;  4EMH A;  3GPL A;  4F7U B;  3EG0 A;  3MP8 A;  1D3B A;  2RQT A;  5IHI A;  3UAT A;  5GAN 7;  2L0A A;  2FRW A;  5C6S A;  5D7U A;  1JXM A;  2DO3 A;  3JB9 I;  3QWX X;  4M78 G;  2CSI A;  1UJ0 A;  4Z89 A;  2DD5 A;  1K0X A;  4Y91 A;  2BZY A;  2JOY A;  2A3L A;  2SEM A;  3MEV A;  2VGN A;  4RTW A;  1D0Y A;  4C8Q C;  4JLG A;  1BU1 A;  1M30 A;  4M7A B;  1KQS A;  1WHH A;  3G6E T;  3JCM W;  1YN8 A;  3INZ A;  5FWC A;  1YJN A;  2XD0 A;  1M3A A;  5FW9 A;  4C8Q F;  2KXC A;  4O6J A;  3EGX A;  1D0Z A;  5KYY B;  3JCM g;  2C06 A;  2VWF A;  1MV0 B;  4LDV A;  4RKU E;  4EPC A;  2OTL Q;  2EFI A;  1EFN A;  4JJC A;  1T0H A;  4A4K A;  2CH4 W;  2DYB A;  1G8X A;  1D0X A;  3I56 A;  1SSF A;  4RG2 A;  1M1G A;  1TOV A;  1I0C A;  3ZL7 C;  4M7A F;  1M3C A;  3M59 A;  5GMK h;  2RI3 A;  1PNJ A;  1T3S A;  4FU6 A;  4MZM A;  3CCU A;  1YJW Q;  1Y96 B;  1B7T A;  2YUQ A;  5LJ5 h;  2OTJ Q;  3S3N A;  1K8A U;  4PLL A;  2FZG B;  4M77 C;  2VB6 A;  5GJW B;  1R8O B;  2XDD A;  1X27 A;  3C95 A;  1X2Q A;  2V1R A;  3UF4 A;  1GFD A;  3PE0 A;  2A28 A;  1KQS P;  2QQR A;  4PJO C;  3ME9 A;  3TSW A;  2FO0 A;  2KT1 A;  2K4Y A;  4LDX A;  2YRC A;  1XOV A;  4BI3 A;  1CSK A;  1PWT A;  1Z9Q A;  3VS1 A;  4ZN1 A;  5CQY A;  1VQ8 Q;  2F1L A;  1K8A R;  1VQ4 T;  4JRP A;  3OBY A;  2YRD A;  1QLY A;  3H41 A;  4AT1 B;  1JRI A;  2EQK A;  2DTI A;  1HSQ A;  2QA4 A;  1LNX A;  2O4X B;  2DXU A;  2GGR A;  1BIA A;  4JZ3 A;  3DLM A;  2CGH A;  3U23 A;  3LX7 A;  4DEX A;  3CCQ T;  3JCM e;  1VQK Q;  3BDL A;  3KUF A;  4KRT A;  3URG A;  4NS5 A;  4HVW A;  4JS5 A;  2EPD A;  3V7C A;  5KYU B;  3CC2 A;  2HNI A;  2EGA A;  2CP2 A;  4OMO A;  1YJ9 T;  3OW2 A;  3TVT A;  5GAM g;  1ZA1 B;  2Z0W A;  2Y90 A;  3C4S A;  2KYM A;  1WJR A;  2F2X A;  4F7U A;  1UEB A;  3LYI A;  1D3B B;  4M77 D;  2K5I A;  2LDM A;  2J6K A;  2HBW A;  1ZHI A;  3SWN A;  3CXC A;  2AK5 A;  1JJ2 A;  1QCN A;  4IIM A;  3RMQ A;  2LCS A;  2LRQ A;  3QHS A;  4J9C A;  1YI2 T;  2QGG A;  2VC8 A;  3G71 A;  1VIF A;  2EKH A;  3JCM P;  1ZSZ C;  3I55 T;  3V7S A;  1CKB A;  3M9Q A;  3VU3 C;  1WA7 A;  3PT9 A;  3X25 B;  4EIK A;  2LCC A;  5FU6 B;  5CKE A;  1UUE A;  1D1C A;  2HAX A;  1VQM A;  4QQD A;  2JNG A;  2RH2 A;  5GAN h;  4E7H A;  3OYC A;  1TXQ A;  3NFC A;  1TS9 A;  1RAC B;  3OW2 P;  1SHG A;  3RR6 A;  3CC4 T;  2COZ A;  2J6F A;  1K73 U;  3TCJ A;  2RQR A;  2LQ8 A;  3JCM V;  1K8A C;  3OYY A;  1ZSZ A;  2J7I A;  5HK0 A;  3CMA T;  2BUD A;  2QQS A;  3EG9 B;  3HKS A;  4HVV A;  1H3H A;  2PVG B;  4KH1 B;  1TU0 B;  4RTY A;  2K5F A;  1WQW A;  5GAN j;  2EQI A;  3HL8 A;  1YNZ A;  1KJW A;  1MND A;  5CQX A;  5GMK m;  2LJ0 A;  2DK3 A;  1KQS S;  1HD3 A;  4J6W A;  1VQ8 A;  3MEW A;  1RAG B;  4XK8 E;  3X20 B;  2RB6 A;  2DAQ A;  2EW3 A;  1NPP A;  4C5E A;  1VYT A;  1JBM A;  2KSS A;  3ZBD A;  3LH5 A;  1AOJ A;  4M77 E;  1I4K 1;  2E1H A;  4M75 B;  3G6E Q;  4ZTF A;  1BI3 A;  4NOY A;  1WHG A;  1YP5 A;  2F2V A;  1J3T A;  5GAM d;  3C12 A;  3GNG A;  5HK3 A;  2Y4X A;  4JUV A;  2HBP A;  2LZ6 B;  4HCB A;  3M0T A;  4DA4 A;  2DBK A;  2AKK A;  2XID A;  4CRI A;  3A8L B;  1XTD A;  4XTU A;  3VS7 A;  3JCM b;  4B6M A;  1PSF A;  2OTL T;  3OYD A;  4N0A C;  2C0I A;  4EMK A;  2CP5 A;  1RLQ C;  1OU8 A;  2JM9 A;  3GF5 A;  3I5S A;  4FW2 A;  3CPW A;  1YHQ A;  2AKL A;  4AFS C;  4PJO D;  3CXC S;  2MPX C;  3NTK A;  4LUE A;  3OYM A;  4II1 A;  3QYG B;  2E6N A;  2OJ2 A;  3CCJ A;  3EAE A;  2KRS A;  4PJM A;  3PVQ A;  2MK5 A;  5LJ3 d;  3MCA B;  2OTJ T;  4X34 A;  3SB2 A;  2P0P A;  2CYZ B;  4RTU A;  4QQ6 A;  1K1Z A;  3NTH A;  2DIG A;  2JUF A;  3A1P A;  1MMG A;  2LCL A;  2KR3 A;  1ZBX A;  2LQW A;  1GBQ A;  2NYS A;  3FC3 A;  2MIO A;  2ED0 A;  1O75 A;  1WXB A;  1W1F A;  1RAI B;  5I11 A;  1OX8 A;  1VQO T;  1AWO A;  1UEC A;  4ATO A;  2MI6 A;  4J9G A;  1VQ4 Q;  1YIT Q;  1OPK A;  4KGX B;  1Q86 U;  3V8J A;  3LLR A;  1IZ6 A;  1KFZ A;  4C92 F;  2J05 A;  2K5L A;  3H0I A;  1K9M R;  5FRM A;  3P8D A;  2RQV A;  2DYI A;  4FT2 A;  1EX4 A;  2LTO A;  1N27 A;  2NUZ A;  3T9N A;  2ENM A;  5I21 A;  5AYF A;  2COW A;  1KG1 A;  1Y71 A;  1BYM A;  4DBH A;  1G3W A;  3Q1J A;  5IHN A;  3JB9 D;  5GAN 8;  3A5Z B;  1VQK T;  1UE9 A;  3ULR B;  1KC8 C;  4C92 C;  4JS4 A;  1IO6 A;  1SF9 A;  2JTF A;  3G1J A;  5GAN e;  2K79 A;  3QYH B;  2DX1 A;  3P8B B;  3L2U A;  2RHY A;  2NUP B;  3BE3 A;  3G4S T;  1G3Y A;  2LMJ A;  2LNV A;  1B07 A;  4C92 B;  3EH2 A;  2KRO A;  2DVE A;  1QW1 A;  2YLB A;  2FHD A;  3M57 A;  3KFV A;  2CKK A;  4XU1 A;  4RCB A;  3FLG A;  2VKN A;  1MMD A;  4DBQ A;  3FB9 A;  2XK0 A;  2HL3 A;  2DL5 A;  5A0D A;  2PQW A;  4BAC A;  3EFR A;  3MPU B;  2YSQ A;  4M78 A;  2GCX A;  1ABO A;  2JN0 A;  1YI2 Q;  1UGS B;  3O5Z A;  4RUG A;  4HT9 A;  3CCL A;  5HKC A;  4DOW A;  1U1T A;  1VQN T;  2VXF A;  3HP9 A;  1KD1 R;  1N9R A;  3O8V A;  4M7A C;  3VUB A;  1B34 A;  3MEA A;  4HCK A;  2GQV A;  2EYZ A;  1VQ5 A;  1A0N B;  2EKO A;  3RBB B;  2GF7 A;  3RIR A;  2YUP A;  2EQM A;  3ER0 A;  1YCY A;  3M55 A;  3OYJ A;  1OZ3 A;  3QPH A;  2DJZ A;  4C0D C;  2MCN A;  3G4S A;  3DKM A;  3EH1 A;  2CH4 A;  3CC2 Q;  3CCS Q;  2LC4 A;  3ASK A;  2HQE A;  1X6O A;  4HCC A;  2W0Z A;  2BIV A;  1LPL A;  3CC4 Q;  2CDT A;  2JMC A;  2DBM A;  2L3P A;  4F7U F;  1GFC A;  4LUD A;  2BZ8 A;  2KNB B;  1WYX A;  2PVD B;  4A63 B;  2D0N A;  4LE9 A;  2C0O A;  3EG2 A;  2E4H A;  3HRT A;  1Z9Z A;  1ZBJ A;  4OP0 A;  1VYV A;  3JCM d;  2BTT A;  2JZ2 A;  3VJP A;  2PUO B;  3CQT A;  3OYI A;  2LT4 A;  4DOV A;  4JRQ A;  4KUI A;  1KQ1 A;  2D8H A;  3CC7 Q;  2I0N A;  4FYV B;  1XQH A;  3CBP A;  2DL3 A;  1JJ2 P;  3TEE A;  4FSS A;  3H6Z A;  1ZQ1 A;  1U1S A;  2NLU A;  2ZPF B;  3OYG A;  4AG1 C;  3R6O A;  4JRK A;  3HFO A;  2EYW A;  2RQW A;  4F04 B;  1I5O B;  1M1K U;  3HRS A;  4J7F A;  1W6X A;  1ZSG A;  2E3H A;  4M7D G;  4F7U G;  2JS0 A;  1R0B G;  2DL7 A;  2LVM A;  3HRU A;  1WIE A;  5AT1 B;  2E5K A;  2X4X A;  1ARK A;  3NHN A;  3VS3 A;  1K4U S;  3UA7 A;  8ATC B;  4BE2 A;  2F5K A;  5L8R E;  1Q81 U;  1SPK A;  1SHF A;  4C8Q A;  1PRL C;  1UGP B;  1Y96 A;  4J9E A;  3AHU A;  4OB0 B;  3VRY A;  2DIQ A;  2EGE A;  1YHQ T;  1LJO A;  1P92 A;  3MJX A;  1UDL A;  4FT4 A;  2O31 A;  4D6W A;  2XDB A;  2CRE A;  2OTL A;  5CKH A;  2F69 A;  3VS5 A;  2XI9 A;  1HK9 A;  3CME T;  4IUU A;  4RCC A;  2DNU A;  2H3J A;  1VQ6 A;  2X9H A;  2JW4 A;  2XIC A;  2DL4 A;  4WF2 A;  3WVE B;  2DXC A;  4QQG A;  3JCM f;  2ZPB B;  2KEA A;  1OV3 A;  2PNI A;  4L6V 5;  4BE1 A;  4ZGE B;  3S3M A;  1FXX A;  1VQP A;  2CZ7 B;  1AVZ C;  2AIR B;  3EGD A;  4P5N A;  1MUZ A;  4J9D A;  1VQO Q;  2ZPE B;  3SHW A;  3E9F A;  1QVG A;  1SEM A;  1Q82 U;  2JS2 A;  3H0H A;  3V7R A;  1YIT T;  5LJ5 g;  4E47 A;  4UC4 A;  1SRM A;  4NL3 A;  1I8F A;  2PUK B;  4C5G A;  2YLC A;  2EYX A;  1VQL A;  1WHK A;  1M8M A;  2VUB A;  3CMA A;  4LDU A;  4M7A D;  4KT0 E;  2RN8 A;  1N8R R;  3M56 A;  4ZGD B;  1OQK A;  5IN1 A;  4B9X A;  1TUD A;  2EVR A;  5CK9 A;  3QKJ A;  3QZ5 B;  2M0O A;  5GAM h;  3CC4 A;  4PK4 A;  1N5Z A;  1D09 B;  4C5H A;  1G3S A;  3V8K A;  2ATC B;  2KI7 A;  3PIP A;  4FM4 B;  1I81 A;  2K3X A;  2CT4 A;  1Q81 R;  3M58 A;  3GP8 A;  2EJF A;  3G4S Q;  1C1A A;  4YTL A;  4AFQ C;  2DZ9 A;  4RTT A;  4IUR A;  5CR2 A;  1VQ5 T;  3I55 A;  4GLM A;  3CCE T;  3M0Q A;  4CC2 A;  1UFF A;  4MZP A;  1YFN A;  3QII A;  2X51 A;  4HXJ A;  4Q5W A;  4BDY A;  5L23 A;  1M27 C;  3L2W A;  1QKW A;  1VQ7 A;  3GLX A;  2DRM A;  4HA8 A;  1AZE A;  1M2V A;  1QVG P;  3OY9 A;  1YI2 A;  5C0M A;  1T3L A;  2GTO A;  4IUV A;  3JAM E;  1KQ2 A;  2EYY A;  1LOJ A;  1IXD A;  2CZ1 B;  5KYX A;  1AHJ B;  1ZA2 B;  1NEG A;  3H8Z A;  1QWF A;  3QG1 A;  1VQN Q;  2QG9 B;  3JRZ A;  1YWP A;  2E64 A;  2LX7 A;  3MET A;  2DD4 A;  2KMT A;  2XMF A;  1PKS A;  2AHJ B;  1Q86 C;  5CAI A;  4F16 A;  4M7D D;  1BIB A;  4E7Z A;  1FWZ A;  2A7Y A;  3CCS T;  3CC2 T;  4MDX A;  1K0S A;  3CCV A;  3NTI A;  1MV3 A;  2I2L A;  2DFU A;  1VQK A;  3CCQ A;  5CO7 A;  5GMK j;  3JCM J;  3QZ9 B;  1SSH A;  1WXT A;  5KYW B;  4C92 D;  3CXC P;  3CCM T;  1PRM C;  2ROL A;  1UB4 A;  1ABQ A;  4IUP A;  3DB4 A;  2KYB A;  2JTE A;  2LQN A;  4M75 A;  2JJ9 A;  3OYH A;  4M7D B;  1HJD A;  3X24 B;  1NLP C;  2IPO B;  3D7S B;  3OYE A;  1VYU A;  2HSP A;  2XDP A;  1VQ4 A;  1OUL A;  2DZC A;  3BDU A;  3CCM A;  5LJ3 f;  2HCK A;  4XTW A;  1Q7Y C;  3CC7 T;  2A0F B;  1OU9 A;  1O9S A;  2L2P A;  2VVK A;  4RTZ A;  3UDC A;  2GQI A;  1WJQ A;  4E7J A;  1BCO A;  1X6G A;  1K73 R;  4DQ2 A;  3VKI A;  2IVW A;  4EDU A;  3M0P A;  1KIK A;  2OTJ A;  2HSE B;  1QKX A;  2EIF A;  3JB9 H;  2YUO A;  1IHW A;  3X26 B;  3OB9 A;  2COY A;  5DLQ E;  2BE7 D;  2RO0 A;  2YT6 A;  4WCI A;  4FCY A;  4JZ4 A;  1OZ2 A;  3OS0 A;  5LL6 S;  1PC0 A;  3EGU A;  4BB7 A;  3HTR A;  1BI2 A;  3FEO A;  3OMG A;  2AZS A;  1Q7Y U;  2KE9 A;  2QAZ A;  1YHQ Q;  2GFU A;  4Z02 A;  1HXD A;  1V76 A;  2O9V A;  5CVI A;  5I2S A;  2VV5 A;  2FL7 A;  4PL6 A;  4OGE A;  1OX9 A;  1WXU A;  1BKB A;  2EGC A;  2LNH B;  1NE8 A;  4A4F A;  1WX6 A;  1MMN A;  2K9G A;  2OAU A;  3CME Q;  2KRN A;  1WZO A;  1KC8 U;  4M77 A;  4GLK A;  1N9S A;  4M75 C;  2QGF B;  5GAO p;  4JLI A;  2GBQ A;  1GRI A;  1QVF P;  1TUC A;  4IUQ A;  3G7Z A;  1QQJ A;  2KVQ G;  1Q86 R;  2E12 A;  4DEY A;  1M2V B;  2MMP A;  3G6E A;  5DM7 R;  3QWY A;  4IKF A;  1JEG A;  4DBR A;  1FMW A;  2MWP A;  2VXE A;  2RK2 A;  2EWN A;  5ECA A;  1UGR B;  3KBG A;  3OYL A;  4PFZ A;  1R77 A;  3M53 A;  2DJQ A;  6AT1 B;  2RMO A;  3OSV A;  1E7O A;  3REB B;  4E6R A;  5J3B A;  2G3R A;  3PVL A;  1RAB B;  3A98 A;  2RD1 A;  4PJO A;  3RER A;  3L2Z A;  2OI3 A;  4XTZ A;  4EMG A;  3VS6 A;  1M1K C;  2DXT A;  2NUP A;  5D6W A;  4L5G A;  1WPY A;  3C94 A;  2O01 E;  2ABL A;  1VQL T;  4M75 D;  5HCK A;  5FWB A;  5FRN A;  2RPN A;  2XU8 A;  4ZTJ A;  5KE2 A;  1IB8 A;  1WQ7 A;  5GMK e;  4A4H A;  3JB9 J;  1YIT A;  1T0J A;  4C8Q D;  1QCO A;  1Q82 C;  1JB0 E;  2E70 A;  1NYG A;  3GIB A;  2LT1 A;  2K3Y A;  1KSW A;  4OB2 B;  2R5A A;  2RNA A;  4BDZ A;  1M4Z A;  4BUG A;  2CUB A;  4E2F B;  4X1V A;  4E7K A;  5A0G A;  1MGQ A;  2FB7 A;  2FPE A;  2ECZ A;  2L8D A;  1R0C B;  4K11 A;  1VQ5 Q;  3CCE Q;  1M5Q 1;  1RL2 A;  1UHC A;  2E5Q A;  5EG2 A;  2NUT A;  3LGF A;  4R56 A;  1M1K R;  2L3R A;  3CCJ Q; 
#chains in the Genus database with same CATH homology
 1TSF A;  1TS9 A;  2ZAE A;  1V76 A;  1OQK A;  2KI7 A;  1PC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...