2KI7A

The solution structure of rpp29-rpp21 complex from pyrococcus furiosus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
111
structure length
111
Chain Sequence
QGSYQEIIGRTWIFRGAHRGRVNKKNIVWHELIGLKVRVVNSTHPGYVGIEGYVIDETRNMLVIAGENKVWKVPKDVCIFEFETWDGTKIKISGEKLVGRPEMRLKKRWRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 1
publication title Solution structure of an archaeal RNase P binary protein complex: formation of the 30-kDa complex between Pyrococcus furiosus RPP21 and RPP29 is accompanied by coupled protein folding and highlights critical features for protein-protein and protein-RNA interactions.
pubmed doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
total genus 15
structure length 111
sequence length 111
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 2ki7A00
1PC0A 1TSFA 2KI7A 2ZAEA 1OQKA 1V76A 1TS9A
chains in the Genus database with same CATH superfamily
2KR3A 2NUTA 2DK3A 1FMVA 3OB9A 1AWJA 3QKJA 2RMOA 1VQKA 4CC4B 2JS2A 4AG1C 5CR2A 1IGQA 2E64A 5IHIA 1QP3A 1PHTA 4QQGA 2HNIA 4FYVB 1R0CB 3HRTA 4BE0A 1YITT 2G6FX 2DAQA 1QP2A 1OI1A 3L2WA 4KULA 1W2BP 2L3RA 1M5Q1 4J9DA 1O75A 5FROA 1SPKA 3M4YA 2JM9A 2YT6A 3S3MA 2K3BA 1H8KA 4FW2A 3NFCA 4ZN3A 3EFOB 5L8RE 1AZEA 2CP0A 3DKMA 5J26A 1IZ6A 3A8LB 3CMEQ 1I5LA 3CMAA 4Z89A 3M57A 1OEBA 4PFOA 1LJOA 1VQ5A 3L2VA 3MEWA 2LZ6B 3QYHB 1EX4A 1VQMT 1W4SA 2MOXA 4RTVA 3MCAB 3TSZA 2ZPIB 2DTHA 2RQRA 3M9QA 1N8RC 3QWYA 1TG0A 5HY6A 3JCMb 1YJWA 3FB9A 1VQNT 4B9WA 3JB9J 1MUZA 3CC2A 4E47A 3EGXA 1ZBXA 4ANJA 1GCQA 4ZTFA 2L2PA 3JCMf 5GJWB 4L6V5 1Z9ZA 2EBPA 5KYWA 1Y7XA 2HAXA 4RG8A 2P84A 4M7DF 2HQXA 4NS5A 1RADB 2HL3A 1AD5A 2QGFB 1HD3A 4FT2A 2DO3A 2LCLA 1NYGA 4EMHA 2YRVA 2HDAA 4M7DG 3WVEB 4C8QB 3FEOA 2E3IA 1EFNA 3CXCA 1M8VA 1G2BA 3MHXA 5HK3A 1HJDA 5GANf 4QVDA 4MDWA 1D1AA 4M7DC 2CP5A 1QLYA 4OMMA 1AT1B 1M90R 4L59A 4BACA 2YRDA 3VS3A 2M51A 3A5ZB 4C8QE 4RTXA 2LJ3A 2DILA 2EIFA 1CKAA 1K9AA 1RABB 3S3OA 1WHGA 5LJ3d 1RAEB 1BK2A 1OULA 2PVOB 2ZPHB 3ZEHA 2XHCA 4M75D 1GXIE 2RHXA 4F04B 1YI2Q 1WGSA 2K4YA 3F70A 3HRUA 5LJ3e 4XTVA 4A54A 2BTTA 2EVRA 3CCSQ 1LOJA 3QO3A 4GY5A 2CDTA 2ZPBB 2DNUA 1YHQQ 2ZGWA 2C0TA 2RJDA 1M3CA 2XG8D 1WLPB 2O9SA 3E2UA 4QVCA 2DX1A 3LW5E 3RESA 2DERA 3G71A 1W2BA 3LLRA 4PK4A 2V8IA 4YTLA 4P5NA 1Y96A 2YLBA 1E7OA 2JVVA 5LJ5d 1H641 4LD6A 4MMLA 2IPOB 4JRPA 3PVLA 1TUDA 5LJ3h 3ER0A 4DBFA 2FZCB 1G5VA 4JLIA 2QG9B 5LJ5e 4A4EA 1ZUYA 4OGEA 1T3SA 1Q86U 2DTIA 2RK1A 2EQMA 4JS5A 2FYKA 3CPWP 2CSIA 3QZ9B 2HQHA 4M7AD 4EIKA 3GPLA 1QVGP 1JJ2P 3JCMW 4RKUE 3GNFB 2DL4A 1RL2A 1NBEB 4F17A 3NHNA 2M1HA 2P4RA 1VA7A 4JJBA 2GFAA 2CKKA 1D1BA 3WVDB 1YIJA 1BB9A 1D1CA 4CI0C 3QBYA 4PJOB 3NPFA 1X01A 5FWCA 3I5SA 1VQ9Q 2XU8A 3QXEB 2RPNA 5LJ5h 1ZHIA 2O88A 1XQHA 4E7KA 3TSWA 2IG0A 1TXQA 2DBKA 2RHYA 1Y71A 2CT4A 1WDXA 3N5BB 4RTYA 1SSFA 2QEXQ 3I55Q 4PJOE 4JJNK 1FMWA 1YCSB 1S72Q 4AFZC 5FRMA 2I2LA 1I1JA 3RUXA 1RAIB 2DJZA 1LNXA 1NLOC 1QCNA 2LNHB 3EGUA 2KNBB 4ZGDB 1VQ7Q 2K5LA 5GAOm 1X27A 3GLXA 2AZSA 1T0JA 2EYQA 3KXTA 2JT4A 2DL3A 3A8MB 3REAB 4DQ2A 3HTRA 2RJFA 1VQPQ 1R0BG 2EJGA 2M02A 2LCSA 3EHRA 2CYZB 4M78D 3G6EA 2KI7A 1NEBA 1NJIU 1RLQC 1HXDA 1BIBA 1AWWA 1UECA 2FZKB 2RM4A 4EPCA 3OS0A 1WHLA 1OU8A 2XDPA 3M0UA 4HT8A 3H0FA 4JS4A 3CCRQ 5GAN2 3OS2A 3EG0A 5J39A 1IHVA 2JS0A 2EYZA 2LQWA 4JJCA 2O4XA 3VUBA 4KH0B 4M75A 1NPPA 3SWNB 1K8AU 2WACA 4C92G 2AZVA 2K9GA 2HZYA 1ACMB 4GLMA 1VQ8Q 3URGA 2C0OA 4DEXA 2YXYA 1CSKA 2A7YA 1W70A 4X1VA 3KFVA 2K7AA 4C92C 3RMSA 2JOYA 1ARKA 4F16A 1IB8A 3JCMc 4OVAA 4BI4A 2ECZA 1EZZB 3MEVA 1YP5A 2J6OA 1Q86C 2DLPA 5GMKm 2DVEA 4XU0A 8ATCB 3EG2A 2JM8A 3CCVA 2D9TA 3UA6A 3I56Q 2E5KA 5KYXA 1YNZA 1NE8A 1TU0B 2WSCE 2CT3A 4CRIA 3O8VA 2GNCA 3CCST 1FXXA 3CPWA 1JU5C 2FL7A 2L89A 3RBBB 2PNIA 2EYXA 1YHQT 4PJLA 4F7UB 2FG0A 4LDWA 1JJ2A 1QVGA 3MEUA 2F2XA 2LX7A 1Q95G 1VQMQ 5KYUA 4BDZA 3U23A 1UTIA 2KAFA 2KK4A 2GQIA 3M58A 2CZ7B 3A98A 4PFZA 5LJ3f 3I35A 4M77D 1W1FA 2PU9B 5IN1A 3OW2S 4M7AA 2FHDA 3TREA 2D0QB 4FW1A 1QQJA 3CCMQ 4F7UE 1VQNQ 3JCMX 1UJYA 4A4FA 5GAN6 3OYCA 1M8MA 2LRQA 3LX7A 2X4YA 1JQQA 3OSVA 1TS9A 1NEGA 2D8HA 1B3QA 1RUWA 2JZ2A 4XTUA 2AHJB 4OGCA 3CC7Q 3EH1A 4C92B 5CAIA 2RF0A 2CH4A 2YSQA 2SEMA 2DKGA 1WJRA 2DD4A 2DJQA 1MMGA 3DB3A 2LC4A 3QHSA 2NUTB 2YHTA 2LX9A 3VS2A 2MCNA 4KGVB 3OS5A 3RKXA 3CCJQ 3CCLA 1NJIC 2KVQG 1WIEA 4JJDA 4OB3B 1BIAA 3OYMA 2KROA 3VS1A 1UGQB 4C92E 5LJ5f 2OTLA 2BIVA 1FWZA 4LNPA 3HSBA 2RQUA 5GMKj 1VQLQ 3OSSC 1KD1R 4QQDA 4C5EA 2JW4A 4E7ZA 4HKEA 2K2VA 3M0TA 3CMAQ 1VQ9T 1V76A 4ELZC 3QG1A 4LUDA 1M2VB 1HSQA 3UT1A 2KBTA 1K8AC 2J6FA 4M78A 1BCMA 1X6BA 2QEXT 2NWMA 2X4XA 2K3XA 1WZOA 2LNVA 3I55T 5GANj 1S72T 4F14A 4C0DB 2X9HA 3X28B 1YJWQ 4EMGA 2DXUA 1VQ7T 3CD6A 2NUPA 2K6DA 2A0FB 4IUTA 4KGZB 5GAMj 1UHCA 4BDYA 1JEGA 1VQPT 4AFQC 1WPYA 3BW1A 4O6JA 1OYXA 1YITA 3NTHA 2LJ0A 3QZ5B 1QMCA 4LDUA 3BY7A 4HT9A 4E2FB 5IHNA 5IXBA 4NOYA 2ED0A 4II1A 4L5GA 2R58A 3L2QA 1K9MU 1UJ0A 4DBHA 3JCMQ 2E5QA 3CCRT 2QA4Q 3FIFA 5EG2A 1PD0A 3C12A 5KYWB 2KRNA 3S6WA 2MF2A 2VVKA 1K9MR 3PIPA 1VQ6Q 1AVZC 3CCEA 3DLLA 4FIBA 3HP9A 1VQ8T 4ESRA 4PKCC 3I5RA 3CCUQ 1GCPA 1Q7YR 2MMPA 2DL5A 3S3NA 2COYA 1RAFB 3EFSA 1UEBA 4C8QF 2BUDA 1D3BA 4A4HA 2H3EB 1FYNA 2DVJA 3GIBA 3OYYA 1YJ9A 1OQKA 1TUGB 1H3HA 4C8QG 4ZGEB 4J7IA 2HBWA 1UGPB 2EPDA 1SEMA 2MWOA 4M77A 3I56T 5A0LA 5A0DA 1TOVA 2PUKB 2HKQB 3A1PA 4C8QC 3GBQA 3L2ZA 1KC8R 2HSPA 1MNEA 2ROTA 2EQJA 1RAHB 1ZSZA 5GAN7 2CP7A 4ME7A 2JTMA 2W10A 3H41A 1GL5A 3HHTB 5GAMg 3JB9G 4DEYA 2R5MA 4HVUA 4IIMA 3HPWA 3VKIA 2EYWA 4XU3A 1BI0A 3BDLA 1D0ZA 3UATA 4DOWA 1XOVA 2A28A 3PMTA 1I81A 3P8DA 1NPRA 3CCMT 1LVKA 2V26A 4FYXB 1OX8A 2COZA 3PIOA 1WXTA 4XTZA 2DXBA 4J83A 4XTWA 3KUFA 1Y96B 2ATCB 1PC0A 3Q1JA 4RG2A 2RN8A 2YWWA 1QVFP 4CC2A 4D8KA 4J7FA 3EG1A 1SRLA 2A37A 3UDCA 4WF2A 3CC7T 4R55A 2YUOA 4BE2A 2CZ0B 5GAN5 2E4HA 4E7LA 4QVZA 1KQSS 2CP3A 2LT1A 2CP6A 4AG2C 1YIJQ 2HL5C 1NLPC 3CCJT 3PGGA 5GAOq 5EC7A 3VS5A 1WX6A 2RB6A 4HCKA 4FCYA 3AHUA 3G4SA 1ABOA 2EGAA 2QQRA 1LPLA 2FRWA 1M90U 1VQLT 4FL6A 3VYHB 2M0OA 1VOMA 5GAN4 4XAXB 3CMAT 1BYMA 2KXCA 5I21A 2HSEB 3J80E 4AFUC 2F2WA 4PJOF 1ZX6A 1KSWA 2FPEA 3VRZA 3OYJA 2WSFE 3A8OB 4J9HA 2QTVA 3RIRA 1PNJA 3KBGA 1GBQA 4PJOG 3E19A 1N9SA 1TTHB 3UA7A 3CC4Q 3OBYA 1YJWT 5L23A 2DRMA 2RHIA 4KH1B 2R5AA 2VYTA 4UC4A 4N4GA 2JJ9A 4PJOC 4C0FA 4J9EA 3JB9H 1I5OB 5ECAA 1G3SA 2DE0X 2EFIA 2K79A 1K4US 3G6EQ 4M7DD 1JO8A 7AT1B 3FLGA 3MJXA 3H8ZA 4J5YA 2RD1A 1QKXA 3GF5A 1IXDA 1X69A 4OP0A 2I0NA 3V8LA 3UF4A 4DBQA 1B07A 4AT1B 1BI1A 1AOJA 1KG1A 2SRCA 1ABQA 2RI2A 4C5GA 4EMKA 2QA4T 3SD4A 5DLQE 3GOXA 1GFDA 3VS4A 1Q81R 3CMEA 1TSFA 3H9NA 3L2RA 1VQ6T 4ELYC 1IHWA 4KGXB 4LDVA 4N0AC 1QCOA 2FEIA 1WJQA 4RTZA 3WXMB 2D0NA 4D8DA 1EIFA 3PVQA 3QJYA 3MP1A 5FW9A 4K11A 3CCUT 4XQ3A 1J3TA 2V1QA 3INZA 4RUGA 2O4XB 1XNIA 1PM3A 2V8JA 4C5IA 4M75B 5FLXE 2B86A 2BZYA 5HKCA 2KYMA 2CGHA 2VXFA 5FWBA 4KUIA 3CCVQ 1G3WA 4E7IA 1Y0MA 2ROLA 2K2MA 1K0SA 4JPBW 2MPXC 4X9CA 2DRKA 1Q82U 1M27C 2DFUA 3LWHA 1X6OA 3H0HA 5CVIA 3P8HA 3X26B 4M75E 3LWIA 3SWNC 1UE9A 1M1GA 2ZCFB 1QVFA 2RI5A 4AFSC 1Q82R 5GMKi 1XJWB 2D8JA 5CCAA 3PT9A 4RTWA 4J9CA 4HCZA 1M90C 2EQIA 1NM7A 2L3SA 3CXCS 1PD1A 1N27A 4FSXA 2DIGA 4OMFB 2G3RA 5IAYA 3M54A 1BKBA 2QDLA 2QQBA 1RI0A 3META 1OX9A 2E1HA 4F7UF 2OTJA 2KE9A 3X20B 4XU1A 3QPHA 4PL6A 4FYYB 1QWEA 5KYUB 3EG9A 3RNJA 2Z0WA 3HRSA 1VQ4Q 2XDBA 4F7UG 2RI3A 1UUEA 5GAN8 4M7AB 3H6ZA 3OYFA 2VB6A 2ENMA 2VWFA 1X75C 1C0MA 4JRQA 5J3BA 1QKWA 1KHCA 3SFMA 4GLKA 2ESWA 1U8RA 1YCYA 4NL2A 4B6MA 3OYIA 1YI2A 2OTLQ 4C92F 4M7AE 3VS6A 1KQ2A 1YIJT 1UGRB 4JUVA 1FMKA 2DEUA 2KGTA 2P0PA 4DOVA 2RK2A 1E6GA 2DIQA 1W2BS 3PE0A 2COWA 1YHQA 3OYNA 1H3ZA 2X4JA 1M2OA 3ULRB 1W6XA 1KHIA 1FX7A 2J7IA 1MMAA 3DB4A 1TH7A 2RO0A 1DJ7B 2HQEA 1YJNA 1V29B 1U1SA 4M7DA 2O2OA 3FJ5A 5KE2A 1MV3A 4JRIA 3OYDA 1M1KR 3CCQA 2FO0A 3E1SA 3CD6Q 3V7SA 2XDDA 1WHKA 3PTAA 4J6WA 3CC4T 3ASKA 4M78B 2E6NA 3M0PA 2FPFA 1UGVA 4D6WA 4MZPA 5CKFA 2EGEA 1VQOA 1PWTA 4IURA 4J6XA 3QDRB 3RMQA 3OYHA 3MEAA 2F69A 1K73R 3C0CA 4O5VA 2OAWA 2DYBA 1VIFA 3G6ET 1VYUA 2KQWA 3FC3A 1X43A 4LUEA 2B8AA 4E7HA 2DYIA 2NUPB 5GAN3 3EGDA 2IIMA 4M78E 4OB2B 3VRYA 2RH2A 2F5KA 4LN2A 3CEYA 3L1AA 4B9XA 2RHUA 3QWXX 2MAMA 3OMGA 4R0KA 1SF9A 1R8OB 3E9FA 3V7CA 4C0DC 3OMCA 2HMAA 4J9IA 4X34A 2DZ9A 3CCEQ 1AEYA 1ZLMA 4QKUA 2LTOA 3E9GA 1VQKQ 2QEXA 1S72A 2WSEE 1OOTA 1JXOA 2HEQA 2QXFA 1WHMA 5I2SA 2PVGB 5GMKe 1UFFA 1YJ9Q 2XMFA 3SB2A 4BE1A 2P0QA 2XICA 5KYYA 3UWNA 4ORZA 3CCVT 1KD1U 1GCQC 4MDXA 5GANd 4FM4B 2RQVA 5FU7B 1ZSGA 4WCIA 2KYBA 3A8GB 5GANe 1SG5A 4FSSA 2LCCA 2Y4XA 1XTDA 1UGSB 2DTOA 4OMNA 5GAMd 1TUCA 2K5IA 1VQ5Q 4M77B 2K3YA 3EHQA 2CUDA 5GMKh 5DY9A 2DMOA 4V2SA 4LE9A 5GAMe 4PFPA 2VUBA 1JB0E 4JLGA 3H0IA 1P92A 2MYSA 4JZ3A 3PNWC 5CKDA 3JCMV 1ZQ1A 4M77E 1ZUUA 2AT1B 3CC2Q 4PJMA 1N8RU 1X2QA 2JMCA 2F2VA 5GANh 2VXEA 1PKSA 1VQ4T 3CPFA 4ATOA 2DXCA 3JSCA 1YFNA 1N8RR 4CC3A 2KT8A 3JV3A 8AT1B 1RAAB 5KYNA 1N6AA 3DLMA 3OYEA 3OYBA 5GAMh 5CK9A 1SRMA 3EGXB 3I56A 1NG2A 3JCMP 3CPWS 2YDLA 3M55A 4JDSA 5FU6B 5CO7A 2OTLT 4J9BA 3EFRA 5C6SA 3T9NA 4BUGA 4R56A 1Q7YU 4HCBA 6AT1B 4XTXA 1R77A 1OZ2A 1WNLA 2KRSA 2MI6A 3JCMg 1T3LA 3C4SA 3TQ7P 4E7SA 2CH4W 1VQMA 4A4KA 4BI8B 2DZCA 4MZTA 2X3WD 3RDVA 5KH6A 2GTJA 3OS1A 2M9UA 1LCKA 1B34A 4RTUA 3CCMA 5GAOn 5IHKA 2X4WA 3R6OA 1VQNA 2D6FA 5IH2A 2M0YA 1MMDA 3ZL7C 1KC8U 5CKEA 3CD6T 3D7SB 2OAUA 4QT7A 1WXUA 1RAGB 4PNOA 3OY9A 1HYOA 2QASA 2DL8A 3OYGA 2MIOA 3CC7A 4Z02A 3M5AA 5GANg 3RR6A 1KQ1A 4AMCA 1KD1C 1IREB 4C0GA 3JB9F 1BI3A 5IT9E 2DF6A 2X3XD 1VIEA 3NTKA 3OYKA 2DA9A 4GBQA 3G71Q 3CCJA 1M2VA 4IIOA 1IRXA 3VS7A 1UB4A 1WYXA 1AZGB 2JXBA 2E12A 1ZA2B 4A4GA 1VQLA 1GBRA 2NLUA 2RJEA 2NUZA 4HA8A 1NZ9A 4QQ6A 3OA6A 4FYWB 2O9VA 1KJWA 2F5TX 3QIIA 3CCET 1D09B 2EW3A 4C8QD 1K0XA 4FU6A 3QDFA 1MNDA 2BE9B 1M4ZA 2EQUA 1E6HA 5D6YA 2H3JA 1WXBA 2ZPEB 3I9QA 3PFSA 2HD0A 1VQKT 2ZPFB 4EMKB 5KE3A 3JAME 3MPUB 3TVTA 3GP8A 1AWXA 1BBZA 1A0NB 2HKNA 3J7AF 4ZGJB 2PVDB 2VC8A 1YJ9T 2HBPA 2RQTA 5KCHA 1ZA1B 2ZAEA 4KUDK 3RERA 4TVRA 3VV0A 2NYSA 3IQLA 3OYLA 3JRZA 3JB9D 4LD9K 2CP2A 4BY6C 4M75F 4PLLA 2LJ1A 2CS7A 2QAZA 3GNGA 3X24B 2XK0A 4A53A 3A8HB 1PG5B 2RQWA 3M0SA 1G3YA 2QK0A 1K9MC 4X9DA 3P8BB 3OW2P 2R57A 3BDUA 4OB0B 4M75G 3JB9I 4XU2A 1Q7YC 1OZ3A 1VQ5T 1PCXA 2EGCA 2X51A 2QA4A 4M75C 4JRKA 2RNAA 1D0YA 5M9OA 3J81E 2GQVA 2MK5A 4LXCA 2OTJQ 1VQ6A 1M3BA 4RCBA 1WHJA 1WHHA 1WI7A 2LQ8A 2E70A 3M0QA 3R6NA 1Z9QA 2PTKA 2VASA 3CCUA 3NMZC 3V7RA 3CC2T 4NL3A 1O9SA 2VV5A 1QVPA 3V8KA 1I07A 2FPDA 4OF1A 2LQKA 1KC8C 2QTXA 4Q5WA 1M1FA 1PSEA 5GAMf 2EKOA 3EFOA 3VUZA 2L8DA 2W0ZA 2J05A 2RHZA 2AIRB 1H92A 3EG9B 1WQWA 1JBMA 4LDXA 4M7AF 1Q81U 3O5ZA 2EWNA 1IGUA 3NTIA 5D7UA 2BZ8A 5A2QE 4VUBA 5AYFA 2FVUA 3LGLA 3NGPA 4BY6B 3G4ST 2EAYA 2LDMA 2AKKA 4PJOD 4M7AG 2BZXA 5CQXA 5GAOr 1AWOA 3UPUA 2LT4A 4Y28E 5LJ3j 4XK8E 1WQ7A 4RTTA 3THKA 1YJNQ 1BI2A 4M7AC 4KT0E 3HKSA 1PRMC 1I4K1 1AHJB 4IUPA 2KXDA 4PJJA 3C94A 3MP8A 4OMLA 4C5HA 2JTEA 3L42A 3CCQQ 5HK0A 2K5FA 2J6KA 4XTYA 1N5ZA 4Z8AA 1V1CA 4E7JA 5AT1B 5I11A 4OMQA 2QQ9A 4M7DB 2KSSA 2FZGB 4LDYA 2JMAA 1VQOQ 1X2KA 5C0MA 4Y91A 3EH2A 2PUOB 1G8XA 2L3QA 5DM7R 1Q86R 4C8QA 3HFNA 4M78F 1WJSA 5LJ5j 2QQSA 2EKHA 4IUVA 3HL8A 4M7DE 1RACB 1Y57A 2JN0A 3HFOA 5KYXB 1OPLA 2GF7A 3G71T 1K76A 2DETA 1MMNA 3FDRA 3SEMA 2CSQA 4M78G 2EJFA 5D6XA 1N9RA 5LL6S 2Y90A 2K57A 2CZ1B 2J06A 2DPPB 3EGDB 5CIUA 2O01E 2QI2A 3CMET 4M78C 1QWFA 3OW2A 3TEEA 1G3TA 4M4ZA 3M56A 2KDSA 4N4IA 1PSFA 4MMKA 4JZ4A 2YUQA 2GTOA 4C0ZA 2XKOC 2XIDA 3M53A 4PJNA 1SKUB 1VYVA 1T0HA 5GAOp 2GGRA 1SSHA 3CC4A 2P0KA 3LH0A 5LJ3g 1OPKA 2GFUA 3CCLQ 1MGQA 2D1XA 1RLPC 1YN8A 2KRMA 1UG1A 3CCSA 3ZBDA 3OQ5A 2DEQA 1WA7A 4J9FA 1IO6A 3RKYA 3VU3C 1Q81C 4J6YA 5KYYB 2E65A 3SHWA 4E6RA 4IUQA 2M16A 1NJIR 1M30A 1M1KU 4N4HA 2DD5A 3QSUA 9ATCB 5GAOl 2FB7A 4OMOA 4BB7A 2PQWA 1UDLA 3C95A 4OMPA 3ZFJA 2EJ9A 3MKDA 4EDUA 3TU4K 1MV0B 1Y07A 3M59A 1C1AA 5LJ5g 2OTJT 4M77F 3LGFA 3L2UA 1NYFA 5FU7C 4OB1B 1K73U 4Y92A 1K8AR 1YWOA 1KQSP 2QQAA 1GRIA 2JUFA 1VUBA 2YRCA 2CZ6B 1YITQ 2V1RA 3V8JA 3M0RA 4M77G 4PJOA 3BFMA 1WFWA 1QCFA 3EG3A 2L3PA 2QGGA 1Q82C 1M3AA 2KMTA 1M9SA 4WTOB 3M4GA 4C92D 4M77C 2VKNA 1KFZA 4KBMB 5KCOA 2L0AA 4HVVA 3BE3A 2ABLA 1TWBA 2C0IA 1QVFS 3FJPA 5I2MA 1YI2T 4RMOA 3EAEA 3FRNA 4ZN1A 1ZSZC 1F1BB 4MZMA 2E10A 3VYGA 1VQ9A 2ED1A 3JCMd 4PLIA 2LQNA 2YUNA 2MWPA 2DBMA 2C06A 2PZ1A 2BKDN 2YUPA 1MHNA 5GJVB 1G83A 2F1LA 3JCMe 2BE7D 1JRIA 3I55A 4N0AA 1YJNT 2OJ2A 2OX7A 3CQTA 2H8HA 3QUIA 1YBYA 3G7ZA 2IVWA 5GMKl 3MP6A 1B7TA 4BD3A 1I8FA 2CREA 1VQ7A 3CCQT 2P4TA 2LP5A 3LH5A 5FU6C 1OV3A 2XI9A 1VQPA 1VQ4A 4Z88A 5IXFA 4FT4A 1D3BB 1CKBA 1VQOT 4ZNXA 1JXMA 2CUBA 1RI9A 4BI3A 5FRNA 1B34B 2VGMA 3TCJA 4ZTJA 5DLOA 4HXJA 1U5SA 2A3LA 3X25B 3SWNA 2AK5A 5CKBA 3JCMh 2V8KA 4J9GA 1S1NA 1BCOA 3CBPA 2A08A 1OU9A 5HCKA 3CBMA 3CCRA 3VS0A 2A36A 2DM1A 2LVMA 2O31A 1KK7A 1ZUKA 4CC7A 2FRYA 1X6GA 1SHGA 2E6ZA 2JTFA 1M1KC 3OBWA 4QW2A 1ZSZB 3REBB 1SHFA 1VQ8A 3AT1B 2VGNA 5CQYA 2QDYB 4HCCA 2KEAA 3QYGB 4DBRA 3PMIA 2E3HA 1BU1A 5A0GA 2LMJA 2RA2A 1QW1A 1HK9A 2AKLA 2OI3A 3G1JA 3JCMJ 1ZBJA 5CKHA 5I22A 2YLCA 2HCKA 2ZPGB 4A63B 1K73C 2XD0A 4J8OA 2EQKA 2DXTA 5D6WA 4HVWA 1U1TA 1K1ZA 3LYIA 3RKWA 3CBOA 1VYTA 4DA4A 2KT1A 4F7UA 1GFCA 1PRLC 1YWPA 3SDZA 3CCLT 1I0CA 1KQSA 2ZZDA 2JNGA 1UHFA 3G4SQ 3CXCP 1JJ2S 3QJ6A 1QVGS 2Y4YA 4IKFA 1C6VX 3VJPA 2GBQA 2E41A 2L5QA 4IUUA 2QYZA 2RJCA 1PKTA 4EMKC 4KRTA 1U06A 1D0XA 2DL7A 4C92A 1U3OA 1KIKA 3OYAA 3MO8A 2X35A 2GCXA 4RCCA 2EYYA 3ME9A 2KY9A
chains in the Genus database with same CATH topology
1PC0A 1TSFA 2KI7A 2ZAEA 1OQKA 1V76A 1TS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PC0 A;  1TSF A;  2KI7 A;  2ZAE A;  1OQK A;  1V76 A;  1TS9 A; 
#chains in the Genus database with same CATH topology
 2KR3 A;  2NUT A;  2DK3 A;  1FMV A;  3OB9 A;  1AWJ A;  3QKJ A;  2RMO A;  1VQK A;  4CC4 B;  2JS2 A;  4AG1 C;  5CR2 A;  1IGQ A;  2E64 A;  5IHI A;  1QP3 A;  1PHT A;  4QQG A;  2HNI A;  4FYV B;  1R0C B;  3HRT A;  4BE0 A;  1YIT T;  2G6F X;  2DAQ A;  1QP2 A;  1OI1 A;  3L2W A;  4KUL A;  1W2B P;  2L3R A;  1M5Q 1;  4J9D A;  1O75 A;  5FRO A;  1SPK A;  3M4Y A;  2JM9 A;  2YT6 A;  3S3M A;  2K3B A;  1H8K A;  4FW2 A;  3NFC A;  4ZN3 A;  3EFO B;  5L8R E;  1AZE A;  2CP0 A;  3DKM A;  5J26 A;  1IZ6 A;  3A8L B;  3CME Q;  1I5L A;  3CMA A;  4Z89 A;  3M57 A;  1OEB A;  4PFO A;  1LJO A;  1VQ5 A;  3L2V A;  3MEW A;  2LZ6 B;  3QYH B;  1EX4 A;  1VQM T;  1W4S A;  2MOX A;  4RTV A;  3MCA B;  3TSZ A;  2ZPI B;  2DTH A;  2RQR A;  3M9Q A;  1N8R C;  3QWY A;  1TG0 A;  5HY6 A;  3JCM b;  1YJW A;  3FB9 A;  1VQN T;  4B9W A;  3JB9 J;  1MUZ A;  3CC2 A;  4E47 A;  3EGX A;  1ZBX A;  4ANJ A;  1GCQ A;  4ZTF A;  2L2P A;  3JCM f;  5GJW B;  4L6V 5;  1Z9Z A;  2EBP A;  5KYW A;  1Y7X A;  2HAX A;  4RG8 A;  2P84 A;  4M7D F;  2HQX A;  4NS5 A;  1RAD B;  2HL3 A;  1AD5 A;  2QGF B;  1HD3 A;  4FT2 A;  2DO3 A;  2LCL A;  1NYG A;  4EMH A;  2YRV A;  2HDA A;  4M7D G;  3WVE B;  4C8Q B;  3FEO A;  2E3I A;  1EFN A;  3CXC A;  1M8V A;  1G2B A;  3MHX A;  5HK3 A;  1HJD A;  5GAN f;  4QVD A;  4MDW A;  1D1A A;  4M7D C;  2CP5 A;  1QLY A;  4OMM A;  1AT1 B;  1M90 R;  4L59 A;  4BAC A;  2YRD A;  3VS3 A;  2M51 A;  3A5Z B;  4C8Q E;  4RTX A;  2LJ3 A;  2DIL A;  2EIF A;  1CKA A;  1K9A A;  1RAB B;  3S3O A;  1WHG A;  5LJ3 d;  1RAE B;  1BK2 A;  1OUL A;  2PVO B;  2ZPH B;  3ZEH A;  2XHC A;  4M75 D;  1GXI E;  2RHX A;  4F04 B;  1YI2 Q;  1WGS A;  2K4Y A;  3F70 A;  3HRU A;  5LJ3 e;  4XTV A;  4A54 A;  2BTT A;  2EVR A;  3CCS Q;  1LOJ A;  3QO3 A;  4GY5 A;  2CDT A;  2ZPB B;  2DNU A;  1YHQ Q;  2ZGW A;  2C0T A;  2RJD A;  1M3C A;  2XG8 D;  1WLP B;  2O9S A;  3E2U A;  4QVC A;  2DX1 A;  3LW5 E;  3RES A;  2DER A;  3G71 A;  1W2B A;  3LLR A;  4PK4 A;  2V8I A;  4YTL A;  4P5N A;  1Y96 A;  2YLB A;  1E7O A;  2JVV A;  5LJ5 d;  1H64 1;  4LD6 A;  4MML A;  2IPO B;  4JRP A;  3PVL A;  1TUD A;  5LJ3 h;  3ER0 A;  4DBF A;  2FZC B;  1G5V A;  4JLI A;  2QG9 B;  5LJ5 e;  4A4E A;  1ZUY A;  4OGE A;  1T3S A;  1Q86 U;  2DTI A;  2RK1 A;  2EQM A;  4JS5 A;  2FYK A;  3CPW P;  2CSI A;  3QZ9 B;  2HQH A;  4M7A D;  4EIK A;  3GPL A;  1QVG P;  1JJ2 P;  3JCM W;  4RKU E;  3GNF B;  2DL4 A;  1RL2 A;  1NBE B;  4F17 A;  3NHN A;  2M1H A;  2P4R A;  1VA7 A;  4JJB A;  2GFA A;  2CKK A;  1D1B A;  3WVD B;  1YIJ A;  1BB9 A;  1D1C A;  4CI0 C;  3QBY A;  4PJO B;  3NPF A;  1X01 A;  5FWC A;  3I5S A;  1VQ9 Q;  2XU8 A;  3QXE B;  2RPN A;  5LJ5 h;  1ZHI A;  2O88 A;  1XQH A;  4E7K A;  3TSW A;  2IG0 A;  1TXQ A;  2DBK A;  2RHY A;  1Y71 A;  2CT4 A;  1WDX A;  3N5B B;  4RTY A;  1SSF A;  2QEX Q;  3I55 Q;  4PJO E;  4JJN K;  1FMW A;  1YCS B;  1S72 Q;  4AFZ C;  5FRM A;  2I2L A;  1I1J A;  3RUX A;  1RAI B;  2DJZ A;  1LNX A;  1NLO C;  1QCN A;  2LNH B;  3EGU A;  2KNB B;  4ZGD B;  1VQ7 Q;  2K5L A;  5GAO m;  1X27 A;  3GLX A;  2AZS A;  1T0J A;  2EYQ A;  3KXT A;  2JT4 A;  2DL3 A;  3A8M B;  3REA B;  4DQ2 A;  3HTR A;  2RJF A;  1VQP Q;  1R0B G;  2EJG A;  2M02 A;  2LCS A;  3EHR A;  2CYZ B;  4M78 D;  3G6E A;  2KI7 A;  1NEB A;  1NJI U;  1RLQ C;  1HXD A;  1BIB A;  1AWW A;  1UEC A;  2FZK B;  2RM4 A;  4EPC A;  3OS0 A;  1WHL A;  1OU8 A;  2XDP A;  3M0U A;  4HT8 A;  3H0F A;  4JS4 A;  3CCR Q;  5GAN 2;  3OS2 A;  3EG0 A;  5J39 A;  1IHV A;  2JS0 A;  2EYZ A;  2LQW A;  4JJC A;  2O4X A;  3VUB A;  4KH0 B;  4M75 A;  1NPP A;  3SWN B;  1K8A U;  2WAC A;  4C92 G;  2AZV A;  2K9G A;  2HZY A;  1ACM B;  4GLM A;  1VQ8 Q;  3URG A;  2C0O A;  4DEX A;  2YXY A;  1CSK A;  2A7Y A;  1W70 A;  4X1V A;  3KFV A;  2K7A A;  4C92 C;  3RMS A;  2JOY A;  1ARK A;  4F16 A;  1IB8 A;  3JCM c;  4OVA A;  4BI4 A;  2ECZ A;  1EZZ B;  3MEV A;  1YP5 A;  2J6O A;  1Q86 C;  2DLP A;  5GMK m;  2DVE A;  4XU0 A;  8ATC B;  3EG2 A;  2JM8 A;  3CCV A;  2D9T A;  3UA6 A;  3I56 Q;  2E5K A;  5KYX A;  1YNZ A;  1NE8 A;  1TU0 B;  2WSC E;  2CT3 A;  4CRI A;  3O8V A;  2GNC A;  3CCS T;  1FXX A;  3CPW A;  1JU5 C;  2FL7 A;  2L89 A;  3RBB B;  2PNI A;  2EYX A;  1YHQ T;  4PJL A;  4F7U B;  2FG0 A;  4LDW A;  1JJ2 A;  1QVG A;  3MEU A;  2F2X A;  2LX7 A;  1Q95 G;  1VQM Q;  5KYU A;  4BDZ A;  3U23 A;  1UTI A;  2KAF A;  2KK4 A;  2GQI A;  3M58 A;  2CZ7 B;  3A98 A;  4PFZ A;  5LJ3 f;  3I35 A;  4M77 D;  1W1F A;  2PU9 B;  5IN1 A;  3OW2 S;  4M7A A;  2FHD A;  3TRE A;  2D0Q B;  4FW1 A;  1QQJ A;  3CCM Q;  4F7U E;  1VQN Q;  3JCM X;  1UJY A;  4A4F A;  5GAN 6;  3OYC A;  1M8M A;  2LRQ A;  3LX7 A;  2X4Y A;  1JQQ A;  3OSV A;  1TS9 A;  1NEG A;  2D8H A;  1B3Q A;  1RUW A;  2JZ2 A;  4XTU A;  2AHJ B;  4OGC A;  3CC7 Q;  3EH1 A;  4C92 B;  5CAI A;  2RF0 A;  2CH4 A;  2YSQ A;  2SEM A;  2DKG A;  1WJR A;  2DD4 A;  2DJQ A;  1MMG A;  3DB3 A;  2LC4 A;  3QHS A;  2NUT B;  2YHT A;  2LX9 A;  3VS2 A;  2MCN A;  4KGV B;  3OS5 A;  3RKX A;  3CCJ Q;  3CCL A;  1NJI C;  2KVQ G;  1WIE A;  4JJD A;  4OB3 B;  1BIA A;  3OYM A;  2KRO A;  3VS1 A;  1UGQ B;  4C92 E;  5LJ5 f;  2OTL A;  2BIV A;  1FWZ A;  4LNP A;  3HSB A;  2RQU A;  5GMK j;  1VQL Q;  3OSS C;  1KD1 R;  4QQD A;  4C5E A;  2JW4 A;  4E7Z A;  4HKE A;  2K2V A;  3M0T A;  3CMA Q;  1VQ9 T;  1V76 A;  4ELZ C;  3QG1 A;  4LUD A;  1M2V B;  1HSQ A;  3UT1 A;  2KBT A;  1K8A C;  2J6F A;  4M78 A;  1BCM A;  1X6B A;  2QEX T;  2NWM A;  2X4X A;  2K3X A;  1WZO A;  2LNV A;  3I55 T;  5GAN j;  1S72 T;  4F14 A;  4C0D B;  2X9H A;  3X28 B;  1YJW Q;  4EMG A;  2DXU A;  1VQ7 T;  3CD6 A;  2NUP A;  2K6D A;  2A0F B;  4IUT A;  4KGZ B;  5GAM j;  1UHC A;  4BDY A;  1JEG A;  1VQP T;  4AFQ C;  1WPY A;  3BW1 A;  4O6J A;  1OYX A;  1YIT A;  3NTH A;  2LJ0 A;  3QZ5 B;  1QMC A;  4LDU A;  3BY7 A;  4HT9 A;  4E2F B;  5IHN A;  5IXB A;  4NOY A;  2ED0 A;  4II1 A;  4L5G A;  2R58 A;  3L2Q A;  1K9M U;  1UJ0 A;  4DBH A;  3JCM Q;  2E5Q A;  3CCR T;  2QA4 Q;  3FIF A;  5EG2 A;  1PD0 A;  3C12 A;  5KYW B;  2KRN A;  3S6W A;  2MF2 A;  2VVK A;  1K9M R;  3PIP A;  1VQ6 Q;  1AVZ C;  3CCE A;  3DLL A;  4FIB A;  3HP9 A;  1VQ8 T;  4ESR A;  4PKC C;  3I5R A;  3CCU Q;  1GCP A;  1Q7Y R;  2MMP A;  2DL5 A;  3S3N A;  2COY A;  1RAF B;  3EFS A;  1UEB A;  4C8Q F;  2BUD A;  1D3B A;  4A4H A;  2H3E B;  1FYN A;  2DVJ A;  3GIB A;  3OYY A;  1YJ9 A;  1OQK A;  1TUG B;  1H3H A;  4C8Q G;  4ZGE B;  4J7I A;  2HBW A;  1UGP B;  2EPD A;  1SEM A;  2MWO A;  4M77 A;  3I56 T;  5A0L A;  5A0D A;  1TOV A;  2PUK B;  2HKQ B;  3A1P A;  4C8Q C;  3GBQ A;  3L2Z A;  1KC8 R;  2HSP A;  1MNE A;  2ROT A;  2EQJ A;  1RAH B;  1ZSZ A;  5GAN 7;  2CP7 A;  4ME7 A;  2JTM A;  2W10 A;  3H41 A;  1GL5 A;  3HHT B;  5GAM g;  3JB9 G;  4DEY A;  2R5M A;  4HVU A;  4IIM A;  3HPW A;  3VKI A;  2EYW A;  4XU3 A;  1BI0 A;  3BDL A;  1D0Z A;  3UAT A;  4DOW A;  1XOV A;  2A28 A;  3PMT A;  1I81 A;  3P8D A;  1NPR A;  3CCM T;  1LVK A;  2V26 A;  4FYX B;  1OX8 A;  2COZ A;  3PIO A;  1WXT A;  4XTZ A;  2DXB A;  4J83 A;  4XTW A;  3KUF A;  1Y96 B;  2ATC B;  1PC0 A;  3Q1J A;  4RG2 A;  2RN8 A;  2YWW A;  1QVF P;  4CC2 A;  4D8K A;  4J7F A;  3EG1 A;  1SRL A;  2A37 A;  3UDC A;  4WF2 A;  3CC7 T;  4R55 A;  2YUO A;  4BE2 A;  2CZ0 B;  5GAN 5;  2E4H A;  4E7L A;  4QVZ A;  1KQS S;  2CP3 A;  2LT1 A;  2CP6 A;  4AG2 C;  1YIJ Q;  2HL5 C;  1NLP C;  3CCJ T;  3PGG A;  5GAO q;  5EC7 A;  3VS5 A;  1WX6 A;  2RB6 A;  4HCK A;  4FCY A;  3AHU A;  3G4S A;  1ABO A;  2EGA A;  2QQR A;  1LPL A;  2FRW A;  1M90 U;  1VQL T;  4FL6 A;  3VYH B;  2M0O A;  1VOM A;  5GAN 4;  4XAX B;  3CMA T;  1BYM A;  2KXC A;  5I21 A;  2HSE B;  3J80 E;  4AFU C;  2F2W A;  4PJO F;  1ZX6 A;  1KSW A;  2FPE A;  3VRZ A;  3OYJ A;  2WSF E;  3A8O B;  4J9H A;  2QTV A;  3RIR A;  1PNJ A;  3KBG A;  1GBQ A;  4PJO G;  3E19 A;  1N9S A;  1TTH B;  3UA7 A;  3CC4 Q;  3OBY A;  1YJW T;  5L23 A;  2DRM A;  2RHI A;  4KH1 B;  2R5A A;  2VYT A;  4UC4 A;  4N4G A;  2JJ9 A;  4PJO C;  4C0F A;  4J9E A;  3JB9 H;  1I5O B;  5ECA A;  1G3S A;  2DE0 X;  2EFI A;  2K79 A;  1K4U S;  3G6E Q;  4M7D D;  1JO8 A;  7AT1 B;  3FLG A;  3MJX A;  3H8Z A;  4J5Y A;  2RD1 A;  1QKX A;  3GF5 A;  1IXD A;  1X69 A;  4OP0 A;  2I0N A;  3V8L A;  3UF4 A;  4DBQ A;  1B07 A;  4AT1 B;  1BI1 A;  1AOJ A;  1KG1 A;  2SRC A;  1ABQ A;  2RI2 A;  4C5G A;  4EMK A;  2QA4 T;  3SD4 A;  5DLQ E;  3GOX A;  1GFD A;  3VS4 A;  1Q81 R;  3CME A;  1TSF A;  3H9N A;  3L2R A;  1VQ6 T;  4ELY C;  1IHW A;  4KGX B;  4LDV A;  4N0A C;  1QCO A;  2FEI A;  1WJQ A;  4RTZ A;  3WXM B;  2D0N A;  4D8D A;  1EIF A;  3PVQ A;  3QJY A;  3MP1 A;  5FW9 A;  4K11 A;  3CCU T;  4XQ3 A;  1J3T A;  2V1Q A;  3INZ A;  4RUG A;  2O4X B;  1XNI A;  1PM3 A;  2V8J A;  4C5I A;  4M75 B;  5FLX E;  2B86 A;  2BZY A;  5HKC A;  2KYM A;  2CGH A;  2VXF A;  5FWB A;  4KUI A;  3CCV Q;  1G3W A;  4E7I A;  1Y0M A;  2ROL A;  2K2M A;  1K0S A;  4JPB W;  2MPX C;  4X9C A;  2DRK A;  1Q82 U;  1M27 C;  2DFU A;  3LWH A;  1X6O A;  3H0H A;  5CVI A;  3P8H A;  3X26 B;  4M75 E;  3LWI A;  3SWN C;  1UE9 A;  1M1G A;  2ZCF B;  1QVF A;  2RI5 A;  4AFS C;  1Q82 R;  5GMK i;  1XJW B;  2D8J A;  5CCA A;  3PT9 A;  4RTW A;  4J9C A;  4HCZ A;  1M90 C;  2EQI A;  1NM7 A;  2L3S A;  3CXC S;  1PD1 A;  1N27 A;  4FSX A;  2DIG A;  4OMF B;  2G3R A;  5IAY A;  3M54 A;  1BKB A;  2QDL A;  2QQB A;  1RI0 A;  3MET A;  1OX9 A;  2E1H A;  4F7U F;  2OTJ A;  2KE9 A;  3X20 B;  4XU1 A;  3QPH A;  4PL6 A;  4FYY B;  1QWE A;  5KYU B;  3EG9 A;  3RNJ A;  2Z0W A;  3HRS A;  1VQ4 Q;  2XDB A;  4F7U G;  2RI3 A;  1UUE A;  5GAN 8;  4M7A B;  3H6Z A;  3OYF A;  2VB6 A;  2ENM A;  2VWF A;  1X75 C;  1C0M A;  4JRQ A;  5J3B A;  1QKW A;  1KHC A;  3SFM A;  4GLK A;  2ESW A;  1U8R A;  1YCY A;  4NL2 A;  4B6M A;  3OYI A;  1YI2 A;  2OTL Q;  4C92 F;  4M7A E;  3VS6 A;  1KQ2 A;  1YIJ T;  1UGR B;  4JUV A;  1FMK A;  2DEU A;  2KGT A;  2P0P A;  4DOV A;  2RK2 A;  1E6G A;  2DIQ A;  1W2B S;  3PE0 A;  2COW A;  1YHQ A;  3OYN A;  1H3Z A;  2X4J A;  1M2O A;  3ULR B;  1W6X A;  1KHI A;  1FX7 A;  2J7I A;  1MMA A;  3DB4 A;  1TH7 A;  2RO0 A;  1DJ7 B;  2HQE A;  1YJN A;  1V29 B;  1U1S A;  4M7D A;  2O2O A;  3FJ5 A;  5KE2 A;  1MV3 A;  4JRI A;  3OYD A;  1M1K R;  3CCQ A;  2FO0 A;  3E1S A;  3CD6 Q;  3V7S A;  2XDD A;  1WHK A;  3PTA A;  4J6W A;  3CC4 T;  3ASK A;  4M78 B;  2E6N A;  3M0P A;  2FPF A;  1UGV A;  4D6W A;  4MZP A;  5CKF A;  2EGE A;  1VQO A;  1PWT A;  4IUR A;  4J6X A;  3QDR B;  3RMQ A;  3OYH A;  3MEA A;  2F69 A;  1K73 R;  3C0C A;  4O5V A;  2OAW A;  2DYB A;  1VIF A;  3G6E T;  1VYU A;  2KQW A;  3FC3 A;  1X43 A;  4LUE A;  2B8A A;  4E7H A;  2DYI A;  2NUP B;  5GAN 3;  3EGD A;  2IIM A;  4M78 E;  4OB2 B;  3VRY A;  2RH2 A;  2F5K A;  4LN2 A;  3CEY A;  3L1A A;  4B9X A;  2RHU A;  3QWX X;  2MAM A;  3OMG A;  4R0K A;  1SF9 A;  1R8O B;  3E9F A;  3V7C A;  4C0D C;  3OMC A;  2HMA A;  4J9I A;  4X34 A;  2DZ9 A;  3CCE Q;  1AEY A;  1ZLM A;  4QKU A;  2LTO A;  3E9G A;  1VQK Q;  2QEX A;  1S72 A;  2WSE E;  1OOT A;  1JXO A;  2HEQ A;  2QXF A;  1WHM A;  5I2S A;  2PVG B;  5GMK e;  1UFF A;  1YJ9 Q;  2XMF A;  3SB2 A;  4BE1 A;  2P0Q A;  2XIC A;  5KYY A;  3UWN A;  4ORZ A;  3CCV T;  1KD1 U;  1GCQ C;  4MDX A;  5GAN d;  4FM4 B;  2RQV A;  5FU7 B;  1ZSG A;  4WCI A;  2KYB A;  3A8G B;  5GAN e;  1SG5 A;  4FSS A;  2LCC A;  2Y4X A;  1XTD A;  1UGS B;  2DTO A;  4OMN A;  5GAM d;  1TUC A;  2K5I A;  1VQ5 Q;  4M77 B;  2K3Y A;  3EHQ A;  2CUD A;  5GMK h;  5DY9 A;  2DMO A;  4V2S A;  4LE9 A;  5GAM e;  4PFP A;  2VUB A;  1JB0 E;  4JLG A;  3H0I A;  1P92 A;  2MYS A;  4JZ3 A;  3PNW C;  5CKD A;  3JCM V;  1ZQ1 A;  4M77 E;  1ZUU A;  2AT1 B;  3CC2 Q;  4PJM A;  1N8R U;  1X2Q A;  2JMC A;  2F2V A;  5GAN h;  2VXE A;  1PKS A;  1VQ4 T;  3CPF A;  4ATO A;  2DXC A;  3JSC A;  1YFN A;  1N8R R;  4CC3 A;  2KT8 A;  3JV3 A;  8AT1 B;  1RAA B;  5KYN A;  1N6A A;  3DLM A;  3OYE A;  3OYB A;  5GAM h;  5CK9 A;  1SRM A;  3EGX B;  3I56 A;  1NG2 A;  3JCM P;  3CPW S;  2YDL A;  3M55 A;  4JDS A;  5FU6 B;  5CO7 A;  2OTL T;  4J9B A;  3EFR A;  5C6S A;  3T9N A;  4BUG A;  4R56 A;  1Q7Y U;  4HCB A;  6AT1 B;  4XTX A;  1R77 A;  1OZ2 A;  1WNL A;  2KRS A;  2MI6 A;  3JCM g;  1T3L A;  3C4S A;  3TQ7 P;  4E7S A;  2CH4 W;  1VQM A;  4A4K A;  4BI8 B;  2DZC A;  4MZT A;  2X3W D;  3RDV A;  5KH6 A;  2GTJ A;  3OS1 A;  2M9U A;  1LCK A;  1B34 A;  4RTU A;  3CCM A;  5GAO n;  5IHK A;  2X4W A;  3R6O A;  1VQN A;  2D6F A;  5IH2 A;  2M0Y A;  1MMD A;  3ZL7 C;  1KC8 U;  5CKE A;  3CD6 T;  3D7S B;  2OAU A;  4QT7 A;  1WXU A;  1RAG B;  4PNO A;  3OY9 A;  1HYO A;  2QAS A;  2DL8 A;  3OYG A;  2MIO A;  3CC7 A;  4Z02 A;  3M5A A;  5GAN g;  3RR6 A;  1KQ1 A;  4AMC A;  1KD1 C;  1IRE B;  4C0G A;  3JB9 F;  1BI3 A;  5IT9 E;  2DF6 A;  2X3X D;  1VIE A;  3NTK A;  3OYK A;  2DA9 A;  4GBQ A;  3G71 Q;  3CCJ A;  1M2V A;  4IIO A;  1IRX A;  3VS7 A;  1UB4 A;  1WYX A;  1AZG B;  2JXB A;  2E12 A;  1ZA2 B;  4A4G A;  1VQL A;  1GBR A;  2NLU A;  2RJE A;  2NUZ A;  4HA8 A;  1NZ9 A;  4QQ6 A;  3OA6 A;  4FYW B;  2O9V A;  1KJW A;  2F5T X;  3QII A;  3CCE T;  1D09 B;  2EW3 A;  4C8Q D;  1K0X A;  4FU6 A;  3QDF A;  1MND A;  2BE9 B;  1M4Z A;  2EQU A;  1E6H A;  5D6Y A;  2H3J A;  1WXB A;  2ZPE B;  3I9Q A;  3PFS A;  2HD0 A;  1VQK T;  2ZPF B;  4EMK B;  5KE3 A;  3JAM E;  3MPU B;  3TVT A;  3GP8 A;  1AWX A;  1BBZ A;  1A0N B;  2HKN A;  3J7A F;  4ZGJ B;  2PVD B;  2VC8 A;  1YJ9 T;  2HBP A;  2RQT A;  5KCH A;  1ZA1 B;  2ZAE A;  4KUD K;  3RER A;  4TVR A;  3VV0 A;  2NYS A;  3IQL A;  3OYL A;  3JRZ A;  3JB9 D;  4LD9 K;  2CP2 A;  4BY6 C;  4M75 F;  4PLL A;  2LJ1 A;  2CS7 A;  2QAZ A;  3GNG A;  3X24 B;  2XK0 A;  4A53 A;  3A8H B;  1PG5 B;  2RQW A;  3M0S A;  1G3Y A;  2QK0 A;  1K9M C;  4X9D A;  3P8B B;  3OW2 P;  2R57 A;  3BDU A;  4OB0 B;  4M75 G;  3JB9 I;  4XU2 A;  1Q7Y C;  1OZ3 A;  1VQ5 T;  1PCX A;  2EGC A;  2X51 A;  2QA4 A;  4M75 C;  4JRK A;  2RNA A;  1D0Y A;  5M9O A;  3J81 E;  2GQV A;  2MK5 A;  4LXC A;  2OTJ Q;  1VQ6 A;  1M3B A;  4RCB A;  1WHJ A;  1WHH A;  1WI7 A;  2LQ8 A;  2E70 A;  3M0Q A;  3R6N A;  1Z9Q A;  2PTK A;  2VAS A;  3CCU A;  3NMZ C;  3V7R A;  3CC2 T;  4NL3 A;  1O9S A;  2VV5 A;  1QVP A;  3V8K A;  1I07 A;  2FPD A;  4OF1 A;  2LQK A;  1KC8 C;  2QTX A;  4Q5W A;  1M1F A;  1PSE A;  5GAM f;  2EKO A;  3EFO A;  3VUZ A;  2L8D A;  2W0Z A;  2J05 A;  2RHZ A;  2AIR B;  1H92 A;  3EG9 B;  1WQW A;  1JBM A;  4LDX A;  4M7A F;  1Q81 U;  3O5Z A;  2EWN A;  1IGU A;  3NTI A;  5D7U A;  2BZ8 A;  5A2Q E;  4VUB A;  5AYF A;  2FVU A;  3LGL A;  3NGP A;  4BY6 B;  3G4S T;  2EAY A;  2LDM A;  2AKK A;  4PJO D;  4M7A G;  2BZX A;  5CQX A;  5GAO r;  1AWO A;  3UPU A;  2LT4 A;  4Y28 E;  5LJ3 j;  4XK8 E;  1WQ7 A;  4RTT A;  3THK A;  1YJN Q;  1BI2 A;  4M7A C;  4KT0 E;  3HKS A;  1PRM C;  1I4K 1;  1AHJ B;  4IUP A;  2KXD A;  4PJJ A;  3C94 A;  3MP8 A;  4OML A;  4C5H A;  2JTE A;  3L42 A;  3CCQ Q;  5HK0 A;  2K5F A;  2J6K A;  4XTY A;  1N5Z A;  4Z8A A;  1V1C A;  4E7J A;  5AT1 B;  5I11 A;  4OMQ A;  2QQ9 A;  4M7D B;  2KSS A;  2FZG B;  4LDY A;  2JMA A;  1VQO Q;  1X2K A;  5C0M A;  4Y91 A;  3EH2 A;  2PUO B;  1G8X A;  2L3Q A;  5DM7 R;  1Q86 R;  4C8Q A;  3HFN A;  4M78 F;  1WJS A;  5LJ5 j;  2QQS A;  2EKH A;  4IUV A;  3HL8 A;  4M7D E;  1RAC B;  1Y57 A;  2JN0 A;  3HFO A;  5KYX B;  1OPL A;  2GF7 A;  3G71 T;  1K76 A;  2DET A;  1MMN A;  3FDR A;  3SEM A;  2CSQ A;  4M78 G;  2EJF A;  5D6X A;  1N9R A;  5LL6 S;  2Y90 A;  2K57 A;  2CZ1 B;  2J06 A;  2DPP B;  3EGD B;  5CIU A;  2O01 E;  2QI2 A;  3CME T;  4M78 C;  1QWF A;  3OW2 A;  3TEE A;  1G3T A;  4M4Z A;  3M56 A;  2KDS A;  4N4I A;  1PSF A;  4MMK A;  4JZ4 A;  2YUQ A;  2GTO A;  4C0Z A;  2XKO C;  2XID A;  3M53 A;  4PJN A;  1SKU B;  1VYV A;  1T0H A;  5GAO p;  2GGR A;  1SSH A;  3CC4 A;  2P0K A;  3LH0 A;  5LJ3 g;  1OPK A;  2GFU A;  3CCL Q;  1MGQ A;  2D1X A;  1RLP C;  1YN8 A;  2KRM A;  1UG1 A;  3CCS A;  3ZBD A;  3OQ5 A;  2DEQ A;  1WA7 A;  4J9F A;  1IO6 A;  3RKY A;  3VU3 C;  1Q81 C;  4J6Y A;  5KYY B;  2E65 A;  3SHW A;  4E6R A;  4IUQ A;  2M16 A;  1NJI R;  1M30 A;  1M1K U;  4N4H A;  2DD5 A;  3QSU A;  9ATC B;  5GAO l;  2FB7 A;  4OMO A;  4BB7 A;  2PQW A;  1UDL A;  3C95 A;  4OMP A;  3ZFJ A;  2EJ9 A;  3MKD A;  4EDU A;  3TU4 K;  1MV0 B;  1Y07 A;  3M59 A;  1C1A A;  5LJ5 g;  2OTJ T;  4M77 F;  3LGF A;  3L2U A;  1NYF A;  5FU7 C;  4OB1 B;  1K73 U;  4Y92 A;  1K8A R;  1YWO A;  1KQS P;  2QQA A;  1GRI A;  2JUF A;  1VUB A;  2YRC A;  2CZ6 B;  1YIT Q;  2V1R A;  3V8J A;  3M0R A;  4M77 G;  4PJO A;  3BFM A;  1WFW A;  1QCF A;  3EG3 A;  2L3P A;  2QGG A;  1Q82 C;  1M3A A;  2KMT A;  1M9S A;  4WTO B;  3M4G A;  4C92 D;  4M77 C;  2VKN A;  1KFZ A;  4KBM B;  5KCO A;  2L0A A;  4HVV A;  3BE3 A;  2ABL A;  1TWB A;  2C0I A;  1QVF S;  3FJP A;  5I2M A;  1YI2 T;  4RMO A;  3EAE A;  3FRN A;  4ZN1 A;  1ZSZ C;  1F1B B;  4MZM A;  2E10 A;  3VYG A;  1VQ9 A;  2ED1 A;  3JCM d;  4PLI A;  2LQN A;  2YUN A;  2MWP A;  2DBM A;  2C06 A;  2PZ1 A;  2BKD N;  2YUP A;  1MHN A;  5GJV B;  1G83 A;  2F1L A;  3JCM e;  2BE7 D;  1JRI A;  3I55 A;  4N0A A;  1YJN T;  2OJ2 A;  2OX7 A;  3CQT A;  2H8H A;  3QUI A;  1YBY A;  3G7Z A;  2IVW A;  5GMK l;  3MP6 A;  1B7T A;  4BD3 A;  1I8F A;  2CRE A;  1VQ7 A;  3CCQ T;  2P4T A;  2LP5 A;  3LH5 A;  5FU6 C;  1OV3 A;  2XI9 A;  1VQP A;  1VQ4 A;  4Z88 A;  5IXF A;  4FT4 A;  1D3B B;  1CKB A;  1VQO T;  4ZNX A;  1JXM A;  2CUB A;  1RI9 A;  4BI3 A;  5FRN A;  1B34 B;  2VGM A;  3TCJ A;  4ZTJ A;  5DLO A;  4HXJ A;  1U5S A;  2A3L A;  3X25 B;  3SWN A;  2AK5 A;  5CKB A;  3JCM h;  2V8K A;  4J9G A;  1S1N A;  1BCO A;  3CBP A;  2A08 A;  1OU9 A;  5HCK A;  3CBM A;  3CCR A;  3VS0 A;  2A36 A;  2DM1 A;  2LVM A;  2O31 A;  1KK7 A;  1ZUK A;  4CC7 A;  2FRY A;  1X6G A;  1SHG A;  2E6Z A;  2JTF A;  1M1K C;  3OBW A;  4QW2 A;  1ZSZ B;  3REB B;  1SHF A;  1VQ8 A;  3AT1 B;  2VGN A;  5CQY A;  2QDY B;  4HCC A;  2KEA A;  3QYG B;  4DBR A;  3PMI A;  2E3H A;  1BU1 A;  5A0G A;  2LMJ A;  2RA2 A;  1QW1 A;  1HK9 A;  2AKL A;  2OI3 A;  3G1J A;  3JCM J;  1ZBJ A;  5CKH A;  5I22 A;  2YLC A;  2HCK A;  2ZPG B;  4A63 B;  1K73 C;  2XD0 A;  4J8O A;  2EQK A;  2DXT A;  5D6W A;  4HVW A;  1U1T A;  1K1Z A;  3LYI A;  3RKW A;  3CBO A;  1VYT A;  4DA4 A;  2KT1 A;  4F7U A;  1GFC A;  1PRL C;  1YWP A;  3SDZ A;  3CCL T;  1I0C A;  1KQS A;  2ZZD A;  2JNG A;  1UHF A;  3G4S Q;  3CXC P;  1JJ2 S;  3QJ6 A;  1QVG S;  2Y4Y A;  4IKF A;  1C6V X;  3VJP A;  2GBQ A;  2E41 A;  2L5Q A;  4IUU A;  2QYZ A;  2RJC A;  1PKT A;  4EMK C;  4KRT A;  1U06 A;  1D0X A;  2DL7 A;  4C92 A;  1U3O A;  1KIK A;  3OYA A;  3MO8 A;  2X35 A;  2GCX A;  4RCC A;  2EYY A;  3ME9 A;  2KY9 A; 
#chains in the Genus database with same CATH homology
 1PC0 A;  1TSF A;  2KI7 A;  2ZAE A;  1OQK A;  1V76 A;  1TS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...