2KIGA

A ph domain within ocrl bridges clathrin mediated membrane trafficking to phosphoinositide metabolism
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
161
structure length
161
Chain Sequence
GPLGSMDQSVAIQETLVEGEYCVIAVQGVLCKGDSRQSRLLGLVRYRLENDAQEHALFLYTHRRMAITGDDVSLDQIVPLSKDFMLEEVSPDGELYILGSDVTVQLNTAELKLVFQLPFGSHTRTFLQEVARACPGFDPETRDPEFEWLSRHTCAEPDAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol polyphosphate 5-phosphatase II isoform
publication title A PH domain within OCRL bridges clathrin-mediated membrane trafficking to phosphoinositide metabolism.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis, hydrolase
total genus 16
structure length 161
sequence length 161
ec nomenclature ec 3.1.3.36: Phosphoinositide 5-phosphatase.
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16776 INPP5B_PH Type II inositol 1,4,5-trisphosphate 5-phosphatase PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.110 Mainly Beta Roll PH-domain like PH-domain like 2kigA00
2KIGA 2KIEA
chains in the Genus database with same CATH superfamily
3KSYA 1MIZB 4MY6A 3WA0A 3MPXA 2I5CA 1AQCA 5D3WA 3PVLA 2DHJA 2Y8GA 1FHOA 4P7IA 1EGXA 1WJMA 1ZC4B 1SGHA 2NBVA 5C5BB 4C0AA 2OTXA 4HAZB 3FEHA 3KRWA 3ML4A 2LYDA 1Z87A 2Z0QA 3A8QA 4IFSA 3VOQA 1N3HA 2EMTA 1BTNA 4HSIA 2LOZA 1J19A 2RUKB 3FSSA 1V89A 5LOPB 1U27A 2W2XD 5FI0A 2KUPA 3NWFA 3SUZA 5GOWB 4PNKA 4D6WA 1V88A 5LG4B 1U5FA 5M4YB 3KRXA 4K81A 5D3VA 1FHWA 2Z13A 2H7EA 1KZGA 3NSUA 1ZVRA 3N7CA 4A6KA 2W2WA 4DBBA 4KAXB 1LB1A 1RRPB 2R2YA 4GPTB 2K2UA 3VIAA 3DXCA 2I5FA 1ZC3B 1QC6A 2K2JA 5DIFB 4ZRIA 2Z0PA 2XQNM 4GZUA 3OHMB 4GMVA 3CXBB 2X18A 2LKOA 1WG7A 3X23A 3U12A 2NZ8B 2Z0OA 1FHXA 4XWXA 1MK7B 4WJ7A 2R09A 1U5GA 2AEHA 3TVVA 5JP4A 2CY4A 3DXEA 1GG3A 1UNRA 2Y7BA 4GXBA 4F7HA 3GYOA 1SHCA 2COFA 2Z4DA 3NW8A 4HAXB 3KY9A 4GNKB 4IOYX 2D4QA 1EVHA 4K17A 5C5BA 1E5WA 4ZRJA 2LG1A 2M38A 5I2MA 3RCPA 1MIXA 1XCGA 2RSGA 1ISNA 2UZRA 5I2SA 3HSAA 3F5RA 4GN1A 5HE3A 2QKMA 5C16A 1U5EA 1K5GB 2J0KA 5KQ4A 3PP2A 2DKQA 2D10A 4Z2MB 3A8PA 4NY0A 4QJ5B 2YS3A 5DI9B 1H4RA 2Y8FA 2YT0A 3IVFA 1UNQA 3QIJA 4F7UP 5D3XA 4A6FB 2I1KA 1IRSA 3SO6A 1ZYIA 1XODA 4YONA 2YT1A 4HDQA 2CAYA 3HK0A 5DHAB 5KQ1A 1EF1A 1NI2A 1LW3A 1RJ2A 2L1CA 2RVBB 5HE2A 2D9YA 1OQNA 4HB0B 1GC6A 2RGNB 1MAIA 3ZVRA 2DA0A 1V5PA 3A58A 3AU5A 1PMSA 4HB4B 5EFXA 3ODOA 5L81A 4OT1A 1QQGA 2PZ1A 1B55A 4DX8A 2KIEA 5C6RA 2ROZB 4EKUA 2DFKA 2L2IA 4KHBB 2YRYA 2ZKMX 1X86A 1Y5OA 2YT2A 2EC1A 2YS5A 4EMOA 2D9ZA 3P7ZA 2MKRA 4IAPA 2KGXB 2KIGA 1NU2A 2VKIA 1DBHA 3O96A 4D0NB 1DDWA 2K00A 5C79A 5J3QA 2D9WA 5JLJB 4A6FA 5KCVA 2N0YA 1WGUA 3M1IB 4K2OA 2UVMA 3ODXA 2W2XC 1Y19B 2J0JA 3CIKA 2DHIA 2DYNA 1BAKA 3ODWA 1OMWA 1AWEA 3NWDA 2YS1A 3TW1A 3KZ1A 3D8EA 2G35A 1J0WA 4QXAB 3FVCA 2I1JA 1ZM0A 1FB8A 3TCAA 2AL6A 1UNPA 3OANA 2JP2A 2V76A 2GCLA 2P0HA 1H10A 3QWMA 5IRSA 1MI1A 2GCJA 2H7DA 2IFSA 4QJ4B 4HHVA 1XX0A 2D9VA 2KCJA 4NSWA 2DKPA 4CSQA 2COCA 4L1RA 4KHBA 2UZSA 2Q13A 5J3TA 4L6EA 1NTYA 3HQCA 1MKEA 1I7AA 3QBVB 1T77A 5DH9B 3ZDTA 2BCJA 5JHGA 1V5MA 4KVGB 3DXDA 5HE0A 3AU4A 4TYZA 1FAOA 2GUMA 1WVHA 2DN6A 1WJ1A 3SV1A 1U29A 4HB2B 2DHKA 2P0FA 1TJ6A 4OSNA 3P6AA 1DDVA 3ULBA 3G9WA 1FOEA 2DLWA 2YVCA 4K2PA 2COAA 1W1DA 5D3YA 2OQBA 4PQ0A 2N23A 2ROVA 3PEGA 2D11A 1V61A 1BWNA 1TXDA 2DX1A 1M7EA 2VRWB 1EAZA 4HDOA 2YF0A 1KZ7A 1Q67A 2CODA 5JHHA 3DCXA 2YSZA 2ADZA 1V5UA 5LONB 2R0DA 4HAWB 1KI1B 2Z59A 4EJNA 1PLSA 3V5WA 2J59M 3HW2B 2MWNB 3BINA 1X1GA 2D2QA 4HATB 1U2BA 4B6HA 1P5TA 2E2XA 2RRFA 3NWAA 1I2HA 4HAVB 1PFJA 3GYPA 4GOUA 1W1HA 1U5DA 4A5KA 3SNHA 1ZSQA 5J3YA 1P3RA 2ELBA 4MT7A 1XKEA 3PG7A 1X11A 1UPQA 2LULA 3MDBC 1MPHA 4HB3B 4F7GA 2HE7A 3B77A 5HE1A 4CYEA 5FI1A 1FGZA 3LJUX 3F0WA 4A6HA 3U8ZA 4YL8A 5DHFB 1XD4A 4BBKA 1DROA 3U7DA 2DTCA 4KHOA 3PVWA 4CHJA 3UZTA 2KR0A 1UPRA 4WSFA 4KHAA 2Z14A 2GS0A 2LOXA 4CHMA 4HAYB 1P6SA 1TQZA 2KUQA 1DDMA 2P0DA 5CLQB 2FJUB 1M7RA 1W1GA 4MK0A 3HIEA 5CLLB 3A98B 2DYQA 1X1FA 3TFMA 4DXAB 1WI1A 3PSCA 1UEFA 2HTHB 3D8DA 3FM8C 2RLOA 2ZPYA 4GMXB 5D27A 3ULCA 2IYBA 2DX5A 2K8EA 3PZDA 2RNRB 1XR0B 2K49A 4DX90 1K5DB 4TKNA 1DYNA 2CY5A 3WYFB 2CRFA 3PVUA 4Y94A 4H8SA 4Z2NA 1MK9B 2MDXA 1NTVA 2ELAA 2J0MA 1GC7A 3T06A 1FGYA 2P8VA 1X05A 2NMBA 4WVFB 2EJ8A 4DIXA 1BTKA 1WGQA 4QJ3B 3TO1A 4ZRKA 3D8FA 3AJ4A 2QKLA 3SYXA 2M14A 2VSZA 2MFQA 2EMSA 2FJLA 2GJYA 2D9XA 1OY2A 4HAUB 3BJIA
chains in the Genus database with same CATH topology
3GYPA 4GOUA 4QJ5B 3FSSA 4KHBB 2ZKMX 4OSNA 3OHMB 5I2MA 2GCLA 2KR0A 3NWFA 2K8EA 4D6WA 5LG4B 5IRSA 2GCJA 2YT2A 5M4YB 4KHAA 2Z14A 3U12A 4DIXA 3A58A 4QJ4B 2Z13A 2Z59A 3TO1A 3NWDA 4QJ3B 5I2SA 4CSQA 2KUQA 2NBVA 4KHBA 4L1RA 2KIGA 2K49A 3TW1A 3TVVA 1ZYIA 4PQ0A 2FJUB 4IFSA 2GUMA 4OT1A 4Z2NA 4QXAB 3GYOA 3HIEA 3NW8A 2Z4DA 2KIEA 2R2YA 3FVCA 4GNKB 2RRFA 4IOYX 3NWAA 4HSIA 4KHOA 4Z2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIG A;  2KIE A; 
#chains in the Genus database with same CATH topology
 3KSY A;  1MIZ B;  4MY6 A;  3WA0 A;  3MPX A;  2I5C A;  1AQC A;  5D3W A;  3PVL A;  2DHJ A;  2Y8G A;  1FHO A;  4P7I A;  1EGX A;  1WJM A;  1ZC4 B;  1SGH A;  2NBV A;  5C5B B;  4C0A A;  2OTX A;  4HAZ B;  3FEH A;  3KRW A;  3ML4 A;  2LYD A;  1Z87 A;  2Z0Q A;  3A8Q A;  4IFS A;  3VOQ A;  1N3H A;  2EMT A;  1BTN A;  4HSI A;  2LOZ A;  1J19 A;  2RUK B;  3FSS A;  1V89 A;  5LOP B;  1U27 A;  2W2X D;  5FI0 A;  2KUP A;  3NWF A;  3SUZ A;  5GOW B;  4PNK A;  4D6W A;  1V88 A;  5LG4 B;  1U5F A;  5M4Y B;  3KRX A;  4K81 A;  5D3V A;  1FHW A;  2Z13 A;  2H7E A;  1KZG A;  3NSU A;  1ZVR A;  3N7C A;  4A6K A;  2W2W A;  4DBB A;  4KAX B;  1LB1 A;  1RRP B;  2R2Y A;  4GPT B;  2K2U A;  3VIA A;  3DXC A;  2I5F A;  1ZC3 B;  1QC6 A;  2K2J A;  5DIF B;  4ZRI A;  2Z0P A;  2XQN M;  4GZU A;  3OHM B;  4GMV A;  3CXB B;  2X18 A;  2LKO A;  1WG7 A;  3X23 A;  3U12 A;  2NZ8 B;  2Z0O A;  1FHX A;  4XWX A;  1MK7 B;  4WJ7 A;  2R09 A;  1U5G A;  2AEH A;  3TVV A;  5JP4 A;  2CY4 A;  3DXE A;  1GG3 A;  1UNR A;  2Y7B A;  4GXB A;  4F7H A;  3GYO A;  1SHC A;  2COF A;  2Z4D A;  3NW8 A;  4HAX B;  3KY9 A;  4GNK B;  4IOY X;  2D4Q A;  1EVH A;  4K17 A;  5C5B A;  1E5W A;  4ZRJ A;  2LG1 A;  2M38 A;  5I2M A;  3RCP A;  1MIX A;  1XCG A;  2RSG A;  1ISN A;  2UZR A;  5I2S A;  3HSA A;  3F5R A;  4GN1 A;  5HE3 A;  2QKM A;  5C16 A;  1U5E A;  1K5G B;  2J0K A;  5KQ4 A;  3PP2 A;  2DKQ A;  2D10 A;  4Z2M B;  3A8P A;  4NY0 A;  4QJ5 B;  2YS3 A;  5DI9 B;  1H4R A;  2Y8F A;  2YT0 A;  3IVF A;  1UNQ A;  3QIJ A;  4F7U P;  5D3X A;  4A6F B;  2I1K A;  1IRS A;  3SO6 A;  1ZYI A;  1XOD A;  4YON A;  2YT1 A;  4HDQ A;  2CAY A;  3HK0 A;  5DHA B;  5KQ1 A;  1EF1 A;  1NI2 A;  1LW3 A;  1RJ2 A;  2L1C A;  2RVB B;  5HE2 A;  2D9Y A;  1OQN A;  4HB0 B;  1GC6 A;  2RGN B;  1MAI A;  3ZVR A;  2DA0 A;  1V5P A;  3A58 A;  3AU5 A;  1PMS A;  4HB4 B;  5EFX A;  3ODO A;  5L81 A;  4OT1 A;  1QQG A;  2PZ1 A;  1B55 A;  4DX8 A;  2KIE A;  5C6R A;  2ROZ B;  4EKU A;  2DFK A;  2L2I A;  4KHB B;  2YRY A;  2ZKM X;  1X86 A;  1Y5O A;  2YT2 A;  2EC1 A;  2YS5 A;  4EMO A;  2D9Z A;  3P7Z A;  2MKR A;  4IAP A;  2KGX B;  2KIG A;  1NU2 A;  2VKI A;  1DBH A;  3O96 A;  4D0N B;  1DDW A;  2K00 A;  5C79 A;  5J3Q A;  2D9W A;  5JLJ B;  4A6F A;  5KCV A;  2N0Y A;  1WGU A;  3M1I B;  4K2O A;  2UVM A;  3ODX A;  2W2X C;  1Y19 B;  2J0J A;  3CIK A;  2DHI A;  2DYN A;  1BAK A;  3ODW A;  1OMW A;  1AWE A;  3NWD A;  2YS1 A;  3TW1 A;  3KZ1 A;  3D8E A;  2G35 A;  1J0W A;  4QXA B;  3FVC A;  2I1J A;  1ZM0 A;  1FB8 A;  3TCA A;  2AL6 A;  1UNP A;  3OAN A;  2JP2 A;  2V76 A;  2GCL A;  2P0H A;  1H10 A;  3QWM A;  5IRS A;  1MI1 A;  2GCJ A;  2H7D A;  2IFS A;  4QJ4 B;  4HHV A;  1XX0 A;  2D9V A;  2KCJ A;  4NSW A;  2DKP A;  4CSQ A;  2COC A;  4L1R A;  4KHB A;  2UZS A;  2Q13 A;  5J3T A;  4L6E A;  1NTY A;  3HQC A;  1MKE A;  1I7A A;  3QBV B;  1T77 A;  5DH9 B;  3ZDT A;  2BCJ A;  5JHG A;  1V5M A;  4KVG B;  3DXD A;  5HE0 A;  3AU4 A;  4TYZ A;  1FAO A;  2GUM A;  1WVH A;  2DN6 A;  1WJ1 A;  3SV1 A;  1U29 A;  4HB2 B;  2DHK A;  2P0F A;  1TJ6 A;  4OSN A;  3P6A A;  1DDV A;  3ULB A;  3G9W A;  1FOE A;  2DLW A;  2YVC A;  4K2P A;  2COA A;  1W1D A;  5D3Y A;  2OQB A;  4PQ0 A;  2N23 A;  2ROV A;  3PEG A;  2D11 A;  1V61 A;  1BWN A;  1TXD A;  2DX1 A;  1M7E A;  2VRW B;  1EAZ A;  4HDO A;  2YF0 A;  1KZ7 A;  1Q67 A;  2COD A;  5JHH A;  3DCX A;  2YSZ A;  2ADZ A;  1V5U A;  5LON B;  2R0D A;  4HAW B;  1KI1 B;  2Z59 A;  4EJN A;  1PLS A;  3V5W A;  2J59 M;  3HW2 B;  2MWN B;  3BIN A;  1X1G A;  2D2Q A;  4HAT B;  1U2B A;  4B6H A;  1P5T A;  2E2X A;  2RRF A;  3NWA A;  1I2H A;  4HAV B;  1PFJ A;  3GYP A;  4GOU A;  1W1H A;  1U5D A;  4A5K A;  3SNH A;  1ZSQ A;  5J3Y A;  1P3R A;  2ELB A;  4MT7 A;  1XKE A;  3PG7 A;  1X11 A;  1UPQ A;  2LUL A;  3MDB C;  1MPH A;  4HB3 B;  4F7G A;  2HE7 A;  3B77 A;  5HE1 A;  4CYE A;  5FI1 A;  1FGZ A;  3LJU X;  3F0W A;  4A6H A;  3U8Z A;  4YL8 A;  5DHF B;  1XD4 A;  4BBK A;  1DRO A;  3U7D A;  2DTC A;  4KHO A;  3PVW A;  4CHJ A;  3UZT A;  2KR0 A;  1UPR A;  4WSF A;  4KHA A;  2Z14 A;  2GS0 A;  2LOX A;  4CHM A;  4HAY B;  1P6S A;  1TQZ A;  2KUQ A;  1DDM A;  2P0D A;  5CLQ B;  2FJU B;  1M7R A;  1W1G A;  4MK0 A;  3HIE A;  5CLL B;  3A98 B;  2DYQ A;  1X1F A;  3TFM A;  4DXA B;  1WI1 A;  3PSC A;  1UEF A;  2HTH B;  3D8D A;  3FM8 C;  2RLO A;  2ZPY A;  4GMX B;  5D27 A;  3ULC A;  2IYB A;  2DX5 A;  2K8E A;  3PZD A;  2RNR B;  1XR0 B;  2K49 A;  4DX9 0;  1K5D B;  4TKN A;  1DYN A;  2CY5 A;  3WYF B;  2CRF A;  3PVU A;  4Y94 A;  4H8S A;  4Z2N A;  1MK9 B;  2MDX A;  1NTV A;  2ELA A;  2J0M A;  1GC7 A;  3T06 A;  1FGY A;  2P8V A;  1X05 A;  2NMB A;  4WVF B;  2EJ8 A;  4DIX A;  1BTK A;  1WGQ A;  4QJ3 B;  3TO1 A;  4ZRK A;  3D8F A;  3AJ4 A;  2QKL A;  3SYX A;  2M14 A;  2VSZ A;  2MFQ A;  2EMS A;  2FJL A;  2GJY A;  2D9X A;  1OY2 A;  4HAU B;  3BJI A; 
#chains in the Genus database with same CATH homology
 3GYP A;  4GOU A;  4QJ5 B;  3FSS A;  4KHB B;  2ZKM X;  4OSN A;  3OHM B;  5I2M A;  2GCL A;  2KR0 A;  3NWF A;  2K8E A;  4D6W A;  5LG4 B;  5IRS A;  2GCJ A;  2YT2 A;  5M4Y B;  4KHA A;  2Z14 A;  3U12 A;  4DIX A;  3A58 A;  4QJ4 B;  2Z13 A;  2Z59 A;  3TO1 A;  3NWD A;  4QJ3 B;  5I2S A;  4CSQ A;  2KUQ A;  2NBV A;  4KHB A;  4L1R A;  2KIG A;  2K49 A;  3TW1 A;  3TVV A;  1ZYI A;  4PQ0 A;  2FJU B;  4IFS A;  2GUM A;  4OT1 A;  4Z2N A;  4QXA B;  3GYO A;  3HIE A;  3NW8 A;  2Z4D A;  2KIE A;  2R2Y A;  3FVC A;  4GNK B;  2RRF A;  4IOY X;  3NWA A;  4HSI A;  4KHO A;  4Z2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...