2KJ5A

Solution nmr structure of a domain from a putative phage integrase protein nmul_a0064 from nitrosospira multiformis, northeast structural genomics consortium target nmr46c
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
116
structure length
116
Chain Sequence
MAEKNAYTVAQLADEYFERMIAGRWKHPNIVRSRIEKDIKPAIGSLKVEDVKPRHIDDVLKAVMKRGAPSIANDTLRWLKRMFNYAIKRHIIEYNPAAAFDPGDAGGKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of a domain from a putative phage integrase protein Nmul_A0064 from Nitrosospira multiformis, Northeast Structural Genomics Consortium Target NmR46C.
rcsb
source organism Nitrosospira multiformis atcc 25196
molecule tags Structural genomics, unknown function
molecule keywords Phage integrase
total genus 36
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kj5A00
2HOIA 2KJ8A 5CRXA 3LYSA 2KOBA 3C29A 1Q3UA 1DRGA 1MA7A 1KBUA 3MGVA 2KD1A 2KKVA 1XNSA 4ACOA 1A0PA 2KEYA 2KIWA 1NZBA 1F44A 3C28A 2HOFA 1PVQA 4CRXA 2KHQA 1XO0A 2KJ5A 1P7DA 1PVRA 2OXOA 4A8EA 1CRXA 1Q3VA 1PVPA 2A3VA 2KKPA 1OUQA 3NRWA 1Z1BA 2KJ9A 1Z19A 3CRXA 2CRXA 2KHVA
chains in the Genus database with same CATH superfamily
2KSOA 3T79A 1RYRA 2AGPA 2Y9TA 3BS5B 4C8LA 1ZQDA 3RAQA 4DCCA 4J9QA 2NRTA 4DQQA 4C4TA 4DS4A 2OWOA 2BCRA 1N2XA 5KFUA 3PZPA 1Z1BA 3SQIA 3BS7A 3KKAC 3GV5B 3PV8A 4NM1A 1UA1A 2AH5A 3DV9A 4CNQA 2F8LA 5AM0A 2O6KA 2VANA 5AM5A 1PVQA 3MFHA 4QZHA 1ZRNA 5ALGA 3RH5A 1BGXT 5BPCA 2F2AB 3RBDA 2R8KA 3AU2A 4ELUA 4EYHB 3QU9A 8ICCA 4DSEA 3D2SA 1NK4A 5J0OA 4DQRA 2WF8A 4OJLA 2WHEA 4F4KA 4FZNA 3N7PD 3OHBA 2WB1F 3EPIA 1LKYA 1IG6A 1ZJMA 3PSFA 1SGGA 3T5KA 4E0DA 4O3NA 1OUQA 1LVHA 3C2MA 5EE9A 2W9BB 3MDCA 4I2DA 4RQ4A 1XC9A 1F0MA 4R63A 1D8YA 3WKAA 3JPSA 4UB2A 4NXZA 1SB3C 5KT7A 1URJA 1V97A 2MUTB 1A77A 1T8EA 2DKXA 4DF8A 2W43A 2QB0A 2W9CA 2ZG6A 3H8JA 3TADC 1ZQEA 3UQ0A 5T14A 4F4YA 4M9NA 3ZDDA 8ICHA 2RRDA 3RJKA 2ZXIA 4HAIA 5HHIA 1B0XA 1QCKA 5HMMA 1S0MA 1SV0C 3ZDCA 2VA3A 4EZ9A 3JPRA 2PFNA 4KLHA 3NASA 5ALEA 3KTQA 2EQYA 2NRWA 4Q43A 2KVSA 4NWIA 2ASLA 3RJJA 4JB3A 1ZRMA 4ECXA 3UXOA 2ODGA 5J0YA 3AL0B 1BPXA 3IG5A 5ALVA 3F2BA 3ISCA 1ZQIA 3H40A 1TE2A 1N5WA 3KHRA 4C8NA 2HW3A 2AQ4A 3MR6A 3SD7A 3L5KA 4MHVA 1NZPA 4O3PA 3CRXA 4GXIA 1FIQA 1ZD4A 5KT4A 4PL1A 3IRUA 2KD1A 1M6YA 4Y2JA 1QSLA 5L1JA 3KHLA 1XWLA 4DFMA 2IMWP 5KFGA 3M7DA 1U4BA 8ICTA 4QNLA 1NJYA 5J2AA 2JMGA 2G5HB 4IR1A 4O3OA 4EX6A 4QZ8A 2EANA 4ECVA 2VJ5A 4ED1A 3MGVA 2PXIA 2PFOA 2QARA 3Q8KA 4QZGA 1X9XA 5KT2A 3RJHA 2A1JB 3GV8B 5CB1A 4IL6U 5DBCA 4P0QA 1YZ6A 4DFKA 1A6SA 7ICQA 3T5HA 5DBAA 4O3MA 2FDRA 2UVRA 3AU6A 2JXJA 2BDPA 4F4XA 2ZXHA 5B66U 2ZIUA 1KBUA 1SXEA 9ICJA 4FBTA 2YB4A 4DEZA 4NLZA 4RQ7A 4DWIA 2BZFA 1JX4A 2MRLA 1J2MA 2EAMA 2H5XA 4PL2A 1ZQMA 5DGAA 2B21A 2JRZA 1JUDA 3GU3A 2E5SA 5KT6A 2L5YA 3PR5B 2G5IB 3RH6A 2HSZA 1BPBA 1JN3A 2KP7A 5DLFA 3RH4A 3QEAZ 1ZYQA 1XS9D 5KFMA 2M9NA 2VJ4A 1ZQNA 4TUQA 4TQRA 4RT2A 9ICTA 3T5JA 3EZ5A 4DOAA 9ICVA 3ETRA 5IIMA 2A3VA 2Y0SF 3KD3A 5EWGA 2MSNA 1Z19A 2DFLA 1UT5A 3IP4B 3PR4A 2BQ3A 3I1YA 3ONNA 3KHHA 4ACOA 8ICRA 2HBKA 1MC8A 4OO1J 3Q8RB 3NRZA 1F44A 4ELTA 5KAFU 3SAHA 2H3QA 3QUQA 5D46A 3PNCA 1MQ2A 1FFVA 2M0NA 5ALQA 5L1LA 1RYSA 4RQ1A 1RDFA 3SMVA 4YCXA 3SAFA 1ZQAA 4NLCA 2W54A 4US9A 4K4GA 2ZUBA 2F1IA 1JRPA 3F5AA 2HOQA 4DQPA 3HILA 1L8OA 5AICA 2VIXA 1Z00A 3TAPA 2OCEA 4PHAA 3F53A 9ICAA 4YMNA 2DF4B 3TI0A 3GIJA 5JRTA 1K1SA 2A1JA 2XIDA 1WG8A 2BCVA 1ZD2P 2KIVA 1O08A 3I76A 2OXOA 3WK5A 3KFUF 2WFAA 4K4HA 3CW2C 3ISDA 1IV8A 3QX7A 5J0XA 1QH9A 2W7OA 4YMOA 7ICTA 4YN4A 2IOFA 2LYHA 5FP0A 5JUMA 5L1MA 2NYVA 5TISU 1SL1A 3WK4A 4P4MA 4C0ZA 4EELA 3TQ1A 4DL5A 5DBBA 3UQ2A 4P4OA 4NL9C 3PW5A 1ZQTA 5DKWA 2C22A 4O5CA 2HVHA 4YMMA 4DLGA 4MF8A 8ICAA 9ICCA 5J0UA 4DF4A 4I2GA 4DL4A 3ZDAA 4B6JA 3NGDA 5KFSA 2K4EA 1N48A 1JMSA 1SV4A 5AKEA 1NK0A 2E8PA 4C8OA 3AQEA 4RQ0A 7ICPA 2VA2A 4ECSA 5IIJA 1PZNA 1ZQ1C 9ICMA 1XNSA 2V9WA 5L9XA 3NTUA 4MEXA 3O0FA 4DL2A 4O0IA 2NO5A 4B9SA 2LYAA 2Z7JA 4PHPA 2WB1C 5ALJA 4I2HA 5DQGA 3K1RB 3KKAA 4XQ8A 9ICSA 2J6TA 5J2CA 4QZ9A 3IDWA 1B43A 4KMUA 3L3FX 2W9CB 5J8YC 3HKZF 4DS5A 2H3VA 1CEZA 3AMZA 3HKZC 4PHEA 2LMRA 1UHUA 3Q8MA 2BCSA 2I6XA 3TKAA 1KN5A 4LJXA 2IHNA 3MFIA 3CNHA 2KMDA 2KJ9A 3H0LB 4PH5A 1ZOLA 2OH2A 2PMZC 3OSNA 2ZJ5A 4IRKA 4PJ0U 2DGZA 2KOBA 2WF9A 2XY7A 3GQCA 1MA7A 2BPCA 7ICNA 1N60A 1XSPA 1IIPA 4ED6A 3T3FA 1KRPA 4UB1A 1JROA 4BJQA 7ICVA 2R8IA 5HR7A 3T5LA 2CRXA 4ED2A 1DRGA 1A0PA 3UMCA 2FPKA 3AEVA 2K4IA 4G9BA 5J0WA 5AKLA 4M9HA 2W9MA 8ICZA 5J0PA 3JPTA 3RTVA 1AQ6A 2LKYA 4EEYA 1T3QA 1TK8A 4O3RA 3BQ2A 1WUDA 2JEGA 1VLBA 4ECQA 5EE3A 5ALDA 1JXEA 2E3TA 5ALOA 4F92B 3N97B 3JPQA 1KFSA 9ICUA 1KLNA 2XGPA 2NRXA 3OHAA 1S0VA 3M1YA 5HNKA 4P0QB 5K4LA 3QUCA 4UW9A 2IA6A 3R9KA 3B0XA 1MSWD 2B0CA 4C7ZA 3IV6A 1IM4A 2ES6A 4F8RA 1NK7A 4J9MA 4RQ6A 2P35A 2DQNB 1B22A 1NK8A 4MF2A 4DL6A 2A1AA 2LHTA 5F3XB 4QZDA 4GXJA 3AUOA 4RPYA 2CXYA 4KX5A 4UAYA 1Z00B 3BQ0A 1NNLA 1Q3VA 3RRGA 1ZETA 3H8MA 5H2FU 4GC7A 2AQ0A 3V72A 5KFFA 5J0SA 2FI1A 4I2IA 2YMQA 1YT3A 3WK7A 4KN7A 4NLKA 2BDUA 2KZ3A 4C7YA 5CWRA 5J2BA 4TQSA 3G6VA 1LV5A 1PK1B 5DB7A 2JEIA 7ICLA 5KL8B 4LVSA 4FBUA 5AKYA 1K5OA 2XCPA 3I28A 4Y2PA 2KNJA 4M6WB 1PVPA 1QQ5A 5ALTA 3RR7A 2Y1IA 1N5XA 2K4HA 3OSPA 5KFKA 3EWAA 1C7YA 2N1RA 4U7CA 1A76A 2C2DA 2QARB 1ZQGA 1ZQBA 3F5EA 3D2QA 4DQIA 1N61A 4RNNA 7ICFA 1KTQA 1HUOA 4OJ5A 4YD2A 1DK3A 3N28A 4UQGA 2HBLA 5KFQA 5AM3A 2HOIA 4R66A 2EAPA 4FZMA 2DUYA 5ALIA 5AK3A 4F5OA 1RG6A 4EX7A 1MQ3A 4CF3A 1S9FA 4BDPA 2YN4A 1NOMA 3GV7B 1ZQYA 2JGAA 2E8OA 4B9TA 1HIWA 4IQVA 5KG2A 4DL3A 4B9LA 1IXRA 2EZYA 4KN4A 1ZQCA 1X42A 4DQSA 1QSYA 3QEBZ 3CP8A 2KICA 2C2EA 4TURA 4F71A 4JWMA 4UAUA 1BPZA 5DG9A 5ALZA 3V6HA 1ZQJA 2J6SA 4BXOA 4US8A 2R18A 3RB3A 8ICXA 3LWLA 4UBCA 5EWFA 1TAMA 3PSIA 4KLGA 4B9UA 3QNMA 5G5GA 4M9GA 4NV0A 1ZD3A 8ICFA 5ALMA 4K4IA 5KFVA 3V7LA 5KG5A 1SIJA 1NK9A 4J9RA 2OM6A 3PMNA 3EPGA 2K8AA 4YD1A 2XY6A 4NY8A 2J6UA 3MR2A 3G6XA 3ICXA 4FO6A 2P6UA 4NM2A 1TVAA 3UPQA 3K75D 9ICNA 2ASDA 5DDYA 4RUAA 4EEKA 1BVSA 5AI9A 4Q45A 3WKEA 3TACB 1V38A 3JPNA 4YQWA 3BQ1A 1RQLA 5B5EU 7ICOA 1PVRA 1DXSA 1DOQA 1U9LA 4I2JA 5KFOA 5KG4A 4KLDA 2WF5A 1SWVA 4GFJA 3PSTA 2DKZA 3HJEA 1XU4A 2B6GA 4JUZA 2PMZF 3IHQB 3HPOA 3PX4A 1ZQXA 2LBOA 1D9DA 4I2CA 4I27A 3RAXA 1D9FA 3D2NA 2AGQA 3PX0A 4CF4A 4F2SA 3UXNA 2V4QA 1HUZA 2FJ6A 4BXOB 2GH1A 1S76D 4LZDA 1NKBA 2KKPA 5ALHA 1BPDA 3PW4A 4Q44A 4DSFA 2KHVA 8ICIA 3B0YA 5AKGA 4J9OA 4HYKA 2ESEA 1Q46A 4QIWF 4BUGA 2HVIA 2QB1A 2XVTA 3FM9A 2F1HA 2KHQA 1FFUA 5J2FA 2KFNA 4Y2YA 2FLLA 2OEHA 5AKKA 1ZQSA 1ZQOA 2C2RA 4UB5A 1NKCA 3ALRA 2F44A 2DPIA 5C5JA 4M47A 1L6NA 3C28A 4QJFB 3GZFA 3BDPA 5TZVA 5AK6A 4ECTA 5DB9A 4RQ8A 2BR0A 2JEFA 4UB8U 2KFZA 5HMLA 1BPYA 2W9AA 2BPGA 3BZKA 4C8KA 2V4RA 1FEZA 1QLNA 4QZCA 4QZAA 2XC9A 4QWEA 7ICUA 2ZIVA 5ALYA 4O5EA 3QUBA 5JU5A 4EBEA 2ZIWA 2HHQA 4Y2TA 3UMBA 2DL0A 1D8LA 4M6WA 3TAQA 3HX0A 4RUCA 4M9JA 4Z6CA 3H0MB 5ALRA 2H3ZA 4RNOA 3WKDA 3MABA 1X2IA 5KFYA 2R8JA 3BQ7A 1JI7A 3C21A 4Y2XA 2WAQC 4QW8A 5KFZA 2WAQF 5AK4A 5DQIA 4OD0A 1COOA 1ZQLA 5AI0A 1UT8A 4USAA 2W04A 3WK6A 1COKA 4AYBF 2ISPA 2F77X 2ZIXA 2GO7A 1VJ5A 2KG5A 3QU5A 3TANA 5BOLA 4I2EA 1JXLA 4GC6A 1JALA 3EW9A 1L7NA 3GILA 3AM9A 2YMLA 5KFPA 3ZDBA 1DK2A 5ALSA 1WYGA 4RQ2A 3PW0A 1KEJA 2W03A 1BNOA 4QZBA 4Y2UA 1S5LU 3HWTA 4BGDA 5AKHA 5HP4A 2W11A 5IILA 1Z1VA 4FE3A 4IS7A 3PO5A 4NLGA 2YY6A 5ALFA 2PFQA 2HHSA 4CE6A 1AROP 2ZTCA 4ECWA 1NJWA 7ICMA 4IC9A 4JWNA 3NUQA 1KSPA 4DFPA 3H7IA 1SKSA 2HBMA 1KW4A 4J03A 4UARA 8ICVA 5DQHA 2GLEA 3WK9A 8ICEA 2UVWA 3MDAA 4KLEA 4F2RA 3TFRA 5ALNA 2MA1A 2AU0A 2W3SA 4BX9C 3JPOA 5ALXA 3QXGA 4IQUA 3ZDEA 2XCAA 2E1EA 1TV9A 4Y2RA 2FPMA 5KT5A 3OJUA 1XSNA 1ZQPA 2E1FA 2G07A 4UBBA 3RB4A 1T94A 1N63A 2HBJA 9ICEA 2LM1A 2HHTA 1TFRA 3E2EA 1C20A 3THVA 3PY8A 5JTIA 3M8SA 2K4PA 1X66A 3C2KA 5J0TA 3M9NB 5J2KA 4X5VA 4RU9A 3K1ZA 4BWJA 2RDJA 4NLBA 1LB2B 2F8KA 3RJFA 3RB6A 3KZXA 4Y2VA 2IHMA 1RXWA 5J2JA 1TK0A 3MGHA 9ICIA 4B9NA 5DG8A 4DSKA 1DGJA 4RZRA 2LPEA 4Z6DA 2E8NA 3RBEA 2VA8A 4ED3A 2BCQA 1SL2A 4ED8A 5ALPA 3UXPA 2XY5A 8ICSA 8ICJA 5KFXA 3SAGA 2H3FA 5ALWA 2IOFK 2JZBA 1ZQFA 4F5QA 4KLLA 4I28A 1Q3UA 2Q4TA 3MBYA 1F5SA 8ICMA 3DEEA 2LM4A 4F72A 3L4PA 3PVXA 4P0PA 4J9KA 4IRCA 4KLOA 4EZ6A 3LWMA 1NI3A 1ZQWA 4KLIA 1BNPA 3TFSA 1KDHA 3V7KA 2JV3A 4KLJA 4F5PA 4Q8FA 1L7PA 3S6JA 3FAHA 2KJ8A 3VC8A 4UB3A 5D4BA 3NS1A 3LVVA 2KN7A 4B9VA 4C80A 3JPPA 3C23A 4KLMA 2HHXA 3QU7A 2NRZA 7ICGA 1XO0A 2XICA 3IG8A 4O3SA 3G6YA 3F2DA 2PFPA 4KLTA 3M9MB 3ED5A 5AM2A 2I9GA 9ICXA 5CHGA 5KFDA 3H8SA 8ICLA 2QKQA 4YFKA 8ICWA 1ZQRA 1RPLA 3OPXA 2PI5A 5AHXA 2H3IA 2OHFA 2YMPA 3QUTA 1S10A 8ICKA 4PZNA 2JH7A 4YG2A 1UCVA 4QW9A 4KX3A 5KG3A 1QQ6A 4F91B 2ATLA 4QWAA 1CRXA 5IIKA 5ALKA 4M2YA 4ED7A 2GOLA 3QYPA 7ICEA 4IRDA 5AKXA 2WF7A 2BQRA 9ICWA 4UB6U 3HP6A 4UATA 1V85A 1L3UA 4PPXA 4MEYA 4OCZA 5ALLA 1O03A 2W8LA 5KFAA 1Q8KA 3GIIA 3E58A 4XRHA 2W8KA 2ALZA 3BJYA 3Q8SB 4YR0A 2DPJA 1RXVA 4DOBA 3LVWA 4I2AA 9ICGA 1J2NA 4DFJA 1H38A 2IBKA 2KEYA 4C4RA 8ICOA 1KKXA 2K89A 2G08A 5L1IA 3Q8QB 4RQ5A 2PI4A 3FYHA 4R8UA 3E0FA 3M8RA 2JH1A 4EENA 4ECYA 5F9LA 4DSLA 2F3NA 5AI4A 5CA7A 1UQVA 3CYMA 4I2BA 4QWDA 3Q8LA 4GLXA 2AJQA 5J2IA 4P2HA 1WWVA 2FMSA 4CDGA 4EYIB 3N7RC 5EOZA 5DDMA 4DSJA 1CI4A 2C28A 4F5NA 5EE0A 1ECWA 2KJ5A 3KOOA 4JV2A 5CJ7A 1X6JA 2AHOB 1NK5A 5DB8A 3NVVA 3ORYA 3J81j 5KFBA 3QE9Y 3PW2A 1XO1A 4UASA 2Y1JA 1RZTA 1NJXA 2BPFA 4TUSA 5KFWA 3PMLA 4IQWA 4I2FA 4ECRA 1QQ7A 4KITB 3D6JA 3KZIU 4YVZA 1SXDA 4O5KA 4DOCA 4AYBC 5J2GA 4F50A 8ICPA 2QLTA 1KL9A 4XUSA 2XO7A 2YX8A 4NJ8A 4QWBA 4YXJA 4J9PA 2ZTEA 3BZCA 2W7PA 1SL0A 3WK8A 1Y88A 5ALUA 2ASJA 3C5FA 5EWEA 2FLPA 4GXKA 2LYBA 4YR3A 1X6IA 4Z6EA 7ICKA 1SZPA 1WCNA 1RYUA 1B4FA 4KMOB 2FLNA 4ECUA 3FC4A 3RR8A 1NK6A 2D3DA 1ZQZA 5L1KA 2FMPA 3MGIA 3PSPA 4F5RA 4RNMA 2G06A 1KFDA 3RJGA 4KTQA 4G3IA 7ICIA 5HR6A 2BQUA 5AK5A 5KFNA 1ED1A 1DGSA 2RLTA 4KLFA 1X9WA 1MN8A 5AIBA 4Q8EA 2FE9A 3ZD8A 5AI6A 3AQFA 4R64A 4PZOA 4O3QA 4MFCA 3RB0A 5KG7A 3WU2U 5KFEA 5DB6A 3IM1A 3Q8PB 4OJPA 3SV3A 7ICHA 1L8LA 2F76X 3MC1A 3H4BA 4QZFA 4DSIA 3TADA 1BPEA 5KFHA 5DGBA 5J0RA 4DL7A 2NRVA 4YXMA 1CUKA 2OYYA 1NJZA 5E79U 1JIHA 2KIWA 9ICKA 4RPZA 2P66A 2G09A 1TK5A 1UPHA 3DDHA 2EZZA 4F3OA 4CF5A 4U6PA 5KTQA 5CR0A 1FO4A 3C1ZA 4MFAA 4EBCA 2AXTU 5C0YA 4PGXA 2HCFA 1ZQHA 4RT3A 4M0AA 1HJPA 1N56A 2QB0B 3MR3A 1U48A 1GO3F 2WF6A 3U26A 2I1QA 2ZIUB 3QU4A 5AKJA 3GFKB 7ICRA 3SENA 1U45A 2JHDA 3RJEA 3BQTA 4F4ZA 4IQTA 1LKYB 4JK1A 1PUZA 1RM6C 2HHWA 3A0HU 3H4DA 2EH9A 2IOHA 4Z6FA 1ZXIA 2JZBB 2GWSA 2I5HA 9ICBA 2BCUA 4UAWA 3SZ2A 1SKWA 4ICAA 1J97A 4R8UB 3C5GA 1ZQUA 4IR9A 3SYZA 2ZUCA 4DO9A 3M6ZA 4NL9A 4M04A 1V9PA 3EYZA 4OJ6A 2CN1A 2HDOA 2K8CB 2WTFA 1T7PA 5BOMA 5D49A 2W9BA 1ZD5A 4UAZA 2EDUA 1L3SA 4QZIA 5DLGA 2UVUA 3RRHA 4PGQA 5IINA 3HT3A 2BHNA 2Q0ZX 5AIAA 1PK3A 4FS2A 4PHDA 2LI6A 3WKBA 1NZBA 4FS1A 4P4PA 2YMMA 4J9LA 4ED0A 3TARA 2KZZA 5G5HA 3SI8A 2KSOB 4RQNA 4DLEA 5J29A 9ICOA 7ICSA 1OXJA 3ZI4A 4Y2SA 5KFCA 2JR5A 1S77D 4QIWC 4P0PB 3SEIA 3OGUA 1S0NA 1Z4NA 2DWQA 9ICRA 5KFLA 4ELVA 1NKEA 3IN5A 5AKZA 1QTMA 3KHGA 1EXNA 2W3RA 4JMUA 5J2EA 3LDAA 3QZ8A 3FDSA 4KLQA 1N62A 2R8HA 4B9MA 5KG0A 4UAVA 1X9SA 2PKEA 3PW7A 9ICLA 4NLNA 2RQ5A 2KV2A 5AKIA 2ZTDA 5CP2A 4BWMA 2NO4A 3GIKA 8ICBA 1L3TA 4JV1A 2BKEA 4Y2QA 2AGOA 3B9JA 1ZQKA 4RQ3A 1S8OA 3UM9A 1P7DA 1KQQA 1ZJNA 3QU2A 4ZOHC 3ETLA 5KFTA 8ICQA 3N7SC 2EAOA 3SR6A 8ICNA 4EBDA 2CPRA 2D8CA 8ICGA 4TUPA 1TKDA 3GDXA 4KLSA 4PGYA 5KAIU 2K8BB 4WJ3B 2P6RA 2EZXA 3A0BU 2KZMA 4CRXA 2FPLA 1Z3EB 3KBBA 3AN1A 2KE7A 2BGWA 4RQMA 1OW5A 3N4MB 3OJSA 5CEHA 4DFDA 4KLUA 1YZ7A 2KK0A 3C1YA 1QSSA 9ICPA 5J0QA 1S0OA 2KVCA 1SWWA 2HMXA 8ICUA 4UB4A 5AM4A 4LZGA 2XI9A 3BS5A 1TAUA 3HRDD 5GTIU 2ZJ8A 2W55A 1K1QA 2YTUA 2ISOA 4XA5A 4MFFA 4C4SA 2XGQA 2ZIVB 2A19A 5IIIA 1WCLA 2RDIA 1RQNA 4QWCA 3ISBA 3NVYA 1KFTA 1VDVA 5KFIA 3H8WA 5EE1A 2YB1A 5J8YA 3F2CA 3HW8A 3PO4A 5KT3A 2D6FC 1WWUA 3V7JA 1ZQVA 5IIOA 4CCHA 2RHFA 3M9OB 2KTQA 2YQEA 5DG7A 1L7MA 2R8GA 4F93B 2MAXA 5A0LA 1S97A 5AI8A 4J9NA 3H0RB 2FMQA 5KG6A 4YR2A 2HHUA 1TAQA 5KG1A 4JV0A 1SKRA 4ECZA 3M6KA 3K4GA 9ICFA 3NVWA 3V6KA 1L3VA 1T3NA 2DBYA 4O9MA 1PK1A 2HI0A 1D8BA 4J9SA 3V6JA 2MU2A 3MR5A 4M9LA 1XSLA 1U49A 5AI5A 5GTHU 3QZ7A 2E8MA 4A8EA 9ICQA 2Y0SC 4QZEA 3NRWA 1T4GA 2HHVA 3LK9A 2ZIWB 5F9NA 3RFAA 4I29A 1L7OA 5J2HA 3LYSA 3GIMA 3C29A 3OTQA 3ZD9A 4YP3A 2KKVA 1ZQQA 1SZHA 4GIBA 2RP5A 2ZIXB 4CGZA 5KFRA 5KL1B 3VCBA 5J2DA 2G0AA 2K60A 5KNIA 2NV3A 5HHHA 2ZUDA 1Z4OA 2VKQA 4FZLA 5AM1A 4C8MA 1U47A 4F4WA 1X9MA 8ICYA 1UA0A 9ICHA 7ICJA 5CRXA 3SV4A 2JEJA 5KFJA 1SV0A 1X40A 3WKCA 4ZH4A 2UVVA 3UMGA 2MUTA 2HOFA 2F1JA 3EUB2 1L5UA 2Y9UA 4R65A 4AP9A 3PX6A 3RF9A 3C2LA 1HEKA 3NVZA 2ZJAA 4OJOA 4RPXA 3RJIA 4FFDA
chains in the Genus database with same CATH topology
2KJ8A 3M6ZA 3VC8A 2PMZF 2DGZA 2KOBA 2RRDA 2W7OA 2RHFA 2ZXIA 4BX9C 3CYMA 2ZXHA 3LVVA 1F44A 2ZIUA 3AQFA 1MA7A 1KBUA 2LBOA 3SAHA 2LHTA 4OJ6A 3H0MB 3D2NA 4CDGA 3N7RC 2E1EA 2H3ZA 2YB4A 2CN1A 2K8CB 2E1FA 1XO0A 2MRLA 1ECWA 2G07A 2KJ5A 2XICA 3IG8A 4KX5A 1P7DA 1IIPA 4PL2A 4OJPA 3F2DA 4C0ZA 2GH1A 2F76X 5A0LA 3GU3A 1T94A 2E5SA 2HBJA 2WAQC 4BJQA 1Q3VA 2KKPA 3PZPA 2WAQF 3C28A 1Z1BA 2G5IB 3H0RB 3SQIA 5HR7A 3N7SC 3CP8A 2KICA 2CRXA 2KHVA 2OYYA 1YT3A 2W04A 3M6KA 1DRGA 2F8LA 2CPRA 2VJ4A 3OPXA 2BDUA 4NWIA 2H3IA 1A0PA 2KIWA 4AYBF 1NZBA 4WJ3B 2K8BB 2F77X 4QIWF 4BUGA 2R18A 2ZIXA 4AYBC 2XVTA 1PVQA 2K4IA 5KL8B 2JH7A 3K1ZA 2KHQA 4CRXA 3AL0B 2G09A 1D8BA 1TAMA 3PSIA 4KX3A 3IG5A 4NLBA 1UPHA 3F2BA 2KNJA 4A8EA 1CRXA 3KZXA 4NV0A 1PVPA 2Y0SC 2F2AB 2GOLA 2LKYA 2YX8A 4U6PA 3NRWA 2A3VA 2Y0SF 2K4EA 2ZIWB 3AQEA 3RFAA 1Z19A 3CRXA 1WUDA 3IP4B 3LYSA 2W7PA 2K4HA 5C0YA 3D2SA 3C29A 2W03A 3ALRA 3ONNA 4PL1A 1ZQ1C 4QIWC 2KD1A 2KKVA 1XNSA 3T79A 4P0PB 4ACOA 4OJLA 1SZHA 2HBKA 4OO1J 2OM6A 2RP5A 2ZIXB 2KVCA 4CGZA 3O0FA 4FZNA 2HMXA 2K8AA 2LYBA 2H3QA 2N1RA 3N7PD 5KL1B 4QJFB 3GZFA 2LYAA 3VCBA 4U7CA 2WB1F 2M0NA 4FE3A 2Z7JA 2G0AA 1GO3F 2NV3A 2WB1C 3PSFA 3IN5A 2XI9A 3F5EA 2ZIUB 3D2QA 3M7DA 2VKQA 4FZLA 3ICXA 3SMVA 3SAFA 4OJ5A 4NLCA 1L6NA 1OUQA 4QNLA 4KMOB 2JMGA 2G5HB 4JMUA 3F5AA 2HOQA 2HBLA 2H3FA 3SAGA 3LVWA 2HOIA 2ZIVB 5CRXA 2VIXA 2JHDA 4FZMA 4IC9A 4P0QB 1Q3UA 3NUQA 2VJ5A 3F53A 3PSPA 3L3FX 2DF4B 2Q4TA 3HKZF 2G06A 3MGVA 2H3VA 2HBMA 2KEYA 3HKZC 1URJA 2XIDA 2HOFA 3DEEA 5HR6A 2K89A 3RF9A 4P0QA 4P0PA 2KV2A 1PVRA 2ZG6A 2G08A 1HEKA 2ZIVA 2OXOA 1A6SA 2YB1A 3KFUF 1ED1A 3F2CA 4ICAA 5T14A 3E0FA 4GFJA 4O3MA 2JH1A 2JGAA 2DQNB 2ZIWA 2KJ9A 3H0LB 3PSTA 4OJOA 2D6FC 2OH2A 2PMZC 2MA1A 1HIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOI A;  2KJ8 A;  5CRX A;  3LYS A;  2KOB A;  3C29 A;  1Q3U A;  1DRG A;  1MA7 A;  1KBU A;  3MGV A;  2KD1 A;  2KKV A;  1XNS A;  4ACO A;  1A0P A;  2KEY A;  2KIW A;  1NZB A;  1F44 A;  3C28 A;  2HOF A;  1PVQ A;  4CRX A;  2KHQ A;  1XO0 A;  2KJ5 A;  1P7D A;  1PVR A;  2OXO A;  4A8E A;  1CRX A;  1Q3V A;  1PVP A;  2A3V A;  2KKP A;  1OUQ A;  3NRW A;  1Z1B A;  2KJ9 A;  1Z19 A;  3CRX A;  2CRX A;  2KHV A; 
#chains in the Genus database with same CATH topology
 2KSO A;  3T79 A;  1RYR A;  2AGP A;  2Y9T A;  3BS5 B;  4C8L A;  1ZQD A;  3RAQ A;  4DCC A;  4J9Q A;  2NRT A;  4DQQ A;  4C4T A;  4DS4 A;  2OWO A;  2BCR A;  1N2X A;  5KFU A;  3PZP A;  1Z1B A;  3SQI A;  3BS7 A;  3KKA C;  3GV5 B;  3PV8 A;  4NM1 A;  1UA1 A;  2AH5 A;  3DV9 A;  4CNQ A;  2F8L A;  5AM0 A;  2O6K A;  2VAN A;  5AM5 A;  1PVQ A;  3MFH A;  4QZH A;  1ZRN A;  5ALG A;  3RH5 A;  1BGX T;  5BPC A;  2F2A B;  3RBD A;  2R8K A;  3AU2 A;  4ELU A;  4EYH B;  3QU9 A;  8ICC A;  4DSE A;  3D2S A;  1NK4 A;  5J0O A;  4DQR A;  2WF8 A;  4OJL A;  2WHE A;  4F4K A;  4FZN A;  3N7P D;  3OHB A;  2WB1 F;  3EPI A;  1LKY A;  1IG6 A;  1ZJM A;  3PSF A;  1SGG A;  3T5K A;  4E0D A;  4O3N A;  1OUQ A;  1LVH A;  3C2M A;  5EE9 A;  2W9B B;  3MDC A;  4I2D A;  4RQ4 A;  1XC9 A;  1F0M A;  4R63 A;  1D8Y A;  3WKA A;  3JPS A;  4UB2 A;  4NXZ A;  1SB3 C;  5KT7 A;  1URJ A;  1V97 A;  2MUT B;  1A77 A;  1T8E A;  2DKX A;  4DF8 A;  2W43 A;  2QB0 A;  2W9C A;  2ZG6 A;  3H8J A;  3TAD C;  1ZQE A;  3UQ0 A;  5T14 A;  4F4Y A;  4M9N A;  3ZDD A;  8ICH A;  2RRD A;  3RJK A;  2ZXI A;  4HAI A;  5HHI A;  1B0X A;  1QCK A;  5HMM A;  1S0M A;  1SV0 C;  3ZDC A;  2VA3 A;  4EZ9 A;  3JPR A;  2PFN A;  4KLH A;  3NAS A;  5ALE A;  3KTQ A;  2EQY A;  2NRW A;  4Q43 A;  2KVS A;  4NWI A;  2ASL A;  3RJJ A;  4JB3 A;  1ZRM A;  4ECX A;  3UXO A;  2ODG A;  5J0Y A;  3AL0 B;  1BPX A;  3IG5 A;  5ALV A;  3F2B A;  3ISC A;  1ZQI A;  3H40 A;  1TE2 A;  1N5W A;  3KHR A;  4C8N A;  2HW3 A;  2AQ4 A;  3MR6 A;  3SD7 A;  3L5K A;  4MHV A;  1NZP A;  4O3P A;  3CRX A;  4GXI A;  1FIQ A;  1ZD4 A;  5KT4 A;  4PL1 A;  3IRU A;  2KD1 A;  1M6Y A;  4Y2J A;  1QSL A;  5L1J A;  3KHL A;  1XWL A;  4DFM A;  2IMW P;  5KFG A;  3M7D A;  1U4B A;  8ICT A;  4QNL A;  1NJY A;  5J2A A;  2JMG A;  2G5H B;  4IR1 A;  4O3O A;  4EX6 A;  4QZ8 A;  2EAN A;  4ECV A;  2VJ5 A;  4ED1 A;  3MGV A;  2PXI A;  2PFO A;  2QAR A;  3Q8K A;  4QZG A;  1X9X A;  5KT2 A;  3RJH A;  2A1J B;  3GV8 B;  5CB1 A;  4IL6 U;  5DBC A;  4P0Q A;  1YZ6 A;  4DFK A;  1A6S A;  7ICQ A;  3T5H A;  5DBA A;  4O3M A;  2FDR A;  2UVR A;  3AU6 A;  2JXJ A;  2BDP A;  4F4X A;  2ZXH A;  5B66 U;  2ZIU A;  1KBU A;  1SXE A;  9ICJ A;  4FBT A;  2YB4 A;  4DEZ A;  4NLZ A;  4RQ7 A;  4DWI A;  2BZF A;  1JX4 A;  2MRL A;  1J2M A;  2EAM A;  2H5X A;  4PL2 A;  1ZQM A;  5DGA A;  2B21 A;  2JRZ A;  1JUD A;  3GU3 A;  2E5S A;  5KT6 A;  2L5Y A;  3PR5 B;  2G5I B;  3RH6 A;  2HSZ A;  1BPB A;  1JN3 A;  2KP7 A;  5DLF A;  3RH4 A;  3QEA Z;  1ZYQ A;  1XS9 D;  5KFM A;  2M9N A;  2VJ4 A;  1ZQN A;  4TUQ A;  4TQR A;  4RT2 A;  9ICT A;  3T5J A;  3EZ5 A;  4DOA A;  9ICV A;  3ETR A;  5IIM A;  2A3V A;  2Y0S F;  3KD3 A;  5EWG A;  2MSN A;  1Z19 A;  2DFL A;  1UT5 A;  3IP4 B;  3PR4 A;  2BQ3 A;  3I1Y A;  3ONN A;  3KHH A;  4ACO A;  8ICR A;  2HBK A;  1MC8 A;  4OO1 J;  3Q8R B;  3NRZ A;  1F44 A;  4ELT A;  5KAF U;  3SAH A;  2H3Q A;  3QUQ A;  5D46 A;  3PNC A;  1MQ2 A;  1FFV A;  2M0N A;  5ALQ A;  5L1L A;  1RYS A;  4RQ1 A;  1RDF A;  3SMV A;  4YCX A;  3SAF A;  1ZQA A;  4NLC A;  2W54 A;  4US9 A;  4K4G A;  2ZUB A;  2F1I A;  1JRP A;  3F5A A;  2HOQ A;  4DQP A;  3HIL A;  1L8O A;  5AIC A;  2VIX A;  1Z00 A;  3TAP A;  2OCE A;  4PHA A;  3F53 A;  9ICA A;  4YMN A;  2DF4 B;  3TI0 A;  3GIJ A;  5JRT A;  1K1S A;  2A1J A;  2XID A;  1WG8 A;  2BCV A;  1ZD2 P;  2KIV A;  1O08 A;  3I76 A;  2OXO A;  3WK5 A;  3KFU F;  2WFA A;  4K4H A;  3CW2 C;  3ISD A;  1IV8 A;  3QX7 A;  5J0X A;  1QH9 A;  2W7O A;  4YMO A;  7ICT A;  4YN4 A;  2IOF A;  2LYH A;  5FP0 A;  5JUM A;  5L1M A;  2NYV A;  5TIS U;  1SL1 A;  3WK4 A;  4P4M A;  4C0Z A;  4EEL A;  3TQ1 A;  4DL5 A;  5DBB A;  3UQ2 A;  4P4O A;  4NL9 C;  3PW5 A;  1ZQT A;  5DKW A;  2C22 A;  4O5C A;  2HVH A;  4YMM A;  4DLG A;  4MF8 A;  8ICA A;  9ICC A;  5J0U A;  4DF4 A;  4I2G A;  4DL4 A;  3ZDA A;  4B6J A;  3NGD A;  5KFS A;  2K4E A;  1N48 A;  1JMS A;  1SV4 A;  5AKE A;  1NK0 A;  2E8P A;  4C8O A;  3AQE A;  4RQ0 A;  7ICP A;  2VA2 A;  4ECS A;  5IIJ A;  1PZN A;  1ZQ1 C;  9ICM A;  1XNS A;  2V9W A;  5L9X A;  3NTU A;  4MEX A;  3O0F A;  4DL2 A;  4O0I A;  2NO5 A;  4B9S A;  2LYA A;  2Z7J A;  4PHP A;  2WB1 C;  5ALJ A;  4I2H A;  5DQG A;  3K1R B;  3KKA A;  4XQ8 A;  9ICS A;  2J6T A;  5J2C A;  4QZ9 A;  3IDW A;  1B43 A;  4KMU A;  3L3F X;  2W9C B;  5J8Y C;  3HKZ F;  4DS5 A;  2H3V A;  1CEZ A;  3AMZ A;  3HKZ C;  4PHE A;  2LMR A;  1UHU A;  3Q8M A;  2BCS A;  2I6X A;  3TKA A;  1KN5 A;  4LJX A;  2IHN A;  3MFI A;  3CNH A;  2KMD A;  2KJ9 A;  3H0L B;  4PH5 A;  1ZOL A;  2OH2 A;  2PMZ C;  3OSN A;  2ZJ5 A;  4IRK A;  4PJ0 U;  2DGZ A;  2KOB A;  2WF9 A;  2XY7 A;  3GQC A;  1MA7 A;  2BPC A;  7ICN A;  1N60 A;  1XSP A;  1IIP A;  4ED6 A;  3T3F A;  1KRP A;  4UB1 A;  1JRO A;  4BJQ A;  7ICV A;  2R8I A;  5HR7 A;  3T5L A;  2CRX A;  4ED2 A;  1DRG A;  1A0P A;  3UMC A;  2FPK A;  3AEV A;  2K4I A;  4G9B A;  5J0W A;  5AKL A;  4M9H A;  2W9M A;  8ICZ A;  5J0P A;  3JPT A;  3RTV A;  1AQ6 A;  2LKY A;  4EEY A;  1T3Q A;  1TK8 A;  4O3R A;  3BQ2 A;  1WUD A;  2JEG A;  1VLB A;  4ECQ A;  5EE3 A;  5ALD A;  1JXE A;  2E3T A;  5ALO A;  4F92 B;  3N97 B;  3JPQ A;  1KFS A;  9ICU A;  1KLN A;  2XGP A;  2NRX A;  3OHA A;  1S0V A;  3M1Y A;  5HNK A;  4P0Q B;  5K4L A;  3QUC A;  4UW9 A;  2IA6 A;  3R9K A;  3B0X A;  1MSW D;  2B0C A;  4C7Z A;  3IV6 A;  1IM4 A;  2ES6 A;  4F8R A;  1NK7 A;  4J9M A;  4RQ6 A;  2P35 A;  2DQN B;  1B22 A;  1NK8 A;  4MF2 A;  4DL6 A;  2A1A A;  2LHT A;  5F3X B;  4QZD A;  4GXJ A;  3AUO A;  4RPY A;  2CXY A;  4KX5 A;  4UAY A;  1Z00 B;  3BQ0 A;  1NNL A;  1Q3V A;  3RRG A;  1ZET A;  3H8M A;  5H2F U;  4GC7 A;  2AQ0 A;  3V72 A;  5KFF A;  5J0S A;  2FI1 A;  4I2I A;  2YMQ A;  1YT3 A;  3WK7 A;  4KN7 A;  4NLK A;  2BDU A;  2KZ3 A;  4C7Y A;  5CWR A;  5J2B A;  4TQS A;  3G6V A;  1LV5 A;  1PK1 B;  5DB7 A;  2JEI A;  7ICL A;  5KL8 B;  4LVS A;  4FBU A;  5AKY A;  1K5O A;  2XCP A;  3I28 A;  4Y2P A;  2KNJ A;  4M6W B;  1PVP A;  1QQ5 A;  5ALT A;  3RR7 A;  2Y1I A;  1N5X A;  2K4H A;  3OSP A;  5KFK A;  3EWA A;  1C7Y A;  2N1R A;  4U7C A;  1A76 A;  2C2D A;  2QAR B;  1ZQG A;  1ZQB A;  3F5E A;  3D2Q A;  4DQI A;  1N61 A;  4RNN A;  7ICF A;  1KTQ A;  1HUO A;  4OJ5 A;  4YD2 A;  1DK3 A;  3N28 A;  4UQG A;  2HBL A;  5KFQ A;  5AM3 A;  2HOI A;  4R66 A;  2EAP A;  4FZM A;  2DUY A;  5ALI A;  5AK3 A;  4F5O A;  1RG6 A;  4EX7 A;  1MQ3 A;  4CF3 A;  1S9F A;  4BDP A;  2YN4 A;  1NOM A;  3GV7 B;  1ZQY A;  2JGA A;  2E8O A;  4B9T A;  1HIW A;  4IQV A;  5KG2 A;  4DL3 A;  4B9L A;  1IXR A;  2EZY A;  4KN4 A;  1ZQC A;  1X42 A;  4DQS A;  1QSY A;  3QEB Z;  3CP8 A;  2KIC A;  2C2E A;  4TUR A;  4F71 A;  4JWM A;  4UAU A;  1BPZ A;  5DG9 A;  5ALZ A;  3V6H A;  1ZQJ A;  2J6S A;  4BXO A;  4US8 A;  2R18 A;  3RB3 A;  8ICX A;  3LWL A;  4UBC A;  5EWF A;  1TAM A;  3PSI A;  4KLG A;  4B9U A;  3QNM A;  5G5G A;  4M9G A;  4NV0 A;  1ZD3 A;  8ICF A;  5ALM A;  4K4I A;  5KFV A;  3V7L A;  5KG5 A;  1SIJ A;  1NK9 A;  4J9R A;  2OM6 A;  3PMN A;  3EPG A;  2K8A A;  4YD1 A;  2XY6 A;  4NY8 A;  2J6U A;  3MR2 A;  3G6X A;  3ICX A;  4FO6 A;  2P6U A;  4NM2 A;  1TVA A;  3UPQ A;  3K75 D;  9ICN A;  2ASD A;  5DDY A;  4RUA A;  4EEK A;  1BVS A;  5AI9 A;  4Q45 A;  3WKE A;  3TAC B;  1V38 A;  3JPN A;  4YQW A;  3BQ1 A;  1RQL A;  5B5E U;  7ICO A;  1PVR A;  1DXS A;  1DOQ A;  1U9L A;  4I2J A;  5KFO A;  5KG4 A;  4KLD A;  2WF5 A;  1SWV A;  4GFJ A;  3PST A;  2DKZ A;  3HJE A;  1XU4 A;  2B6G A;  4JUZ A;  2PMZ F;  3IHQ B;  3HPO A;  3PX4 A;  1ZQX A;  2LBO A;  1D9D A;  4I2C A;  4I27 A;  3RAX A;  1D9F A;  3D2N A;  2AGQ A;  3PX0 A;  4CF4 A;  4F2S A;  3UXN A;  2V4Q A;  1HUZ A;  2FJ6 A;  4BXO B;  2GH1 A;  1S76 D;  4LZD A;  1NKB A;  2KKP A;  5ALH A;  1BPD A;  3PW4 A;  4Q44 A;  4DSF A;  2KHV A;  8ICI A;  3B0Y A;  5AKG A;  4J9O A;  4HYK A;  2ESE A;  1Q46 A;  4QIW F;  4BUG A;  2HVI A;  2QB1 A;  2XVT A;  3FM9 A;  2F1H A;  2KHQ A;  1FFU A;  5J2F A;  2KFN A;  4Y2Y A;  2FLL A;  2OEH A;  5AKK A;  1ZQS A;  1ZQO A;  2C2R A;  4UB5 A;  1NKC A;  3ALR A;  2F44 A;  2DPI A;  5C5J A;  4M47 A;  1L6N A;  3C28 A;  4QJF B;  3GZF A;  3BDP A;  5TZV A;  5AK6 A;  4ECT A;  5DB9 A;  4RQ8 A;  2BR0 A;  2JEF A;  4UB8 U;  2KFZ A;  5HML A;  1BPY A;  2W9A A;  2BPG A;  3BZK A;  4C8K A;  2V4R A;  1FEZ A;  1QLN A;  4QZC A;  4QZA A;  2XC9 A;  4QWE A;  7ICU A;  2ZIV A;  5ALY A;  4O5E A;  3QUB A;  5JU5 A;  4EBE A;  2ZIW A;  2HHQ A;  4Y2T A;  3UMB A;  2DL0 A;  1D8L A;  4M6W A;  3TAQ A;  3HX0 A;  4RUC A;  4M9J A;  4Z6C A;  3H0M B;  5ALR A;  2H3Z A;  4RNO A;  3WKD A;  3MAB A;  1X2I A;  5KFY A;  2R8J A;  3BQ7 A;  1JI7 A;  3C21 A;  4Y2X A;  2WAQ C;  4QW8 A;  5KFZ A;  2WAQ F;  5AK4 A;  5DQI A;  4OD0 A;  1COO A;  1ZQL A;  5AI0 A;  1UT8 A;  4USA A;  2W04 A;  3WK6 A;  1COK A;  4AYB F;  2ISP A;  2F77 X;  2ZIX A;  2GO7 A;  1VJ5 A;  2KG5 A;  3QU5 A;  3TAN A;  5BOL A;  4I2E A;  1JXL A;  4GC6 A;  1JAL A;  3EW9 A;  1L7N A;  3GIL A;  3AM9 A;  2YML A;  5KFP A;  3ZDB A;  1DK2 A;  5ALS A;  1WYG A;  4RQ2 A;  3PW0 A;  1KEJ A;  2W03 A;  1BNO A;  4QZB A;  4Y2U A;  1S5L U;  3HWT A;  4BGD A;  5AKH A;  5HP4 A;  2W11 A;  5IIL A;  1Z1V A;  4FE3 A;  4IS7 A;  3PO5 A;  4NLG A;  2YY6 A;  5ALF A;  2PFQ A;  2HHS A;  4CE6 A;  1ARO P;  2ZTC A;  4ECW A;  1NJW A;  7ICM A;  4IC9 A;  4JWN A;  3NUQ A;  1KSP A;  4DFP A;  3H7I A;  1SKS A;  2HBM A;  1KW4 A;  4J03 A;  4UAR A;  8ICV A;  5DQH A;  2GLE A;  3WK9 A;  8ICE A;  2UVW A;  3MDA A;  4KLE A;  4F2R A;  3TFR A;  5ALN A;  2MA1 A;  2AU0 A;  2W3S A;  4BX9 C;  3JPO A;  5ALX A;  3QXG A;  4IQU A;  3ZDE A;  2XCA A;  2E1E A;  1TV9 A;  4Y2R A;  2FPM A;  5KT5 A;  3OJU A;  1XSN A;  1ZQP A;  2E1F A;  2G07 A;  4UBB A;  3RB4 A;  1T94 A;  1N63 A;  2HBJ A;  9ICE A;  2LM1 A;  2HHT A;  1TFR A;  3E2E A;  1C20 A;  3THV A;  3PY8 A;  5JTI A;  3M8S A;  2K4P A;  1X66 A;  3C2K A;  5J0T A;  3M9N B;  5J2K A;  4X5V A;  4RU9 A;  3K1Z A;  4BWJ A;  2RDJ A;  4NLB A;  1LB2 B;  2F8K A;  3RJF A;  3RB6 A;  3KZX A;  4Y2V A;  2IHM A;  1RXW A;  5J2J A;  1TK0 A;  3MGH A;  9ICI A;  4B9N A;  5DG8 A;  4DSK A;  1DGJ A;  4RZR A;  2LPE A;  4Z6D A;  2E8N A;  3RBE A;  2VA8 A;  4ED3 A;  2BCQ A;  1SL2 A;  4ED8 A;  5ALP A;  3UXP A;  2XY5 A;  8ICS A;  8ICJ A;  5KFX A;  3SAG A;  2H3F A;  5ALW A;  2IOF K;  2JZB A;  1ZQF A;  4F5Q A;  4KLL A;  4I28 A;  1Q3U A;  2Q4T A;  3MBY A;  1F5S A;  8ICM A;  3DEE A;  2LM4 A;  4F72 A;  3L4P A;  3PVX A;  4P0P A;  4J9K A;  4IRC A;  4KLO A;  4EZ6 A;  3LWM A;  1NI3 A;  1ZQW A;  4KLI A;  1BNP A;  3TFS A;  1KDH A;  3V7K A;  2JV3 A;  4KLJ A;  4F5P A;  4Q8F A;  1L7P A;  3S6J A;  3FAH A;  2KJ8 A;  3VC8 A;  4UB3 A;  5D4B A;  3NS1 A;  3LVV A;  2KN7 A;  4B9V A;  4C80 A;  3JPP A;  3C23 A;  4KLM A;  2HHX A;  3QU7 A;  2NRZ A;  7ICG A;  1XO0 A;  2XIC A;  3IG8 A;  4O3S A;  3G6Y A;  3F2D A;  2PFP A;  4KLT A;  3M9M B;  3ED5 A;  5AM2 A;  2I9G A;  9ICX A;  5CHG A;  5KFD A;  3H8S A;  8ICL A;  2QKQ A;  4YFK A;  8ICW A;  1ZQR A;  1RPL A;  3OPX A;  2PI5 A;  5AHX A;  2H3I A;  2OHF A;  2YMP A;  3QUT A;  1S10 A;  8ICK A;  4PZN A;  2JH7 A;  4YG2 A;  1UCV A;  4QW9 A;  4KX3 A;  5KG3 A;  1QQ6 A;  4F91 B;  2ATL A;  4QWA A;  1CRX A;  5IIK A;  5ALK A;  4M2Y A;  4ED7 A;  2GOL A;  3QYP A;  7ICE A;  4IRD A;  5AKX A;  2WF7 A;  2BQR A;  9ICW A;  4UB6 U;  3HP6 A;  4UAT A;  1V85 A;  1L3U A;  4PPX A;  4MEY A;  4OCZ A;  5ALL A;  1O03 A;  2W8L A;  5KFA A;  1Q8K A;  3GII A;  3E58 A;  4XRH A;  2W8K A;  2ALZ A;  3BJY A;  3Q8S B;  4YR0 A;  2DPJ A;  1RXV A;  4DOB A;  3LVW A;  4I2A A;  9ICG A;  1J2N A;  4DFJ A;  1H38 A;  2IBK A;  2KEY A;  4C4R A;  8ICO A;  1KKX A;  2K89 A;  2G08 A;  5L1I A;  3Q8Q B;  4RQ5 A;  2PI4 A;  3FYH A;  4R8U A;  3E0F A;  3M8R A;  2JH1 A;  4EEN A;  4ECY A;  5F9L A;  4DSL A;  2F3N A;  5AI4 A;  5CA7 A;  1UQV A;  3CYM A;  4I2B A;  4QWD A;  3Q8L A;  4GLX A;  2AJQ A;  5J2I A;  4P2H A;  1WWV A;  2FMS A;  4CDG A;  4EYI B;  3N7R C;  5EOZ A;  5DDM A;  4DSJ A;  1CI4 A;  2C28 A;  4F5N A;  5EE0 A;  1ECW A;  2KJ5 A;  3KOO A;  4JV2 A;  5CJ7 A;  1X6J A;  2AHO B;  1NK5 A;  5DB8 A;  3NVV A;  3ORY A;  3J81 j;  5KFB A;  3QE9 Y;  3PW2 A;  1XO1 A;  4UAS A;  2Y1J A;  1RZT A;  1NJX A;  2BPF A;  4TUS A;  5KFW A;  3PML A;  4IQW A;  4I2F A;  4ECR A;  1QQ7 A;  4KIT B;  3D6J A;  3KZI U;  4YVZ A;  1SXD A;  4O5K A;  4DOC A;  4AYB C;  5J2G A;  4F50 A;  8ICP A;  2QLT A;  1KL9 A;  4XUS A;  2XO7 A;  2YX8 A;  4NJ8 A;  4QWB A;  4YXJ A;  4J9P A;  2ZTE A;  3BZC A;  2W7P A;  1SL0 A;  3WK8 A;  1Y88 A;  5ALU A;  2ASJ A;  3C5F A;  5EWE A;  2FLP A;  4GXK A;  2LYB A;  4YR3 A;  1X6I A;  4Z6E A;  7ICK A;  1SZP A;  1WCN A;  1RYU A;  1B4F A;  4KMO B;  2FLN A;  4ECU A;  3FC4 A;  3RR8 A;  1NK6 A;  2D3D A;  1ZQZ A;  5L1K A;  2FMP A;  3MGI A;  3PSP A;  4F5R A;  4RNM A;  2G06 A;  1KFD A;  3RJG A;  4KTQ A;  4G3I A;  7ICI A;  5HR6 A;  2BQU A;  5AK5 A;  5KFN A;  1ED1 A;  1DGS A;  2RLT A;  4KLF A;  1X9W A;  1MN8 A;  5AIB A;  4Q8E A;  2FE9 A;  3ZD8 A;  5AI6 A;  3AQF A;  4R64 A;  4PZO A;  4O3Q A;  4MFC A;  3RB0 A;  5KG7 A;  3WU2 U;  5KFE A;  5DB6 A;  3IM1 A;  3Q8P B;  4OJP A;  3SV3 A;  7ICH A;  1L8L A;  2F76 X;  3MC1 A;  3H4B A;  4QZF A;  4DSI A;  3TAD A;  1BPE A;  5KFH A;  5DGB A;  5J0R A;  4DL7 A;  2NRV A;  4YXM A;  1CUK A;  2OYY A;  1NJZ A;  5E79 U;  1JIH A;  2KIW A;  9ICK A;  4RPZ A;  2P66 A;  2G09 A;  1TK5 A;  1UPH A;  3DDH A;  2EZZ A;  4F3O A;  4CF5 A;  4U6P A;  5KTQ A;  5CR0 A;  1FO4 A;  3C1Z A;  4MFA A;  4EBC A;  2AXT U;  5C0Y A;  4PGX A;  2HCF A;  1ZQH A;  4RT3 A;  4M0A A;  1HJP A;  1N56 A;  2QB0 B;  3MR3 A;  1U48 A;  1GO3 F;  2WF6 A;  3U26 A;  2I1Q A;  2ZIU B;  3QU4 A;  5AKJ A;  3GFK B;  7ICR A;  3SEN A;  1U45 A;  2JHD A;  3RJE A;  3BQT A;  4F4Z A;  4IQT A;  1LKY B;  4JK1 A;  1PUZ A;  1RM6 C;  2HHW A;  3A0H U;  3H4D A;  2EH9 A;  2IOH A;  4Z6F A;  1ZXI A;  2JZB B;  2GWS A;  2I5H A;  9ICB A;  2BCU A;  4UAW A;  3SZ2 A;  1SKW A;  4ICA A;  1J97 A;  4R8U B;  3C5G A;  1ZQU A;  4IR9 A;  3SYZ A;  2ZUC A;  4DO9 A;  3M6Z A;  4NL9 A;  4M04 A;  1V9P A;  3EYZ A;  4OJ6 A;  2CN1 A;  2HDO A;  2K8C B;  2WTF A;  1T7P A;  5BOM A;  5D49 A;  2W9B A;  1ZD5 A;  4UAZ A;  2EDU A;  1L3S A;  4QZI A;  5DLG A;  2UVU A;  3RRH A;  4PGQ A;  5IIN A;  3HT3 A;  2BHN A;  2Q0Z X;  5AIA A;  1PK3 A;  4FS2 A;  4PHD A;  2LI6 A;  3WKB A;  1NZB A;  4FS1 A;  4P4P A;  2YMM A;  4J9L A;  4ED0 A;  3TAR A;  2KZZ A;  5G5H A;  3SI8 A;  2KSO B;  4RQN A;  4DLE A;  5J29 A;  9ICO A;  7ICS A;  1OXJ A;  3ZI4 A;  4Y2S A;  5KFC A;  2JR5 A;  1S77 D;  4QIW C;  4P0P B;  3SEI A;  3OGU A;  1S0N A;  1Z4N A;  2DWQ A;  9ICR A;  5KFL A;  4ELV A;  1NKE A;  3IN5 A;  5AKZ A;  1QTM A;  3KHG A;  1EXN A;  2W3R A;  4JMU A;  5J2E A;  3LDA A;  3QZ8 A;  3FDS A;  4KLQ A;  1N62 A;  2R8H A;  4B9M A;  5KG0 A;  4UAV A;  1X9S A;  2PKE A;  3PW7 A;  9ICL A;  4NLN A;  2RQ5 A;  2KV2 A;  5AKI A;  2ZTD A;  5CP2 A;  4BWM A;  2NO4 A;  3GIK A;  8ICB A;  1L3T A;  4JV1 A;  2BKE A;  4Y2Q A;  2AGO A;  3B9J A;  1ZQK A;  4RQ3 A;  1S8O A;  3UM9 A;  1P7D A;  1KQQ A;  1ZJN A;  3QU2 A;  4ZOH C;  3ETL A;  5KFT A;  8ICQ A;  3N7S C;  2EAO A;  3SR6 A;  8ICN A;  4EBD A;  2CPR A;  2D8C A;  8ICG A;  4TUP A;  1TKD A;  3GDX A;  4KLS A;  4PGY A;  5KAI U;  2K8B B;  4WJ3 B;  2P6R A;  2EZX A;  3A0B U;  2KZM A;  4CRX A;  2FPL A;  1Z3E B;  3KBB A;  3AN1 A;  2KE7 A;  2BGW A;  4RQM A;  1OW5 A;  3N4M B;  3OJS A;  5CEH A;  4DFD A;  4KLU A;  1YZ7 A;  2KK0 A;  3C1Y A;  1QSS A;  9ICP A;  5J0Q A;  1S0O A;  2KVC A;  1SWW A;  2HMX A;  8ICU A;  4UB4 A;  5AM4 A;  4LZG A;  2XI9 A;  3BS5 A;  1TAU A;  3HRD D;  5GTI U;  2ZJ8 A;  2W55 A;  1K1Q A;  2YTU A;  2ISO A;  4XA5 A;  4MFF A;  4C4S A;  2XGQ A;  2ZIV B;  2A19 A;  5III A;  1WCL A;  2RDI A;  1RQN A;  4QWC A;  3ISB A;  3NVY A;  1KFT A;  1VDV A;  5KFI A;  3H8W A;  5EE1 A;  2YB1 A;  5J8Y A;  3F2C A;  3HW8 A;  3PO4 A;  5KT3 A;  2D6F C;  1WWU A;  3V7J A;  1ZQV A;  5IIO A;  4CCH A;  2RHF A;  3M9O B;  2KTQ A;  2YQE A;  5DG7 A;  1L7M A;  2R8G A;  4F93 B;  2MAX A;  5A0L A;  1S97 A;  5AI8 A;  4J9N A;  3H0R B;  2FMQ A;  5KG6 A;  4YR2 A;  2HHU A;  1TAQ A;  5KG1 A;  4JV0 A;  1SKR A;  4ECZ A;  3M6K A;  3K4G A;  9ICF A;  3NVW A;  3V6K A;  1L3V A;  1T3N A;  2DBY A;  4O9M A;  1PK1 A;  2HI0 A;  1D8B A;  4J9S A;  3V6J A;  2MU2 A;  3MR5 A;  4M9L A;  1XSL A;  1U49 A;  5AI5 A;  5GTH U;  3QZ7 A;  2E8M A;  4A8E A;  9ICQ A;  2Y0S C;  4QZE A;  3NRW A;  1T4G A;  2HHV A;  3LK9 A;  2ZIW B;  5F9N A;  3RFA A;  4I29 A;  1L7O A;  5J2H A;  3LYS A;  3GIM A;  3C29 A;  3OTQ A;  3ZD9 A;  4YP3 A;  2KKV A;  1ZQQ A;  1SZH A;  4GIB A;  2RP5 A;  2ZIX B;  4CGZ A;  5KFR A;  5KL1 B;  3VCB A;  5J2D A;  2G0A A;  2K60 A;  5KNI A;  2NV3 A;  5HHH A;  2ZUD A;  1Z4O A;  2VKQ A;  4FZL A;  5AM1 A;  4C8M A;  1U47 A;  4F4W A;  1X9M A;  8ICY A;  1UA0 A;  9ICH A;  7ICJ A;  5CRX A;  3SV4 A;  2JEJ A;  5KFJ A;  1SV0 A;  1X40 A;  3WKC A;  4ZH4 A;  2UVV A;  3UMG A;  2MUT A;  2HOF A;  2F1J A;  3EUB 2;  1L5U A;  2Y9U A;  4R65 A;  4AP9 A;  3PX6 A;  3RF9 A;  3C2L A;  1HEK A;  3NVZ A;  2ZJA A;  4OJO A;  4RPX A;  3RJI A;  4FFD A; 
#chains in the Genus database with same CATH homology
 2KJ8 A;  3M6Z A;  3VC8 A;  2PMZ F;  2DGZ A;  2KOB A;  2RRD A;  2W7O A;  2RHF A;  2ZXI A;  4BX9 C;  3CYM A;  2ZXH A;  3LVV A;  1F44 A;  2ZIU A;  3AQF A;  1MA7 A;  1KBU A;  2LBO A;  3SAH A;  2LHT A;  4OJ6 A;  3H0M B;  3D2N A;  4CDG A;  3N7R C;  2E1E A;  2H3Z A;  2YB4 A;  2CN1 A;  2K8C B;  2E1F A;  1XO0 A;  2MRL A;  1ECW A;  2G07 A;  2KJ5 A;  2XIC A;  3IG8 A;  4KX5 A;  1P7D A;  1IIP A;  4PL2 A;  4OJP A;  3F2D A;  4C0Z A;  2GH1 A;  2F76 X;  5A0L A;  3GU3 A;  1T94 A;  2E5S A;  2HBJ A;  2WAQ C;  4BJQ A;  1Q3V A;  2KKP A;  3PZP A;  2WAQ F;  3C28 A;  1Z1B A;  2G5I B;  3H0R B;  3SQI A;  5HR7 A;  3N7S C;  3CP8 A;  2KIC A;  2CRX A;  2KHV A;  2OYY A;  1YT3 A;  2W04 A;  3M6K A;  1DRG A;  2F8L A;  2CPR A;  2VJ4 A;  3OPX A;  2BDU A;  4NWI A;  2H3I A;  1A0P A;  2KIW A;  4AYB F;  1NZB A;  4WJ3 B;  2K8B B;  2F77 X;  4QIW F;  4BUG A;  2R18 A;  2ZIX A;  4AYB C;  2XVT A;  1PVQ A;  2K4I A;  5KL8 B;  2JH7 A;  3K1Z A;  2KHQ A;  4CRX A;  3AL0 B;  2G09 A;  1D8B A;  1TAM A;  3PSI A;  4KX3 A;  3IG5 A;  4NLB A;  1UPH A;  3F2B A;  2KNJ A;  4A8E A;  1CRX A;  3KZX A;  4NV0 A;  1PVP A;  2Y0S C;  2F2A B;  2GOL A;  2LKY A;  2YX8 A;  4U6P A;  3NRW A;  2A3V A;  2Y0S F;  2K4E A;  2ZIW B;  3AQE A;  3RFA A;  1Z19 A;  3CRX A;  1WUD A;  3IP4 B;  3LYS A;  2W7P A;  2K4H A;  5C0Y A;  3D2S A;  3C29 A;  2W03 A;  3ALR A;  3ONN A;  4PL1 A;  1ZQ1 C;  4QIW C;  2KD1 A;  2KKV A;  1XNS A;  3T79 A;  4P0P B;  4ACO A;  4OJL A;  1SZH A;  2HBK A;  4OO1 J;  2OM6 A;  2RP5 A;  2ZIX B;  2KVC A;  4CGZ A;  3O0F A;  4FZN A;  2HMX A;  2K8A A;  2LYB A;  2H3Q A;  2N1R A;  3N7P D;  5KL1 B;  4QJF B;  3GZF A;  2LYA A;  3VCB A;  4U7C A;  2WB1 F;  2M0N A;  4FE3 A;  2Z7J A;  2G0A A;  1GO3 F;  2NV3 A;  2WB1 C;  3PSF A;  3IN5 A;  2XI9 A;  3F5E A;  2ZIU B;  3D2Q A;  3M7D A;  2VKQ A;  4FZL A;  3ICX A;  3SMV A;  3SAF A;  4OJ5 A;  4NLC A;  1L6N A;  1OUQ A;  4QNL A;  4KMO B;  2JMG A;  2G5H B;  4JMU A;  3F5A A;  2HOQ A;  2HBL A;  2H3F A;  3SAG A;  3LVW A;  2HOI A;  2ZIV B;  5CRX A;  2VIX A;  2JHD A;  4FZM A;  4IC9 A;  4P0Q B;  1Q3U A;  3NUQ A;  2VJ5 A;  3F53 A;  3PSP A;  3L3F X;  2DF4 B;  2Q4T A;  3HKZ F;  2G06 A;  3MGV A;  2H3V A;  2HBM A;  2KEY A;  3HKZ C;  1URJ A;  2XID A;  2HOF A;  3DEE A;  5HR6 A;  2K89 A;  3RF9 A;  4P0Q A;  4P0P A;  2KV2 A;  1PVR A;  2ZG6 A;  2G08 A;  1HEK A;  2ZIV A;  2OXO A;  1A6S A;  2YB1 A;  3KFU F;  1ED1 A;  3F2C A;  4ICA A;  5T14 A;  3E0F A;  4GFJ A;  4O3M A;  2JH1 A;  2JGA A;  2DQN B;  2ZIW A;  2KJ9 A;  3H0L B;  3PST A;  4OJO A;  2D6F C;  2OH2 A;  2PMZ C;  2MA1 A;  1HIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...