2KJ5A

Solution nmr structure of a domain from a putative phage integrase protein nmul_a0064 from nitrosospira multiformis, northeast structural genomics consortium target nmr46c
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
116
structure length
116
Chain Sequence
MAEKNAYTVAQLADEYFERMIAGRWKHPNIVRSRIEKDIKPAIGSLKVEDVKPRHIDDVLKAVMKRGAPSIANDTLRWLKRMFNYAIKRHIIEYNPAAAFDPGDAGGKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phage integrase
publication title Solution NMR structure of a domain from a putative phage integrase protein Nmul_A0064 from Nitrosospira multiformis, Northeast Structural Genomics Consortium Target NmR46C.
rcsb
source organism Nitrosospira multiformis atcc 25196
molecule tags Structural genomics, unknown function
total genus 36
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kj5A00
1DRGA 4A8EA 1Z19A 2KD1A 1Q3UA 1OUQA 3CRXA 3MGVA 3LYSA 5CRXA 1NZBA 1P7DA 2HOIA 1F44A 2KIWA 3NRWA 2KEYA 1XO0A 2KJ8A 2HOFA 2KHVA 2OXOA 1PVQA 1CRXA 1A0PA 3C28A 2CRXA 2KKVA 1Z1BA 1PVPA 2KJ9A 4ACOA 2KOBA 1PVRA 1MA7A 2KJ5A 1KBUA 1XNSA 2A3VA 3C29A 1Q3VA 4CRXA 2KKPA 2KHQA
chains in the Genus database with same CATH superfamily
2BCQA 4O3NA 4RT3A 3PX4A 4M0AA 3GIJA 3AN1A 4ELUA 8ICLA 1ZQSA 1XWLA 1UA1A 1FFUA 2K8BB 3WK9A 3RBEA 1NJWA 4Y2RA 1RQLA 5KFOA 1PVQA 4TQRA 5KT3A 5DQHA 2VJ4A 3TACB 1DK2A 4C4TA 3OPXA 2HBLA 3WKBA 3SV3A 2R8IA 1URJA 3FAHA 4R8UA 2JH7A 9ICNA 4KLLA 5ALRA 1ZQMA 4NLCA 2OYYA 1MC8A 5KAFU 3UXOA 2RHFA 4YP3A 5J2IA 4C8NA 2NO4A 1NJYA 1BPYA 1QSLA 5KFUA 4B9MA 3KKAA 2NRZA 3PR5B 1VLBA 1QTMA 4QZEA 4B9SA 2CRXA 3HKZF 1SWVA 4BJQA 2NRTA 4F8RA 5DLFA 3SR6A 5KG2A 4GC7A 4US9A 3CP8A 1JMSA 2IHMA 1X9SA 3TQ1A 3GIIA 2BQRA 2EZZA 8ICFA 2YN4A 1ZQNA 2MU2A 2UVUA 2IHNA 4NLNA 2C2EA 4GXIA 2P66A 9ICVA 2XIDA 4I2CA 4M6WB 4KLQA 2W9AA 2JEGA 8ICUA 4LZGA 4IRKA 1L6NA 3QX7A 4NWIA 1SKSA 8ICQA 4O3MA 3K75D 1V97A 3SYZA 4UBCA 3ZDBA 2AJQA 5DB9A 5AKGA 4FFDA 2RDJA 3RTVA 4M9NA 5ALSA 3KFUF 4QZ8A 5J0OA 1S5LU 1ZQOA 1HJPA 5DG8A 5ALQA 2CXYA 3TKAA 3C2MA 4DSFA 3V6HA 3UMBA 2HVIA 1U47A 2C2DA 2ZXIA 4IR1A 2VJ5A 2MRLA 2DKXA 4ACOA 4RQ8A 2WAQC 4QW8A 2W3RA 5ALTA 2JEIA 5AKYA 2WFAA 2G09A 4Q44A 4ED7A 5ALUA 2ZJ5A 5KFQA 7ICGA 4RPZA 3IP4B 2BKEA 4KLOA 4BXOB 5HMMA 3RFAA 5F3XB 7ICHA 1BVSA 2DWQA 2NRWA 1L7OA 2G07A 4OJPA 2HMXA 5H2FU 3Q8RB 2KKVA 2R8HA 2F1IA 3BQTA 4RPYA 2DPJA 3N7SC 2OM6A 4TUSA 4DOAA 4MFCA 3NVYA 3B0YA 4RUCA 2JZBB 1HUOA 1KW4A 5CRXA 3N28A 3H7IA 2KEYA 9ICAA 4PHEA 2FLPA 2BCSA 3UQ0A 4J9RA 1KFSA 4M2YA 1JROA 2W55A 1SXEA 3SV4A 3C29A 2KV2A 4GC6A 1NK8A 1Y88A 3QNMA 2FMQA 5G5HA 7ICKA 2E8OA 3WK8A 3QYPA 5HR6A 4KLHA 2BCVA 4KLMA 4DOBA 2VANA 1N5WA 4XA5A 4F4KA 5KG6A 5ALYA 5A0LA 1Q3VA 1L8OA 4DQIA 3Q8QB 2PFNA 1WCLA 2Y9UA 5J2DA 1N60A 3JPPA 4RQ6A 5J2KA 4KITB 3JPTA 3RB4A 1SIJA 3D2NA 5CR0A 2KJ8A 2E3TA 3NVZA 2BHNA 5ALGA 3C28A 1KRPA 4I2IA 2HHUA 1NK7A 1KFTA 2KE7A 2KZMA 4KX3A 2Y9TA 1JXLA 5ALVA 4KLDA 9ICPA 1N62A 4YN4A 3RH6A 4JV1A 3LVWA 4C0ZA 5AKIA 4O3SA 2KIWA 5J0WA 4UAYA 5KFTA 1L7PA 3KZIU 1L5UA 1O08A 2HDOA 4DS5A 2JGAA 5J0XA 5AM1A 3TARA 2EAPA 4NXZA 1ZQFA 5DQIA 5DB7A 1QH9A 2W3SA 2CPRA 2G5HB 4Y2YA 2XY5A 2BDUA 5AICA 2XO7A 1NK4A 1B43A 1EXNA 4UBBA 2ISPA 2XVTA 2CN1A 1TAUA 5AM3A 1BPEA 4WJ3B 3Q8MA 4RT2A 8ICYA 1QLNA 4GXKA 3UXPA 4F91B 5J0PA 1XSLA 1TV9A 1ZQWA 3ETLA 1JXEA 2C22A 3JPOA 3QU2A 3AQEA 2YMPA 3WKDA 9ICFA 5DDMA 5DDYA 3H8JA 1SV4A 2E5SA 1X6JA 2GWSA 4ED2A 2W9MA 4B9LA 4EEKA 2WF8A 3NVVA 1B0XA 3C5FA 3T5JA 1WWVA 1DXSA 3HP6A 5KG0A 3N4MB 5KFMA 3H40A 2YQEA 2HHWA 1BNOA 1X9WA 5AM2A 2EAOA 2HOIA 4O9MA 4ICAA 1JIHA 2GOLA 4R64A 2FMPA 1C20A 4E0DA 1Z00A 1SZPA 5J2HA 4C7ZA 5AI5A 3OTQA 1BGXT 2AQ4A 3HW8A 2VIXA 5KFNA 2XY6A 1XS9D 4R8UB 1ZQCA 4P4OA 1JUDA 1QQ6A 3GV8B 5ALJA 4BWJA 3EPIA 2PFPA 1UHUA 2K8CB 1L3SA 1U49A 4M9GA 4C4RA 5JU5A 1ZQGA 5DB6A 4F4YA 4ECTA 1MA7A 4RQMA 4EEYA 4NLZA 3QUBA 7ICOA 2KP7A 2XI9A 5FP0A 2F76X 1FFVA 2LM1A 2W54A 2WF7A 1PK1B 1TKDA 2H3IA 1NK0A 3H8MA 5KL1B 2HSZA 4NLBA 2PFQA 4G9BA 1C7YA 5KFCA 4J03A 4MFAA 2A19A 1ZQXA 1WG8A 4FZNA 4R65A 7ICNA 2P35A 2F2AB 4DFPA 2G06A 8ICKA 4KN4A 2LHTA 4PH5A 2WHEA 2ZIWA 9ICEA 4I2AA 3GDXA 8ICTA 3WKEA 2P6UA 4U6PA 5F9LA 1F5SA 8ICMA 4M04A 2YB4A 2WB1C 3RH5A 1ZQKA 3PW5A 1JN3A 2EANA 1A6SA 4F5OA 2NV3A 1K5OA 3T5KA 1XO0A 4DS4A 1L7NA 5KFYA 5DBAA 4EBEA 1PVPA 5L1MA 4IC9A 7ICLA 1RYSA 1V9PA 3D2QA 5DBBA 1SZHA 4MF8A 3K1RB 8ICZA 4F72A 4RUAA 1LV5A 1L3VA 5EE9A 1H38A 4KMUA 5J0QA 2OHFA 2ZIUA 2HBKA 1T4GA 1MSWD 3PW0A 4DFKA 3EWAA 1UT8A 4BDPA 4KLGA 3RR7A 2HHXA 1RXWA 2K60A 4O5KA 5CP2A 4KLSA 3SMVA 5AK4A 3ISCA 2ODGA 2LYAA 4FZMA 1D9FA 3PMNA 1QSSA 2IMWP 4DFMA 3B9JA 5AKZA 2ATLA 1IM4A 4DL7A 5KFRA 2JMGA 2XY7A 3KHGA 4DSKA 9ICXA 4YXJA 5KFPA 3THVA 2A3VA 3H4BA 3I76A 5KG7A 9ICKA 4J9PA 1YT3A 2LYHA 2W43A 1NZBA 3F5AA 4J9NA 1VDVA 4F71A 2KICA 1RXVA 5KNIA 5AIAA 3C1ZA 7ICVA 2MAXA 2LBOA 3RB6A 5J2FA 2LMRA 4F92B 4JMUA 2V4RA 3TAPA 1ZETA 4EX6A 2WF9A 4QWCA 1NKCA 3V6JA 4QW9A 3MFIA 2XCAA 4I2BA 4Z6DA 2RDIA 2YB1A 1Q8KA 4HYKA 4B9TA 4F5QA 1UCVA 4ELTA 3NGDA 3KHLA 3MGHA 4Y2UA 3PMLA 4KX5A 1Z3EB 3G6VA 4ED0A 1NK5A 2W9CB 2E1FA 5TISU 4KLIA 2WF5A 3RJHA 1V38A 4RNMA 9ICJA 5E79U 2DKZA 3TAQA 3TANA 5TZVA 3IN5A 3Q8LA 1RM6C 3C5GA 1S97A 4F93B 3BZCA 2JH1A 5DLGA 2BCUA 4DWIA 4YCXA 3GQCA 3BQ0A 1TAMA 1NNLA 2KOBA 2N1RA 4IQUA 4B9UA 4YMMA 3IRUA 4RU9A 4Z6FA 4QZFA 3S6JA 4A8EA 1VJ5A 3HWTA 3M8SA 4O3QA 3RB3A 1ZQEA 3H0MB 3RRGA 3UM9A 2C28A 1KDHA 1ZD5A 4QNLA 8ICGA 4QWDA 4RNOA 1T7PA 4GLXA 5J2GA 2BQ3A 3GIKA 1KQQA 5HR7A 2BQUA 1QCKA 5KFHA 2KN7A 3OJUA 4C8LA 4K4IA 1X66A 4CE6A 5AI8A 4UASA 3BDPA 1QQ7A 4I29A 4MEYA 4DLEA 4QZDA 5ALEA 3MGIA 1JX4A 5ALNA 4KLTA 4EENA 3PSIA 1ZD4A 4KLFA 3EUB2 4J9MA 4I2DA 5AKEA 5ALHA 5ALXA 3SAGA 4IQTA 2KJ5A 1KBUA 4DSEA 4DO9A 2D3DA 1Z00B 3TADC 1T3NA 1D8BA 2HCFA 2ZJAA 1NOMA 9ICWA 4I2JA 4FBTA 3ICXA 3I1YA 5IIJA 5J2AA 5KT7A 8ICWA 3SQIA 5J8YC 2EZYA 3ZDEA 5AI4A 3GU3A 1PVRA 3H4DA 4TUPA 2G5IB 4JK1A 3KTQA 1SV0A 4ECZA 2M9NA 2NRVA 4Q8FA 1TVAA 3QEBZ 2A1JA 1ZQQA 3ISDA 3FC4A 1FIQA 2ZTEA 4RQ7A 2FI1A 2K4IA 3PO4A 2W03A 3OHAA 3WKAA 3AM9A 3PX0A 2YTUA 4DLGA 5KTQA 5HHHA 8ICXA 1ZQPA 2R8KA 1S8OA 5J0RA 3RJFA 3D6JA 2KFNA 5BOMA 2BPCA 4PPXA 1ZXIA 2AGPA 5AKHA 5IIOA 3SAHA 2MA1A 2FE9A 2ZIWB 1LKYA 1HUZA 3V6KA 1SL1A 1ZQBA 8ICCA 5DKWA 4C80A 8ICNA 1L3UA 2JEFA 1AROP 4B6JA 4QIWF 4IS7A 5L1IA 5ALWA 5KFWA 2IA6A 3FDSA 3LDAA 2YX8A 2ZIXA 2Q4TA 2HVHA 2IOFK 5ALDA 4F4WA 3N7RC 5IIIA 3Q8KA 3NRZA 3RR8A 3PW4A 4IR9A 1RG6A 1A77A 5AI6A 5L1LA 2W9BA 3PY8A 2G08A 2F3NA 4DF4A 1J2MA 1SXDA 8ICRA 2ZIUB 5J2CA 3PSTA 3TFSA 2BCRA 1SL0A 3PR4A 1ZQ1C 4F4ZA 3HPOA 2DF4B 4Q8EA 1BPBA 4EBCA 8ICAA 2DFLA 2BDPA 3GV7B 4NV0A 1U45A 4XQ8A 4RNNA 3AU2A 2MUTA 4P0QA 3KKAC 5IIMA 3A0BU 3E0FA 1Z19A 3KBBA 3CRXA 4ECRA 4JWNA 4OJLA 4IRCA 4EBDA 5J0UA 3CYMA 1ZQYA 4M9LA 5DG9A 3M1YA 2KIVA 1RDFA 2VA8A 3CNHA 4DCCA 3PSPA 3PW7A 3WK7A 4O3RA 1T8EA 2AGQA 4FO6A 5KFZA 5KT2A 4JWMA 2FPLA 4K4GA 2F1HA 3D2SA 1O03A 7ICJA 2PKEA 3HKZC 5EE3A 1WYGA 5IILA 4C8OA 2XCPA 2ZJ8A 2ISOA 4EYIB 1SWWA 2F8KA 1J2NA 4C8KA 1N48A 3C2KA 4ELVA 4M9JA 3AQFA 2QB0A 7ICMA 2HHVA 3O0FA 2ES6A 4YFKA 3BQ2A 4J9OA 2KD1A 3MFHA 4MFFA 4DEZA 2LYBA 4X5VA 3KHRA 4ED8A 3DV9A 2FPMA 4XRHA 4Y2SA 1PK3A 4AYBF 4Y2PA 5JUMA 1T3QA 4UATA 3JPQA 1BPDA 4M6WA 4UAWA 3BS5A 3QU7A 4RQ2A 2OH2A 3MR6A 2XGQA 4DSJA 4NL9A 1ECWA 1SV0C 5CEHA 1Z1VA 4J9QA 4Z6EA 5DQGA 9ICLA 8ICSA 1D8YA 3LVVA 2JR5A 3U26A 3M8RA 4US8A 1S76D 3AU6A 1XC9A 2DUYA 4GFJA 2EAMA 3OHBA 3RH4A 3QZ8A 1U4BA 4PL2A 4C7YA 2EQYA 4OD0A 3J81j 5C5JA 2NO5A 1JRPA 1TFRA 5J2BA 4RQ5A 1LVHA 2QB1A 2J6SA 4BUGA 5EWEA 4DL3A 4DSLA 4QWBA 1UPHA 5AI9A 5AKXA 3MR2A 1KSPA 9ICGA 1ZJMA 2UVRA 5J0SA 1MN8A 4UB5A 4DFJA 1F0MA 9ICIA 9ICHA 2W11A 5ALKA 2K8AA 4OO1J 3UMCA 3UMGA 3PZPA 4LVSA 1PZNA 2R18A 5EWGA 1S0NA 3H8WA 2K4EA 1LB2B 1BNPA 1SGGA 2JZBA 4I2HA 3I28A 4B9NA 5ALLA 2R8GA 1DK3A 4NLGA 3GFKB 3E2EA 1P7DA 5ALOA 2HI0A 5KG4A 4ECWA 4QIWC 1Q46A 2FLLA 3ETRA 3ZDCA 1S0OA 1ZQAA 2PMZF 2E8NA 3RJJA 3ZD8A 5T14A 1Z4NA 3BJYA 2B21A 1JALA 2ZIVA 1NKBA 2UVWA 2WAQF 4ZH4A 3GV5B 2RRDA 3C23A 2A1JB 3AEVA 3IG8A 3SENA 1ZD2P 2YY6A 5K4LA 1KEJA 5CA7A 2DBYA 1OXJA 2DQNB 3L5KA 5L9XA 3RJKA 1FO4A 2PFOA 3WU2U 2H3QA 4FE3A 1ZD3A 3MGVA 3LYSA 5L1JA 1XSNA 4DL6A 1F44A 4QJFB 1WWUA 1YZ6A 3HX0A 3BZKA 3JPNA 1RZTA 1NKEA 1A0PA 5BOLA 4PHPA 1LKYB 2ASLA 5CB1A 4DQPA 4DOCA 4CF3A 4B9VA 4RZRA 2KFZA 4Y2VA 1ZQIA 1ZQRA 3MR3A 5AK6A 1RQNA 8ICOA 4KTQA 4Y2TA 1IIPA 3V72A 1ZQVA 2KJ9A 3NTUA 4P2HA 1ZQDA 1B4FA 1TE2A 4GXJA 2ASJA 1Q3UA 1XO1A 1OUQA 1N5XA 3L4PA 3T5HA 1UT5A 1KKXA 1X40A 4RQ1A 1L7MA 4F2SA 2K4HA 4F2RA 9ICQA 4DL4A 5L1KA 3KZXA 5GTIU 1S0VA 5AHXA 3QUQA 2LKYA 3QU5A 5AK3A 2JXJA 5DGBA 1SB3C 4DF8A 1S9FA 3QXGA 4C4SA 1COOA 1K1SA 8ICHA 3GILA 4YG2A 4UB2A 2F8LA 5D4BA 2UVVA 4CCHA 4TQSA 2KMDA 1UA0A 2XGPA 3TFRA 4CF4A 2RP5A 3T79A 8ICBA 4UW9A 2KVCA 5KFEA 5B5EU 2MUTB 4AYBC 4P0QB 3MDCA 4CNQA 2HHQA 4O5CA 1X42A 1SKRA 5KFFA 1M6YA 3WK5A 4UB6U 1TAQA 2EH9A 2RLTA 2OXOA 5JRTA 2WF6A 7ICSA 5HMLA 3RRHA 5DG7A 5AM4A 3PSFA 3NVWA 4ECVA 5D46A 3DDHA 2MSNA 1SKWA 2BPGA 2K4PA 5KFXA 5EWFA 4RQ3A 5AIBA 4DL2A 2NYVA 2KSOA 3ONNA 5J2EA 3AUOA 5KT6A 7ICEA 2E8MA 3WKCA 5GTHU 1XU4A 1N2XA 8ICPA 5KG3A 4ECQA 3JPSA 1L8LA 4CDGA 4YQWA 5CHGA 4BX9C 4ECSA 4DQSA 2QB0B 5KG5A 1PK1A 2H5XA 4UAVA 4IQWA 5EE0A 3M6KA 3KD3A 1HIWA 3JPRA 2BR0A 2HHTA 3QE9Y 1TK5A 3SZ2A 2ZXHA 9ICSA 9ICTA 2AGOA 2PI5A 4NM2A 4CRXA 2OCEA 2YMQA 3BS5B 4I2EA 1NJZA 4ECXA 2GH1A 2VA3A 1N56A 2F1JA 2AQ0A 2ALZA 9ICUA 3H8SA 2IBKA 4HAIA 1NZPA 2JRZA 3NS1A 3QEAZ 2VKQA 1KLNA 4CF5A 3IM1A 2KNJA 1KFDA 2LI6A 3ZI4A 1XSPA 4G3IA 3RJIA 2BPFA 1J97A 2F44A 4IQVA 3WK4A 2V4QA 3QUTA 2PMZC 1N61A 2EZXA 3T5LA 3F5EA 5KFDA 3VC8A 4EZ6A 2B0CA 2XC9A 4QZHA 5KFKA 2K89A 2AXTU 1DGSA 3GZFA 1S10A 4UB3A 2Y0SF 2D8CA 4EX7A 1ZYQA 7ICQA 2LM4A 3FM9A 3QUCA 1MQ2A 5B66U 4UAUA 3NRWA 4LJXA 1BPZA 2QARA 3VCBA 2KG5A 2OWOA 4I2FA 3M6ZA 5KFBA 4PHDA 1V85A 5IINA 4TUQA 1WUDA 4QWEA 3G6XA 5C0YA 2W7PA 4RQ4A 4P0PA 1KN5A 2R8JA 5AKLA 3F53A 3K1ZA 4JB3A 2A1AA 3MDAA 5ALFA 3K4GA 4NY8A 2ZG6A 2JV3A 2WB1F 1X9MA 1CI4A 4FBUA 4KN7A 4YR3A 1ZQJA 5J29A 2I9GA 4I2GA 4M9HA 3MABA 4QWAA 3M9OB 3Q8PB 3M7DA 1ZQLA 1ED1A 3H0LB 4OJOA 3V7LA 2ZIVB 3ALRA 4NJ8A 2EDUA 2L5YA 3MC1A 5AM0A 3DEEA 1NJXA 2KHVA 3IG5A 4MF2A 2C2RA 4KLEA 1Z1BA 3OJSA 3EW9A 7ICUA 2JEJA 2KKPA 1D8LA 1GO3F 4PL1A 3RB0A 2BZFA 1DRGA 3LWLA 4Q45A 1X6IA 3UPQA 2P6RA 5KG1A 3N97B 2H3VA 4YMNA 4QZBA 1RYRA 5KFIA 4UB8U 1IV8A 2YMMA 5HP4A 5AI0A 3PNCA 5ALIA 3RF9A 4F3OA 1K1QA 4PZNA 1TK8A 3F2DA 3EYZA 3QU9A 2KVSA 4KMOB 3KOOA 4IL6U 2AH5A 4Q43A 4EZ9A 5KL8B 4F5NA 2BGWA 1DGJA 2H3ZA 2W9CA 5EE1A 2Q0ZX 4DSIA 2HW3A 8ICVA 5KFSA 3FYHA 4QZ9A 4F4XA 2I6XA 4QZCA 3IDWA 1N63A 2D6FC 4BGDA 5HNKA 2V9WA 2OEHA 2E8PA 1XNSA 3NUQA 2ZTCA 9ICMA 4RPXA 2ZUBA 4F5PA 4O3OA 2NRXA 3ED5A 3R9KA 1TK0A 1QQ5A 1NK9A 4IRDA 9ICRA 4UQGA 7ICTA 5ALPA 3OSPA 4PHAA 4NM1A 1PUZA 4P4MA 2FDRA 2JHDA 2W8LA 3HILA 4LZDA 2HBMA 3ZDAA 1QSYA 3BQ1A 3PVXA 3BQ7A 1A76A 2W04A 1RYUA 5AK5A 4MHVA 5JTIA 5AKJA 4ED3A 4EYHB 2F77X 3PO5A 5J0YA 4ED6A 5BPCA 4UARA 2RQ5A 2IOFA 1CRXA 9ICCA 1ZQUA 5ALZA 3SAFA 3WK6A 1OW5A 3HT3A 4XUSA 3F2BA 2FLNA 4NLKA 1ZRMA 3TI0A 5KFVA 5AM5A 3RJGA 3EZ5A 4DL5A 3ZDDA 2WTFA 3LK9A 3PX6A 4C8MA 1Z4OA 1ZOLA 3N7PD 5KFGA 4RQ0A 2I1QA 4YVZA 4ED1A 3EPGA 2KHQA 8ICJA 2LPEA 2KZ3A 1X2IA 3OGUA 3HRDD 1ZQZA 2DL0A 3QZ7A 2HBJA 1ZQTA 2DGZA 2QKQA 1UQVA 2KSOB 2Y1JA 3QU4A 2XICA 4JUZA 2HHSA 4YR0A 1SL2A 1ZJNA 5AKKA 8ICEA 3V7JA 3IV6A 5DGAA 2B6GA 3ISBA 3PW2A 4UB1A 3V7KA 4BXOA 2KZZA 4KLJA 5HHIA 4MEXA 2ZUCA 4FS2A 3Q8SB 2Z7JA 4YD1A 3C1YA 2Y0SC 2PI4A 4Y2XA 4Y2JA 4RQNA 4PGQA 3UQ2A 2O6KA 4J9LA 1D9DA 3AL0B 5ALMA 2FMSA 4YXMA 4ECYA 5DB8A 2G0AA 3CW2C 3MR5A 5KAIU 3AMZA 2DPIA 4USAA 2GLEA 2HOFA 2AHOB 1BPXA 3BS7A 4O0IA 2QLTA 2GO7A 4M47A 2ZTDA 1COKA 4F5RA 5IIKA 4DFDA 2KK0A 5CWRA 1NI3A 4J9SA 3E58A 1KL9A 7ICFA 4ECUA 4QZAA 4O3PA 1HEKA 3ORYA 3SEIA 3B0XA 3TADA 4U7CA 2VA2A 2FPKA 3LWMA 4O5EA 7ICRA 4PZOA 1ZRNA 3MBYA 3A0HU 1RPLA 2Y1IA 2KTQA 3RJEA 4JV0A 3OSNA 5J2JA 1AQ6A 1IG6A 3T3FA 3M9MB 1X9XA 3C21A 4YMOA 5J8YA 3SD7A 5D49A 4AP9A 4KLUA 3L3FX 4Y2QA 2M0NA 4FZLA 4JV2A 4R63A 1S77D 2QARB 5CJ7A 4I27A 4QZGA 1WCNA 3KHHA 4FS1A 2AU0A 1MQ3A 5G5GA 5KT5A 1YZ7A 4DQQA 5EOZA 8ICIA 4R66A 2ESEA 2E1EA 1JI7A 4P0PB 9ICOA 3IHQB 1CUKA 4GIBA 4PGXA 2HOQA 4UAZA 3UXNA 2W8KA 1NK6A 7ICIA 2I5HA 3RAQA 5KFLA 3RAXA 2ZIXB 1U9LA 3M9NB 3HJEA 5F9NA 5J0TA 3SI8A 4OJ6A 4EELA 1ZQHA 3NASA 2H3FA 1IXRA 1S0MA 4K4HA 4P4PA 1DOQA 4J9KA 4PJ0U 2W9BB 5KFJA 3F2CA 4CGZA 5KFAA 2J6UA 4F50A 3GIMA 4BWMA 1T94A 4YD2A 4QZIA 5KT4A 4I28A 1U48A 3H0RB 3RBDA 3C2LA 2PXIA 4PGYA 3PV8A 4OCZA 1FEZA 2FJ6A 1B22A 7ICPA 2J6TA 4OJ5A 4UB4A 5DBCA 2ASDA 2YMLA 1KTQA 1L3TA 4DQRA 3G6YA 2W7OA 4NL9C 4TURA 2ZUDA 4Z6CA 2IOHA 4ZOHC 3ZD9A 1CEZA 9ICBA 4YR2A
chains in the Genus database with same CATH topology
2H3ZA 3GZFA 3D2SA 4JMUA 2YB4A 2WB1C 3KFUF 2Y0SF 4QIWF 3HKZC 1A6SA 2K8BB 2HBJA 2DGZA 2NV3A 3L3FX 2HOIA 3D2NA 3ONNA 3NRWA 2M0NA 4FZLA 1XO0A 2K8AA 4ICAA 2KJ8A 4OO1J 3PSIA 3VCBA 2YB1A 2YX8A 1IIPA 3PZPA 2ZIXA 2ZXIA 1PVQA 2D6FC 3C28A 2GOLA 2VJ5A 2Q4TA 2MRLA 2VJ4A 2XICA 2KJ9A 2R18A 1PVPA 3OPXA 3N7RC 4IC9A 4ACOA 3SAGA 2K4EA 2HBLA 2KJ5A 2WAQC 3M6ZA 1XNSA 1KBUA 4KX3A 3D2QA 3AQFA 4CDGA 1WUDA 1SZHA 4BX9C 3NUQA 5C0YA 3O0FA 2VIXA 1URJA 2G09A 1D8BA 2JH7A 2W7PA 4P0PA 2KD1A 4KX5A 1Q3UA 1OUQA 2E1EA 3LVWA 4C0ZA 2LYBA 3F53A 3K1ZA 3M6KA 4NLCA 2OYYA 4P0PB 2G08A 3ICXA 1P7DA 3IP4B 2RHFA 2KIWA 2E1FA 1HIWA 3RFAA 2ZG6A 2HOQA 2K4HA 2Z7JA 4AYBF 2JHDA 2K8CB 2G07A 4OJPA 2Y0SC 3KZXA 2ZIUA 2HMXA 2WB1F 4QIWC 3SQIA 2HBKA 2CRXA 2KKVA 2ZXHA 3HKZF 2JGAA 2LKYA 2ZIUB 3GU3A 2HBMA 1PVRA 1MA7A 2G5IB 2ZIXB 4BJQA 4CRXA 3N7SC 2OM6A 3AL0B 4OJ6A 2W04A 3PSTA 2CPRA 2XI9A 2PMZF 2F76X 2G0AA 2H3FA 2G5HB 2OH2A 3CP8A 3IN5A 1ZQ1C 3SMVA 5T14A 2DF4B 1ECWA 2BDUA 2GH1A 2ZIVA 4U6PA 2LYAA 3M7DA 2WAQF 2F8LA 1ED1A 3H0LB 4FZMA 2F77X 4OJOA 2H3IA 5CRXA 2JH1A 5KL1B 2KEYA 2RRDA 2ZIVB 3ALRA 2HOFA 3IG8A 2RP5A 3DEEA 4NLBA 3T79A 2KHVA 3IG5A 4NV0A 1TAMA 2JMGA 1CRXA 3F2CA 4CGZA 3LVVA 2XVTA 2VKQA 2CN1A 2K4IA 1Z1BA 3SAFA 4WJ3B 2KOBA 2KNJA 2KVCA 1T94A 2N1RA 2W03A 4P0QA 2A3VA 3C29A 4FZNA 2KV2A 2KKPA 3H0RB 2DQNB 1GO3F 4GFJA 4PL1A 3F2BA 4AYBC 4P0QB 2XIDA 2F2AB 1DRGA 4A8EA 4PL2A 3E0FA 1Z19A 3CRXA 4OJ5A 2H3QA 4FE3A 3MGVA 2H3VA 2G06A 1YT3A 3LYSA 4OJLA 1NZBA 3H0MB 1F44A 4QJFB 1L6NA 3F5AA 3CYMA 2LHTA 4NWIA 3AQEA 2ZIWA 1HEKA 2PMZC 4O3MA 2KICA 3SAHA 2MA1A 5HR6A 4U7CA 2OXOA 3RF9A 3F5EA 3PSPA 2W7OA 2ZIWB 1A0PA 2E5SA 3VC8A 4BUGA 3N7PD 4QNLA 3F2DA 4KMOB 2LBOA 1Q3VA 1UPHA 5A0LA 5HR7A 3PSFA 5KL8B 2K89A 2KHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRG A;  4A8E A;  1Z19 A;  2KD1 A;  1Q3U A;  1OUQ A;  3CRX A;  3MGV A;  3LYS A;  5CRX A;  1NZB A;  1P7D A;  2HOI A;  1F44 A;  2KIW A;  3NRW A;  2KEY A;  1XO0 A;  2KJ8 A;  2HOF A;  2KHV A;  2OXO A;  1PVQ A;  1CRX A;  1A0P A;  3C28 A;  2CRX A;  2KKV A;  1Z1B A;  1PVP A;  2KJ9 A;  4ACO A;  2KOB A;  1PVR A;  1MA7 A;  2KJ5 A;  1KBU A;  1XNS A;  2A3V A;  3C29 A;  1Q3V A;  4CRX A;  2KKP A;  2KHQ A; 
#chains in the Genus database with same CATH topology
 2BCQ A;  4O3N A;  4RT3 A;  3PX4 A;  4M0A A;  3GIJ A;  3AN1 A;  4ELU A;  8ICL A;  1ZQS A;  1XWL A;  1UA1 A;  1FFU A;  2K8B B;  3WK9 A;  3RBE A;  1NJW A;  4Y2R A;  1RQL A;  5KFO A;  1PVQ A;  4TQR A;  5KT3 A;  5DQH A;  2VJ4 A;  3TAC B;  1DK2 A;  4C4T A;  3OPX A;  2HBL A;  3WKB A;  3SV3 A;  2R8I A;  1URJ A;  3FAH A;  4R8U A;  2JH7 A;  9ICN A;  4KLL A;  5ALR A;  1ZQM A;  4NLC A;  2OYY A;  1MC8 A;  5KAF U;  3UXO A;  2RHF A;  4YP3 A;  5J2I A;  4C8N A;  2NO4 A;  1NJY A;  1BPY A;  1QSL A;  5KFU A;  4B9M A;  3KKA A;  2NRZ A;  3PR5 B;  1VLB A;  1QTM A;  4QZE A;  4B9S A;  2CRX A;  3HKZ F;  1SWV A;  4BJQ A;  2NRT A;  4F8R A;  5DLF A;  3SR6 A;  5KG2 A;  4GC7 A;  4US9 A;  3CP8 A;  1JMS A;  2IHM A;  1X9S A;  3TQ1 A;  3GII A;  2BQR A;  2EZZ A;  8ICF A;  2YN4 A;  1ZQN A;  2MU2 A;  2UVU A;  2IHN A;  4NLN A;  2C2E A;  4GXI A;  2P66 A;  9ICV A;  2XID A;  4I2C A;  4M6W B;  4KLQ A;  2W9A A;  2JEG A;  8ICU A;  4LZG A;  4IRK A;  1L6N A;  3QX7 A;  4NWI A;  1SKS A;  8ICQ A;  4O3M A;  3K75 D;  1V97 A;  3SYZ A;  4UBC A;  3ZDB A;  2AJQ A;  5DB9 A;  5AKG A;  4FFD A;  2RDJ A;  3RTV A;  4M9N A;  5ALS A;  3KFU F;  4QZ8 A;  5J0O A;  1S5L U;  1ZQO A;  1HJP A;  5DG8 A;  5ALQ A;  2CXY A;  3TKA A;  3C2M A;  4DSF A;  3V6H A;  3UMB A;  2HVI A;  1U47 A;  2C2D A;  2ZXI A;  4IR1 A;  2VJ5 A;  2MRL A;  2DKX A;  4ACO A;  4RQ8 A;  2WAQ C;  4QW8 A;  2W3R A;  5ALT A;  2JEI A;  5AKY A;  2WFA A;  2G09 A;  4Q44 A;  4ED7 A;  5ALU A;  2ZJ5 A;  5KFQ A;  7ICG A;  4RPZ A;  3IP4 B;  2BKE A;  4KLO A;  4BXO B;  5HMM A;  3RFA A;  5F3X B;  7ICH A;  1BVS A;  2DWQ A;  2NRW A;  1L7O A;  2G07 A;  4OJP A;  2HMX A;  5H2F U;  3Q8R B;  2KKV A;  2R8H A;  2F1I A;  3BQT A;  4RPY A;  2DPJ A;  3N7S C;  2OM6 A;  4TUS A;  4DOA A;  4MFC A;  3NVY A;  3B0Y A;  4RUC A;  2JZB B;  1HUO A;  1KW4 A;  5CRX A;  3N28 A;  3H7I A;  2KEY A;  9ICA A;  4PHE A;  2FLP A;  2BCS A;  3UQ0 A;  4J9R A;  1KFS A;  4M2Y A;  1JRO A;  2W55 A;  1SXE A;  3SV4 A;  3C29 A;  2KV2 A;  4GC6 A;  1NK8 A;  1Y88 A;  3QNM A;  2FMQ A;  5G5H A;  7ICK A;  2E8O A;  3WK8 A;  3QYP A;  5HR6 A;  4KLH A;  2BCV A;  4KLM A;  4DOB A;  2VAN A;  1N5W A;  4XA5 A;  4F4K A;  5KG6 A;  5ALY A;  5A0L A;  1Q3V A;  1L8O A;  4DQI A;  3Q8Q B;  2PFN A;  1WCL A;  2Y9U A;  5J2D A;  1N60 A;  3JPP A;  4RQ6 A;  5J2K A;  4KIT B;  3JPT A;  3RB4 A;  1SIJ A;  3D2N A;  5CR0 A;  2KJ8 A;  2E3T A;  3NVZ A;  2BHN A;  5ALG A;  3C28 A;  1KRP A;  4I2I A;  2HHU A;  1NK7 A;  1KFT A;  2KE7 A;  2KZM A;  4KX3 A;  2Y9T A;  1JXL A;  5ALV A;  4KLD A;  9ICP A;  1N62 A;  4YN4 A;  3RH6 A;  4JV1 A;  3LVW A;  4C0Z A;  5AKI A;  4O3S A;  2KIW A;  5J0W A;  4UAY A;  5KFT A;  1L7P A;  3KZI U;  1L5U A;  1O08 A;  2HDO A;  4DS5 A;  2JGA A;  5J0X A;  5AM1 A;  3TAR A;  2EAP A;  4NXZ A;  1ZQF A;  5DQI A;  5DB7 A;  1QH9 A;  2W3S A;  2CPR A;  2G5H B;  4Y2Y A;  2XY5 A;  2BDU A;  5AIC A;  2XO7 A;  1NK4 A;  1B43 A;  1EXN A;  4UBB A;  2ISP A;  2XVT A;  2CN1 A;  1TAU A;  5AM3 A;  1BPE A;  4WJ3 B;  3Q8M A;  4RT2 A;  8ICY A;  1QLN A;  4GXK A;  3UXP A;  4F91 B;  5J0P A;  1XSL A;  1TV9 A;  1ZQW A;  3ETL A;  1JXE A;  2C22 A;  3JPO A;  3QU2 A;  3AQE A;  2YMP A;  3WKD A;  9ICF A;  5DDM A;  5DDY A;  3H8J A;  1SV4 A;  2E5S A;  1X6J A;  2GWS A;  4ED2 A;  2W9M A;  4B9L A;  4EEK A;  2WF8 A;  3NVV A;  1B0X A;  3C5F A;  3T5J A;  1WWV A;  1DXS A;  3HP6 A;  5KG0 A;  3N4M B;  5KFM A;  3H40 A;  2YQE A;  2HHW A;  1BNO A;  1X9W A;  5AM2 A;  2EAO A;  2HOI A;  4O9M A;  4ICA A;  1JIH A;  2GOL A;  4R64 A;  2FMP A;  1C20 A;  4E0D A;  1Z00 A;  1SZP A;  5J2H A;  4C7Z A;  5AI5 A;  3OTQ A;  1BGX T;  2AQ4 A;  3HW8 A;  2VIX A;  5KFN A;  2XY6 A;  1XS9 D;  4R8U B;  1ZQC A;  4P4O A;  1JUD A;  1QQ6 A;  3GV8 B;  5ALJ A;  4BWJ A;  3EPI A;  2PFP A;  1UHU A;  2K8C B;  1L3S A;  1U49 A;  4M9G A;  4C4R A;  5JU5 A;  1ZQG A;  5DB6 A;  4F4Y A;  4ECT A;  1MA7 A;  4RQM A;  4EEY A;  4NLZ A;  3QUB A;  7ICO A;  2KP7 A;  2XI9 A;  5FP0 A;  2F76 X;  1FFV A;  2LM1 A;  2W54 A;  2WF7 A;  1PK1 B;  1TKD A;  2H3I A;  1NK0 A;  3H8M A;  5KL1 B;  2HSZ A;  4NLB A;  2PFQ A;  4G9B A;  1C7Y A;  5KFC A;  4J03 A;  4MFA A;  2A19 A;  1ZQX A;  1WG8 A;  4FZN A;  4R65 A;  7ICN A;  2P35 A;  2F2A B;  4DFP A;  2G06 A;  8ICK A;  4KN4 A;  2LHT A;  4PH5 A;  2WHE A;  2ZIW A;  9ICE A;  4I2A A;  3GDX A;  8ICT A;  3WKE A;  2P6U A;  4U6P A;  5F9L A;  1F5S A;  8ICM A;  4M04 A;  2YB4 A;  2WB1 C;  3RH5 A;  1ZQK A;  3PW5 A;  1JN3 A;  2EAN A;  1A6S A;  4F5O A;  2NV3 A;  1K5O A;  3T5K A;  1XO0 A;  4DS4 A;  1L7N A;  5KFY A;  5DBA A;  4EBE A;  1PVP A;  5L1M A;  4IC9 A;  7ICL A;  1RYS A;  1V9P A;  3D2Q A;  5DBB A;  1SZH A;  4MF8 A;  3K1R B;  8ICZ A;  4F72 A;  4RUA A;  1LV5 A;  1L3V A;  5EE9 A;  1H38 A;  4KMU A;  5J0Q A;  2OHF A;  2ZIU A;  2HBK A;  1T4G A;  1MSW D;  3PW0 A;  4DFK A;  3EWA A;  1UT8 A;  4BDP A;  4KLG A;  3RR7 A;  2HHX A;  1RXW A;  2K60 A;  4O5K A;  5CP2 A;  4KLS A;  3SMV A;  5AK4 A;  3ISC A;  2ODG A;  2LYA A;  4FZM A;  1D9F A;  3PMN A;  1QSS A;  2IMW P;  4DFM A;  3B9J A;  5AKZ A;  2ATL A;  1IM4 A;  4DL7 A;  5KFR A;  2JMG A;  2XY7 A;  3KHG A;  4DSK A;  9ICX A;  4YXJ A;  5KFP A;  3THV A;  2A3V A;  3H4B A;  3I76 A;  5KG7 A;  9ICK A;  4J9P A;  1YT3 A;  2LYH A;  2W43 A;  1NZB A;  3F5A A;  4J9N A;  1VDV A;  4F71 A;  2KIC A;  1RXV A;  5KNI A;  5AIA A;  3C1Z A;  7ICV A;  2MAX A;  2LBO A;  3RB6 A;  5J2F A;  2LMR A;  4F92 B;  4JMU A;  2V4R A;  3TAP A;  1ZET A;  4EX6 A;  2WF9 A;  4QWC A;  1NKC A;  3V6J A;  4QW9 A;  3MFI A;  2XCA A;  4I2B A;  4Z6D A;  2RDI A;  2YB1 A;  1Q8K A;  4HYK A;  4B9T A;  4F5Q A;  1UCV A;  4ELT A;  3NGD A;  3KHL A;  3MGH A;  4Y2U A;  3PML A;  4KX5 A;  1Z3E B;  3G6V A;  4ED0 A;  1NK5 A;  2W9C B;  2E1F A;  5TIS U;  4KLI A;  2WF5 A;  3RJH A;  1V38 A;  4RNM A;  9ICJ A;  5E79 U;  2DKZ A;  3TAQ A;  3TAN A;  5TZV A;  3IN5 A;  3Q8L A;  1RM6 C;  3C5G A;  1S97 A;  4F93 B;  3BZC A;  2JH1 A;  5DLG A;  2BCU A;  4DWI A;  4YCX A;  3GQC A;  3BQ0 A;  1TAM A;  1NNL A;  2KOB A;  2N1R A;  4IQU A;  4B9U A;  4YMM A;  3IRU A;  4RU9 A;  4Z6F A;  4QZF A;  3S6J A;  4A8E A;  1VJ5 A;  3HWT A;  3M8S A;  4O3Q A;  3RB3 A;  1ZQE A;  3H0M B;  3RRG A;  3UM9 A;  2C28 A;  1KDH A;  1ZD5 A;  4QNL A;  8ICG A;  4QWD A;  4RNO A;  1T7P A;  4GLX A;  5J2G A;  2BQ3 A;  3GIK A;  1KQQ A;  5HR7 A;  2BQU A;  1QCK A;  5KFH A;  2KN7 A;  3OJU A;  4C8L A;  4K4I A;  1X66 A;  4CE6 A;  5AI8 A;  4UAS A;  3BDP A;  1QQ7 A;  4I29 A;  4MEY A;  4DLE A;  4QZD A;  5ALE A;  3MGI A;  1JX4 A;  5ALN A;  4KLT A;  4EEN A;  3PSI A;  1ZD4 A;  4KLF A;  3EUB 2;  4J9M A;  4I2D A;  5AKE A;  5ALH A;  5ALX A;  3SAG A;  4IQT A;  2KJ5 A;  1KBU A;  4DSE A;  4DO9 A;  2D3D A;  1Z00 B;  3TAD C;  1T3N A;  1D8B A;  2HCF A;  2ZJA A;  1NOM A;  9ICW A;  4I2J A;  4FBT A;  3ICX A;  3I1Y A;  5IIJ A;  5J2A A;  5KT7 A;  8ICW A;  3SQI A;  5J8Y C;  2EZY A;  3ZDE A;  5AI4 A;  3GU3 A;  1PVR A;  3H4D A;  4TUP A;  2G5I B;  4JK1 A;  3KTQ A;  1SV0 A;  4ECZ A;  2M9N A;  2NRV A;  4Q8F A;  1TVA A;  3QEB Z;  2A1J A;  1ZQQ A;  3ISD A;  3FC4 A;  1FIQ A;  2ZTE A;  4RQ7 A;  2FI1 A;  2K4I A;  3PO4 A;  2W03 A;  3OHA A;  3WKA A;  3AM9 A;  3PX0 A;  2YTU A;  4DLG A;  5KTQ A;  5HHH A;  8ICX A;  1ZQP A;  2R8K A;  1S8O A;  5J0R A;  3RJF A;  3D6J A;  2KFN A;  5BOM A;  2BPC A;  4PPX A;  1ZXI A;  2AGP A;  5AKH A;  5IIO A;  3SAH A;  2MA1 A;  2FE9 A;  2ZIW B;  1LKY A;  1HUZ A;  3V6K A;  1SL1 A;  1ZQB A;  8ICC A;  5DKW A;  4C80 A;  8ICN A;  1L3U A;  2JEF A;  1ARO P;  4B6J A;  4QIW F;  4IS7 A;  5L1I A;  5ALW A;  5KFW A;  2IA6 A;  3FDS A;  3LDA A;  2YX8 A;  2ZIX A;  2Q4T A;  2HVH A;  2IOF K;  5ALD A;  4F4W A;  3N7R C;  5III A;  3Q8K A;  3NRZ A;  3RR8 A;  3PW4 A;  4IR9 A;  1RG6 A;  1A77 A;  5AI6 A;  5L1L A;  2W9B A;  3PY8 A;  2G08 A;  2F3N A;  4DF4 A;  1J2M A;  1SXD A;  8ICR A;  2ZIU B;  5J2C A;  3PST A;  3TFS A;  2BCR A;  1SL0 A;  3PR4 A;  1ZQ1 C;  4F4Z A;  3HPO A;  2DF4 B;  4Q8E A;  1BPB A;  4EBC A;  8ICA A;  2DFL A;  2BDP A;  3GV7 B;  4NV0 A;  1U45 A;  4XQ8 A;  4RNN A;  3AU2 A;  2MUT A;  4P0Q A;  3KKA C;  5IIM A;  3A0B U;  3E0F A;  1Z19 A;  3KBB A;  3CRX A;  4ECR A;  4JWN A;  4OJL A;  4IRC A;  4EBD A;  5J0U A;  3CYM A;  1ZQY A;  4M9L A;  5DG9 A;  3M1Y A;  2KIV A;  1RDF A;  2VA8 A;  3CNH A;  4DCC A;  3PSP A;  3PW7 A;  3WK7 A;  4O3R A;  1T8E A;  2AGQ A;  4FO6 A;  5KFZ A;  5KT2 A;  4JWM A;  2FPL A;  4K4G A;  2F1H A;  3D2S A;  1O03 A;  7ICJ A;  2PKE A;  3HKZ C;  5EE3 A;  1WYG A;  5IIL A;  4C8O A;  2XCP A;  2ZJ8 A;  2ISO A;  4EYI B;  1SWW A;  2F8K A;  1J2N A;  4C8K A;  1N48 A;  3C2K A;  4ELV A;  4M9J A;  3AQF A;  2QB0 A;  7ICM A;  2HHV A;  3O0F A;  2ES6 A;  4YFK A;  3BQ2 A;  4J9O A;  2KD1 A;  3MFH A;  4MFF A;  4DEZ A;  2LYB A;  4X5V A;  3KHR A;  4ED8 A;  3DV9 A;  2FPM A;  4XRH A;  4Y2S A;  1PK3 A;  4AYB F;  4Y2P A;  5JUM A;  1T3Q A;  4UAT A;  3JPQ A;  1BPD A;  4M6W A;  4UAW A;  3BS5 A;  3QU7 A;  4RQ2 A;  2OH2 A;  3MR6 A;  2XGQ A;  4DSJ A;  4NL9 A;  1ECW A;  1SV0 C;  5CEH A;  1Z1V A;  4J9Q A;  4Z6E A;  5DQG A;  9ICL A;  8ICS A;  1D8Y A;  3LVV A;  2JR5 A;  3U26 A;  3M8R A;  4US8 A;  1S76 D;  3AU6 A;  1XC9 A;  2DUY A;  4GFJ A;  2EAM A;  3OHB A;  3RH4 A;  3QZ8 A;  1U4B A;  4PL2 A;  4C7Y A;  2EQY A;  4OD0 A;  3J81 j;  5C5J A;  2NO5 A;  1JRP A;  1TFR A;  5J2B A;  4RQ5 A;  1LVH A;  2QB1 A;  2J6S A;  4BUG A;  5EWE A;  4DL3 A;  4DSL A;  4QWB A;  1UPH A;  5AI9 A;  5AKX A;  3MR2 A;  1KSP A;  9ICG A;  1ZJM A;  2UVR A;  5J0S A;  1MN8 A;  4UB5 A;  4DFJ A;  1F0M A;  9ICI A;  9ICH A;  2W11 A;  5ALK A;  2K8A A;  4OO1 J;  3UMC A;  3UMG A;  3PZP A;  4LVS A;  1PZN A;  2R18 A;  5EWG A;  1S0N A;  3H8W A;  2K4E A;  1LB2 B;  1BNP A;  1SGG A;  2JZB A;  4I2H A;  3I28 A;  4B9N A;  5ALL A;  2R8G A;  1DK3 A;  4NLG A;  3GFK B;  3E2E A;  1P7D A;  5ALO A;  2HI0 A;  5KG4 A;  4ECW A;  4QIW C;  1Q46 A;  2FLL A;  3ETR A;  3ZDC A;  1S0O A;  1ZQA A;  2PMZ F;  2E8N A;  3RJJ A;  3ZD8 A;  5T14 A;  1Z4N A;  3BJY A;  2B21 A;  1JAL A;  2ZIV A;  1NKB A;  2UVW A;  2WAQ F;  4ZH4 A;  3GV5 B;  2RRD A;  3C23 A;  2A1J B;  3AEV A;  3IG8 A;  3SEN A;  1ZD2 P;  2YY6 A;  5K4L A;  1KEJ A;  5CA7 A;  2DBY A;  1OXJ A;  2DQN B;  3L5K A;  5L9X A;  3RJK A;  1FO4 A;  2PFO A;  3WU2 U;  2H3Q A;  4FE3 A;  1ZD3 A;  3MGV A;  3LYS A;  5L1J A;  1XSN A;  4DL6 A;  1F44 A;  4QJF B;  1WWU A;  1YZ6 A;  3HX0 A;  3BZK A;  3JPN A;  1RZT A;  1NKE A;  1A0P A;  5BOL A;  4PHP A;  1LKY B;  2ASL A;  5CB1 A;  4DQP A;  4DOC A;  4CF3 A;  4B9V A;  4RZR A;  2KFZ A;  4Y2V A;  1ZQI A;  1ZQR A;  3MR3 A;  5AK6 A;  1RQN A;  8ICO A;  4KTQ A;  4Y2T A;  1IIP A;  3V72 A;  1ZQV A;  2KJ9 A;  3NTU A;  4P2H A;  1ZQD A;  1B4F A;  1TE2 A;  4GXJ A;  2ASJ A;  1Q3U A;  1XO1 A;  1OUQ A;  1N5X A;  3L4P A;  3T5H A;  1UT5 A;  1KKX A;  1X40 A;  4RQ1 A;  1L7M A;  4F2S A;  2K4H A;  4F2R A;  9ICQ A;  4DL4 A;  5L1K A;  3KZX A;  5GTI U;  1S0V A;  5AHX A;  3QUQ A;  2LKY A;  3QU5 A;  5AK3 A;  2JXJ A;  5DGB A;  1SB3 C;  4DF8 A;  1S9F A;  3QXG A;  4C4S A;  1COO A;  1K1S A;  8ICH A;  3GIL A;  4YG2 A;  4UB2 A;  2F8L A;  5D4B A;  2UVV A;  4CCH A;  4TQS A;  2KMD A;  1UA0 A;  2XGP A;  3TFR A;  4CF4 A;  2RP5 A;  3T79 A;  8ICB A;  4UW9 A;  2KVC A;  5KFE A;  5B5E U;  2MUT B;  4AYB C;  4P0Q B;  3MDC A;  4CNQ A;  2HHQ A;  4O5C A;  1X42 A;  1SKR A;  5KFF A;  1M6Y A;  3WK5 A;  4UB6 U;  1TAQ A;  2EH9 A;  2RLT A;  2OXO A;  5JRT A;  2WF6 A;  7ICS A;  5HML A;  3RRH A;  5DG7 A;  5AM4 A;  3PSF A;  3NVW A;  4ECV A;  5D46 A;  3DDH A;  2MSN A;  1SKW A;  2BPG A;  2K4P A;  5KFX A;  5EWF A;  4RQ3 A;  5AIB A;  4DL2 A;  2NYV A;  2KSO A;  3ONN A;  5J2E A;  3AUO A;  5KT6 A;  7ICE A;  2E8M A;  3WKC A;  5GTH U;  1XU4 A;  1N2X A;  8ICP A;  5KG3 A;  4ECQ A;  3JPS A;  1L8L A;  4CDG A;  4YQW A;  5CHG A;  4BX9 C;  4ECS A;  4DQS A;  2QB0 B;  5KG5 A;  1PK1 A;  2H5X A;  4UAV A;  4IQW A;  5EE0 A;  3M6K A;  3KD3 A;  1HIW A;  3JPR A;  2BR0 A;  2HHT A;  3QE9 Y;  1TK5 A;  3SZ2 A;  2ZXH A;  9ICS A;  9ICT A;  2AGO A;  2PI5 A;  4NM2 A;  4CRX A;  2OCE A;  2YMQ A;  3BS5 B;  4I2E A;  1NJZ A;  4ECX A;  2GH1 A;  2VA3 A;  1N56 A;  2F1J A;  2AQ0 A;  2ALZ A;  9ICU A;  3H8S A;  2IBK A;  4HAI A;  1NZP A;  2JRZ A;  3NS1 A;  3QEA Z;  2VKQ A;  1KLN A;  4CF5 A;  3IM1 A;  2KNJ A;  1KFD A;  2LI6 A;  3ZI4 A;  1XSP A;  4G3I A;  3RJI A;  2BPF A;  1J97 A;  2F44 A;  4IQV A;  3WK4 A;  2V4Q A;  3QUT A;  2PMZ C;  1N61 A;  2EZX A;  3T5L A;  3F5E A;  5KFD A;  3VC8 A;  4EZ6 A;  2B0C A;  2XC9 A;  4QZH A;  5KFK A;  2K89 A;  2AXT U;  1DGS A;  3GZF A;  1S10 A;  4UB3 A;  2Y0S F;  2D8C A;  4EX7 A;  1ZYQ A;  7ICQ A;  2LM4 A;  3FM9 A;  3QUC A;  1MQ2 A;  5B66 U;  4UAU A;  3NRW A;  4LJX A;  1BPZ A;  2QAR A;  3VCB A;  2KG5 A;  2OWO A;  4I2F A;  3M6Z A;  5KFB A;  4PHD A;  1V85 A;  5IIN A;  4TUQ A;  1WUD A;  4QWE A;  3G6X A;  5C0Y A;  2W7P A;  4RQ4 A;  4P0P A;  1KN5 A;  2R8J A;  5AKL A;  3F53 A;  3K1Z A;  4JB3 A;  2A1A A;  3MDA A;  5ALF A;  3K4G A;  4NY8 A;  2ZG6 A;  2JV3 A;  2WB1 F;  1X9M A;  1CI4 A;  4FBU A;  4KN7 A;  4YR3 A;  1ZQJ A;  5J29 A;  2I9G A;  4I2G A;  4M9H A;  3MAB A;  4QWA A;  3M9O B;  3Q8P B;  3M7D A;  1ZQL A;  1ED1 A;  3H0L B;  4OJO A;  3V7L A;  2ZIV B;  3ALR A;  4NJ8 A;  2EDU A;  2L5Y A;  3MC1 A;  5AM0 A;  3DEE A;  1NJX A;  2KHV A;  3IG5 A;  4MF2 A;  2C2R A;  4KLE A;  1Z1B A;  3OJS A;  3EW9 A;  7ICU A;  2JEJ A;  2KKP A;  1D8L A;  1GO3 F;  4PL1 A;  3RB0 A;  2BZF A;  1DRG A;  3LWL A;  4Q45 A;  1X6I A;  3UPQ A;  2P6R A;  5KG1 A;  3N97 B;  2H3V A;  4YMN A;  4QZB A;  1RYR A;  5KFI A;  4UB8 U;  1IV8 A;  2YMM A;  5HP4 A;  5AI0 A;  3PNC A;  5ALI A;  3RF9 A;  4F3O A;  1K1Q A;  4PZN A;  1TK8 A;  3F2D A;  3EYZ A;  3QU9 A;  2KVS A;  4KMO B;  3KOO A;  4IL6 U;  2AH5 A;  4Q43 A;  4EZ9 A;  5KL8 B;  4F5N A;  2BGW A;  1DGJ A;  2H3Z A;  2W9C A;  5EE1 A;  2Q0Z X;  4DSI A;  2HW3 A;  8ICV A;  5KFS A;  3FYH A;  4QZ9 A;  4F4X A;  2I6X A;  4QZC A;  3IDW A;  1N63 A;  2D6F C;  4BGD A;  5HNK A;  2V9W A;  2OEH A;  2E8P A;  1XNS A;  3NUQ A;  2ZTC A;  9ICM A;  4RPX A;  2ZUB A;  4F5P A;  4O3O A;  2NRX A;  3ED5 A;  3R9K A;  1TK0 A;  1QQ5 A;  1NK9 A;  4IRD A;  9ICR A;  4UQG A;  7ICT A;  5ALP A;  3OSP A;  4PHA A;  4NM1 A;  1PUZ A;  4P4M A;  2FDR A;  2JHD A;  2W8L A;  3HIL A;  4LZD A;  2HBM A;  3ZDA A;  1QSY A;  3BQ1 A;  3PVX A;  3BQ7 A;  1A76 A;  2W04 A;  1RYU A;  5AK5 A;  4MHV A;  5JTI A;  5AKJ A;  4ED3 A;  4EYH B;  2F77 X;  3PO5 A;  5J0Y A;  4ED6 A;  5BPC A;  4UAR A;  2RQ5 A;  2IOF A;  1CRX A;  9ICC A;  1ZQU A;  5ALZ A;  3SAF A;  3WK6 A;  1OW5 A;  3HT3 A;  4XUS A;  3F2B A;  2FLN A;  4NLK A;  1ZRM A;  3TI0 A;  5KFV A;  5AM5 A;  3RJG A;  3EZ5 A;  4DL5 A;  3ZDD A;  2WTF A;  3LK9 A;  3PX6 A;  4C8M A;  1Z4O A;  1ZOL A;  3N7P D;  5KFG A;  4RQ0 A;  2I1Q A;  4YVZ A;  4ED1 A;  3EPG A;  2KHQ A;  8ICJ A;  2LPE A;  2KZ3 A;  1X2I A;  3OGU A;  3HRD D;  1ZQZ A;  2DL0 A;  3QZ7 A;  2HBJ A;  1ZQT A;  2DGZ A;  2QKQ A;  1UQV A;  2KSO B;  2Y1J A;  3QU4 A;  2XIC A;  4JUZ A;  2HHS A;  4YR0 A;  1SL2 A;  1ZJN A;  5AKK A;  8ICE A;  3V7J A;  3IV6 A;  5DGA A;  2B6G A;  3ISB A;  3PW2 A;  4UB1 A;  3V7K A;  4BXO A;  2KZZ A;  4KLJ A;  5HHI A;  4MEX A;  2ZUC A;  4FS2 A;  3Q8S B;  2Z7J A;  4YD1 A;  3C1Y A;  2Y0S C;  2PI4 A;  4Y2X A;  4Y2J A;  4RQN A;  4PGQ A;  3UQ2 A;  2O6K A;  4J9L A;  1D9D A;  3AL0 B;  5ALM A;  2FMS A;  4YXM A;  4ECY A;  5DB8 A;  2G0A A;  3CW2 C;  3MR5 A;  5KAI U;  3AMZ A;  2DPI A;  4USA A;  2GLE A;  2HOF A;  2AHO B;  1BPX A;  3BS7 A;  4O0I A;  2QLT A;  2GO7 A;  4M47 A;  2ZTD A;  1COK A;  4F5R A;  5IIK A;  4DFD A;  2KK0 A;  5CWR A;  1NI3 A;  4J9S A;  3E58 A;  1KL9 A;  7ICF A;  4ECU A;  4QZA A;  4O3P A;  1HEK A;  3ORY A;  3SEI A;  3B0X A;  3TAD A;  4U7C A;  2VA2 A;  2FPK A;  3LWM A;  4O5E A;  7ICR A;  4PZO A;  1ZRN A;  3MBY A;  3A0H U;  1RPL A;  2Y1I A;  2KTQ A;  3RJE A;  4JV0 A;  3OSN A;  5J2J A;  1AQ6 A;  1IG6 A;  3T3F A;  3M9M B;  1X9X A;  3C21 A;  4YMO A;  5J8Y A;  3SD7 A;  5D49 A;  4AP9 A;  4KLU A;  3L3F X;  4Y2Q A;  2M0N A;  4FZL A;  4JV2 A;  4R63 A;  1S77 D;  2QAR B;  5CJ7 A;  4I27 A;  4QZG A;  1WCN A;  3KHH A;  4FS1 A;  2AU0 A;  1MQ3 A;  5G5G A;  5KT5 A;  1YZ7 A;  4DQQ A;  5EOZ A;  8ICI A;  4R66 A;  2ESE A;  2E1E A;  1JI7 A;  4P0P B;  9ICO A;  3IHQ B;  1CUK A;  4GIB A;  4PGX A;  2HOQ A;  4UAZ A;  3UXN A;  2W8K A;  1NK6 A;  7ICI A;  2I5H A;  3RAQ A;  5KFL A;  3RAX A;  2ZIX B;  1U9L A;  3M9N B;  3HJE A;  5F9N A;  5J0T A;  3SI8 A;  4OJ6 A;  4EEL A;  1ZQH A;  3NAS A;  2H3F A;  1IXR A;  1S0M A;  4K4H A;  4P4P A;  1DOQ A;  4J9K A;  4PJ0 U;  2W9B B;  5KFJ A;  3F2C A;  4CGZ A;  5KFA A;  2J6U A;  4F50 A;  3GIM A;  4BWM A;  1T94 A;  4YD2 A;  4QZI A;  5KT4 A;  4I28 A;  1U48 A;  3H0R B;  3RBD A;  3C2L A;  2PXI A;  4PGY A;  3PV8 A;  4OCZ A;  1FEZ A;  2FJ6 A;  1B22 A;  7ICP A;  2J6T A;  4OJ5 A;  4UB4 A;  5DBC A;  2ASD A;  2YML A;  1KTQ A;  1L3T A;  4DQR A;  3G6Y A;  2W7O A;  4NL9 C;  4TUR A;  2ZUD A;  4Z6C A;  2IOH A;  4ZOH C;  3ZD9 A;  1CEZ A;  9ICB A;  4YR2 A; 
#chains in the Genus database with same CATH homology
 2H3Z A;  3GZF A;  3D2S A;  4JMU A;  2YB4 A;  2WB1 C;  3KFU F;  2Y0S F;  4QIW F;  3HKZ C;  1A6S A;  2K8B B;  2HBJ A;  2DGZ A;  2NV3 A;  3L3F X;  2HOI A;  3D2N A;  3ONN A;  3NRW A;  2M0N A;  4FZL A;  1XO0 A;  2K8A A;  4ICA A;  2KJ8 A;  4OO1 J;  3PSI A;  3VCB A;  2YB1 A;  2YX8 A;  1IIP A;  3PZP A;  2ZIX A;  2ZXI A;  1PVQ A;  2D6F C;  3C28 A;  2GOL A;  2VJ5 A;  2Q4T A;  2MRL A;  2VJ4 A;  2XIC A;  2KJ9 A;  2R18 A;  1PVP A;  3OPX A;  3N7R C;  4IC9 A;  4ACO A;  3SAG A;  2K4E A;  2HBL A;  2KJ5 A;  2WAQ C;  3M6Z A;  1XNS A;  1KBU A;  4KX3 A;  3D2Q A;  3AQF A;  4CDG A;  1WUD A;  1SZH A;  4BX9 C;  3NUQ A;  5C0Y A;  3O0F A;  2VIX A;  1URJ A;  2G09 A;  1D8B A;  2JH7 A;  2W7P A;  4P0P A;  2KD1 A;  4KX5 A;  1Q3U A;  1OUQ A;  2E1E A;  3LVW A;  4C0Z A;  2LYB A;  3F53 A;  3K1Z A;  3M6K A;  4NLC A;  2OYY A;  4P0P B;  2G08 A;  3ICX A;  1P7D A;  3IP4 B;  2RHF A;  2KIW A;  2E1F A;  1HIW A;  3RFA A;  2ZG6 A;  2HOQ A;  2K4H A;  2Z7J A;  4AYB F;  2JHD A;  2K8C B;  2G07 A;  4OJP A;  2Y0S C;  3KZX A;  2ZIU A;  2HMX A;  2WB1 F;  4QIW C;  3SQI A;  2HBK A;  2CRX A;  2KKV A;  2ZXH A;  3HKZ F;  2JGA A;  2LKY A;  2ZIU B;  3GU3 A;  2HBM A;  1PVR A;  1MA7 A;  2G5I B;  2ZIX B;  4BJQ A;  4CRX A;  3N7S C;  2OM6 A;  3AL0 B;  4OJ6 A;  2W04 A;  3PST A;  2CPR A;  2XI9 A;  2PMZ F;  2F76 X;  2G0A A;  2H3F A;  2G5H B;  2OH2 A;  3CP8 A;  3IN5 A;  1ZQ1 C;  3SMV A;  5T14 A;  2DF4 B;  1ECW A;  2BDU A;  2GH1 A;  2ZIV A;  4U6P A;  2LYA A;  3M7D A;  2WAQ F;  2F8L A;  1ED1 A;  3H0L B;  4FZM A;  2F77 X;  4OJO A;  2H3I A;  5CRX A;  2JH1 A;  5KL1 B;  2KEY A;  2RRD A;  2ZIV B;  3ALR A;  2HOF A;  3IG8 A;  2RP5 A;  3DEE A;  4NLB A;  3T79 A;  2KHV A;  3IG5 A;  4NV0 A;  1TAM A;  2JMG A;  1CRX A;  3F2C A;  4CGZ A;  3LVV A;  2XVT A;  2VKQ A;  2CN1 A;  2K4I A;  1Z1B A;  3SAF A;  4WJ3 B;  2KOB A;  2KNJ A;  2KVC A;  1T94 A;  2N1R A;  2W03 A;  4P0Q A;  2A3V A;  3C29 A;  4FZN A;  2KV2 A;  2KKP A;  3H0R B;  2DQN B;  1GO3 F;  4GFJ A;  4PL1 A;  3F2B A;  4AYB C;  4P0Q B;  2XID A;  2F2A B;  1DRG A;  4A8E A;  4PL2 A;  3E0F A;  1Z19 A;  3CRX A;  4OJ5 A;  2H3Q A;  4FE3 A;  3MGV A;  2H3V A;  2G06 A;  1YT3 A;  3LYS A;  4OJL A;  1NZB A;  3H0M B;  1F44 A;  4QJF B;  1L6N A;  3F5A A;  3CYM A;  2LHT A;  4NWI A;  3AQE A;  2ZIW A;  1HEK A;  2PMZ C;  4O3M A;  2KIC A;  3SAH A;  2MA1 A;  5HR6 A;  4U7C A;  2OXO A;  3RF9 A;  3F5E A;  3PSP A;  2W7O A;  2ZIW B;  1A0P A;  2E5S A;  3VC8 A;  4BUG A;  3N7P D;  4QNL A;  3F2D A;  4KMO B;  2LBO A;  1Q3V A;  1UPH A;  5A0L A;  5HR7 A;  3PSF A;  5KL8 B;  2K89 A;  2KHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...