2KJ5A

Solution nmr structure of a domain from a putative phage integrase protein nmul_a0064 from nitrosospira multiformis, northeast structural genomics consortium target nmr46c
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
116
structure length
116
Chain Sequence
b'MAEKNAYTVAQLADEYFERMIAGRWKHPNIVRSRIEKDIKPAIGSLKVEDVKPRHIDDVLKAVMKRGAPSIANDTLRWLKRMFNYAIKRHIIEYNPAAAFDPGDAGGKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phage integrase
publication title Solution NMR structure of a domain from a putative phage integrase protein Nmul_A0064 from Nitrosospira multiformis, Northeast Structural Genomics Consortium Target NmR46C.
rcsb
source organism Nitrosospira multiformis atcc 25196
molecule tags Structural genomics, unknown function
total genus 36
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kj5A00
3NRWA 2KIWA 2OXOA 1DRGA 1OUQA 1PVRA 4A8EA 2KD1A 1XO0A 1Q3UA 5CRXA 1P7DA 2KOBA 1PVQA 1PVPA 1KBUA 1Q3VA 2HOIA 3C28A 4ACOA 2KHQA 1A0PA 2KKVA 1CRXA 1Z19A 1XNSA 2HOFA 3MGVA 2KHVA 3LYSA 1Z1BA 2KJ9A 1NZBA 1MA7A 3CRXA 2A3VA 2KJ5A 2CRXA 3C29A 2KEYA 2KKPA 2KJ8A 1F44A 4CRXA
chains in the Genus database with same CATH superfamily
2JGAA 3RR7A 5J0WA 3RTVA 1DGSA 4R65A 3TKAA 3K75D 2M9NA 2F2AB 4DSIA 5AIBA 2K4HA 4OJ5A 3MABA 2DPJA 5AI4A 4JWNA 5KFSA 2A1JB 5J2FA 5J2CA 4BXOB 1B4FA 3T5JA 2YMMA 1DK3A 1PK3A 2G0AA 5DDYA 2RDJA 3DDHA 2C28A 3THVA 2HHUA 8ICPA 1SZHA 2F1IA 2E8MA 5J0SA 3KHLA 2C2DA 1ZQRA 2YX8A 4KLTA 8ICFA 4DS5A 4UAUA 4ECUA 2PFPA 4QZDA 2PMZF 2ZIXA 1ZQQA 2KEYA 4I2IA 2WF5A 3MDAA 3N97B 4OJLA 9ICPA 3LK9A 2LKYA 2WAQC 1X6JA 5D49A 8ICYA 1MA7A 3GV8B 1S97A 2PMZC 3D2QA 2CRXA 2LM4A 1V38A 1QQ6A 4UB4A 3F2CA 1BGXT 3MDCA 4EBEA 1PVRA 4IR1A 3HP6A 4DOCA 4PJ0U 3KOOA 2HCFA 7ICMA 2E3TA 4NV0A 2OH2A 3NS1A 1IV8A 1VDVA 1N5WA 1QQ5A 2OCEA 5DBAA 4ELTA 4IR9A 4P2HA 7ICJA 4ECXA 4NXZA 4FS1A 3I76A 1B0XA 3RAQA 2H3VA 1QH9A 4DSEA 3NUQA 5AI0A 5KT3A 5J2IA 2ESEA 3FAHA 1ZQ1C 2HOIA 1ZQAA 3KZIU 3M6ZA 2NV3A 5AKKA 2RRDA 3QU4A 4NJ8A 3MR6A 3BQTA 1SGGA 2FDRA 1RYUA 2EDUA 2NRWA 1CUKA 1B22A 4O9MA 2KSOA 2YMPA 2H3IA 1NK7A 5IIKA 2GOLA 4F93B 3OSPA 4MF8A 2G07A 3RB3A 8ICRA 2KNJA 4KLSA 2UVVA 1ZETA 2EZXA 2K8AA 4BWJA 4JV0A 3WKBA 1L7MA 9ICMA 1ZD2P 5CB1A 1QTMA 2ASLA 1RXWA 3ZD9A 2HBKA 4ECSA 4P4PA 1Z3EB 3AL0B 3Q8RB 2EQYA 5DG8A 3OJUA 3QU7A 4F5QA 4I29A 3I1YA 4OD0A 5DGBA 5ALLA 1U49A 2W9CB 3BQ0A 1F44A 3C23A 2KIWA 3A0BU 3RR8A 2PI4A 4Y2QA 2XCAA 3SI8A 3M7DA 5D46A 2KK0A 1ZRNA 3BQ2A 5C5JA 2BZFA 4YR2A 5ALMA 2XY7A 4KLGA 1ZQEA 8ICXA 3QYPA 4CCHA 4QWDA 3BQ7A 4PZOA 4NL9C 3JPPA 3NASA 4UB2A 2AXTU 1J97A 4M2YA 8ICAA 2G5IB 9ICHA 4BDPA 3RF9A 3EPGA 2XI9A 3F53A 2ZTCA 4R64A 3KHGA 3ALRA 4UB6U 4PZNA 3QXGA 1T7PA 4RQ3A 1LKYB 4GLXA 2W54A 4DF4A 3GZFA 4YVZA 2NRZA 2Y9TA 2BCSA 2PFQA 4DL3A 2NRXA 3ZDBA 4IQVA 4RT3A 5AK5A 1NK5A 2FJ6A 3EWAA 9ICJA 3AMZA 2OXOA 8ICWA 4NWIA 2FPLA 1HIWA 5KFCA 1JROA 3UXPA 3RJHA 2J6UA 4J9RA 4J03A 1MQ2A 2ZIVA 3S6JA 1XSLA 2JR5A 4DWIA 4I2HA 5EE0A 4F72A 3TQ1A 5KFRA 3OGUA 2MAXA 3JPTA 1V85A 1ZXIA 3GV7B 4EZ6A 2OM6A 1UT5A 1L3UA 5EWGA 1NI3A 4HAIA 4QWAA 2IHNA 2RP5A 2E8PA 7ICKA 3MFHA 2YMQA 2VANA 4DOAA 2JZBA 5DQGA 3C21A 2YQEA 3SAFA 1TK8A 4KMUA 1URJA 2VA3A 4I2BA 2C2EA 5JRTA 2XICA 3ISBA 1UA1A 5J0PA 4I2AA 3QUCA 4R66A 4K4HA 4KX3A 4DFMA 4NM1A 1UHUA 2HDOA 1Z00B 3FYHA 3IG5A 3GIIA 1O03A 4QZAA 1O08A 3ISCA 4Y2XA 4Q8FA 3PW0A 4GC6A 3EYZA 5J2AA 8ICJA 3IN5A 4Y2PA 1HUZA 2QARB 3JPOA 4O3OA 2YTUA 4RQ4A 1SXEA 2ASDA 5J2HA 2VKQA 1SV4A 4FS2A 1LV5A 4M9JA 5JUMA 4RZRA 4UB1A 3H0LB 5AI9A 3OSNA 2KE7A 1PZNA 3CP8A 3QUTA 1ZQDA 5F9LA 5ALFA 3DEEA 1SIJA 4O3PA 3AUOA 4EBDA 1RYRA 2QKQA 1SWWA 1KN5A 4PGXA 4JV2A 2Q4TA 5ALIA 4QWCA 3M9NB 1ZRMA 1ZD4A 4XRHA 4JWMA 2E1EA 4BWMA 4DFDA 1S10A 4IRKA 4DL4A 4ED0A 5KT4A 2LBOA 2K60A 2WF9A 3L3FX 1SB3C 2LI6A 4QZIA 3A0HU 5DDMA 4DS4A 5J8YA 9ICFA 4J9SA 2ZJ5A 4DSJA 1VLBA 2W8LA 1ZQKA 1QSSA 4UW9A 3ZDCA 2BDPA 3QUQA 5DG9A 1Z1VA 1NZBA 8ICSA 2FE9A 1UQVA 4EELA 2B6GA 4M9LA 3QZ8A 3SZ2A 1YT3A 5AKLA 4J9KA 4I2DA 4F91B 4QWEA 4NLCA 9ICBA 3TANA 1A0PA 2HBLA 2DQNB 8ICHA 1N60A 3PW2A 1ZQWA 1CI4A 1RDFA 1ZOLA 4PHAA 2WHEA 1SKSA 1QLNA 1ZQCA 1L3SA 1RQLA 1K1QA 4FE3A 4RNOA 5AIAA 4CF5A 3R9KA 2BDUA 5ALEA 5ALTA 5KFNA 2J6SA 8ICIA 1QSLA 1DGJA 1KBUA 1OXJA 2AQ0A 2QB0A 4RUCA 5E79U 2A19A 1S9FA 2KHVA 3T79A 3MGHA 7ICOA 2A3VA 4NL9A 4PL2A 2EANA 2CN1A 1X9XA 1ZQMA 3PX4A 1S0OA 1L7OA 2MU2A 2W7PA 1BNPA 4J9LA 1FIQA 3V7LA 2Y1JA 3RB4A 1XU4A 9ICNA 1S8OA 5KG7A 4IC9A 1RQNA 1NJWA 1L7NA 4O0IA 1NOMA 3CRXA 4KLMA 1S0VA 4M6WB 1NKEA 5GTHU 4C8KA 3IP4B 2MSNA 4ECYA 4XUSA 5TZVA 3BS5B 2ZIUB 2H3QA 2KVSA 4PPXA 5DBCA 4OO1J 4Z6EA 3V7JA 4C8NA 2BHNA 1ZJMA 1JMSA 1HUOA 5DQIA 5KFKA 3TAQA 2M0NA 2ZIWA 4P0PB 4YD2A 2W43A 1SXDA 3Q8QB 3D6JA 4BXOA 5DQHA 2BCVA 5JTIA 3H8JA 4F4KA 3FDSA 4MFAA 5ALOA 3WKCA 5CEHA 1SV0C 2KOBA 1ZQNA 1U9LA 3N28A 1IM4A 5ALDA 3LYSA 4LZGA 3OHBA 5L9XA 9ICKA 4ELUA 5J0TA 1X42A 4YXMA 1KEJA 4F50A 2PKEA 4B9UA 1D8BA 2GLEA 3QU9A 1ZQYA 2Y0SC 2ODGA 5IILA 1FO4A 1DK2A 4G9BA 2NRTA 2MUTA 5AKIA 5EWFA 3RB0A 3PR5B 4O3MA 4I2EA 4XQ8A 1QQ7A 2H3ZA 8ICLA 2QLTA 2FPKA 4DF8A 1A76A 5L1LA 4YMMA 5KFBA 3EPIA 1XC9A 3AQFA 1KSPA 4PL1A 1TAQA 3ICXA 2V4RA 4GXKA 2BPFA 5J0RA 2FMSA 4Z6CA 8ICVA 4US8A 5ALJA 4RQMA 1RM6C 5AI6A 4DFPA 2KJ8A 3RRGA 4JUZA 4ED7A 3QUBA 2OEHA 4JV1A 1P7DA 3ZDDA 2I6XA 3ONNA 2VJ5A 3WU2U 4YQWA 4RPZA 1RXVA 2ZIXB 3KFUF 4DQQA 1COKA 4EYIB 3KBBA 3DV9A 4GFJA 5KFVA 1V97A 5HMLA 4QNLA 2DKZA 1MC8A 3IV6A 4KLDA 4F92B 4QZHA 1WYGA 3H4DA 2ZTDA 2IBKA 4QZEA 5KFUA 9ICRA 9ICSA 1X6IA 4F5NA 1RZTA 2YMLA 2EAOA 3SENA 5KT5A 3GQCA 3H8WA 2JEIA 1TK5A 3UXNA 5BOMA 1N56A 1TE2A 4RNNA 4P4MA 5D4BA 5KFYA 4KLHA 3I28A 3WK5A 4U7CA 3GIKA 8ICKA 1NK8A 4Q43A 2HHTA 5J8YC 4EYHB 4PGQA 4C8LA 4Y2RA 1BPYA 4IS7A 1UA0A 7ICPA 3MR2A 3QNMA 2HOQA 3QZ7A 3ISDA 1QCKA 4UAZA 4NLZA 3AQEA 4FZMA 2UVUA 4QWBA 3UQ0A 5CRXA 1FFUA 4B9SA 5KL8B 9ICVA 3H8SA 4AYBF 4CE6A 5AKEA 4Y2YA 3RRHA 2R8KA 5KNIA 4C4SA 3AEVA 2HSZA 5KFZA 4QZGA 9ICTA 2BKEA 5ALGA 4UAVA 3KHHA 8ICBA 2KSOB 4P0QA 2LYAA 1K1SA 4ED6A 5AM1A 2HHSA 2KIVA 4NLNA 4FFDA 3GILA 8ICUA 9ICQA 4AYBC 3SV4A 3TAPA 1A77A 1X9WA 4Y2UA 3ZDEA 2WFAA 2K4EA 2AU0A 2BR0A 2KVCA 3GIMA 2DFLA 5KFOA 3ETRA 4DEZA 1TV9A 4TUQA 2JEFA 9ICCA 5AHXA 3RAXA 2F1HA 3T5KA 4Q45A 4FO6A 3OJSA 4DFKA 4UASA 1M6YA 4YG2A 3HW8A 4UAYA 1UPHA 4M47A 1NK4A 4ECQA 2P35A 4RQ6A 3BS7A 1KFDA 3PSTA 3NVWA 4BUGA 3D2NA 4F3OA 3PW7A 4QW9A 3RJKA 5ALPA 1U45A 1KRPA 2KFZA 3K4GA 5AM4A 1JRPA 2ZUBA 5L1MA 2D8CA 2BGWA 2BQRA 3NTUA 5J2GA 1T94A 1PK1A 1MQ3A 5KFTA 1L8LA 2F1JA 2DPIA 4LVSA 3ED5A 4RQNA 5J2DA 5EE3A 3U26A 3M8SA 4M9NA 5DG7A 3ZDAA 9ICIA 3PSFA 1AROP 4C7YA 2HVHA 3M8RA 3B0XA 4EX7A 1XO1A 1KDHA 2DKXA 4QW8A 1SKWA 1COOA 8ICZA 1X9MA 3MC1A 1SV0A 4I2GA 3UQ2A 2LYBA 4OJOA 5TISU 1NKBA 3V6HA 4RT2A 1LVHA 1HEKA 3N7SC 4F4ZA 4UBCA 4JMUA 1TK0A 1KQQA 2XGQA 4P4OA 2EAPA 1DRGA 3UPQA 2P6RA 1JXLA 5AKYA 2XO7A 4UATA 4KLOA 3RJFA 2H5XA 2WF7A 1ZQPA 1PVPA 4F2SA 2OWOA 5T14A 2ZIVB 3C28A 4R8UA 4DLEA 3MGVA 4J9QA 2UVRA 3SV3A 2W9BA 2P66A 2F3NA 9ICOA 1U48A 3UM9A 1N48A 3SAHA 3SR6A 4C8MA 2A1AA 8ICGA 2C2RA 3JPRA 4G3IA 3MBYA 3IHQB 5JU5A 5KAFU 5KFDA 2EZZA 2E8NA 4TQSA 2ATLA 3QU5A 1N62A 4Y2JA 2JZBB 1L3TA 3PO5A 2Y1IA 3F2DA 4DO9A 4MEXA 4J9PA 5AM5A 3PY8A 3RH4A 3HX0A 7ICNA 2H3FA 4J9NA 4BJQA 2FLPA 4PHPA 2BCQA 3JPSA 2DF4B 4K4GA 2KZMA 4M9GA 1KKXA 4DQSA 2ZG6A 3BDPA 4F4WA 4F5PA 5KT6A 3WKDA 3SAGA 1D8YA 5KFQA 2KTQA 1ZQTA 4C4TA 4KTQA 5AM2A 1OW5A 4ED1A 4YXJA 2ZJ8A 4RPYA 4YR3A 1KFTA 2AGQA 2IOFA 2XVTA 5ALSA 1N63A 2XC9A 1ZQIA 1CRXA 3C1ZA 5AM0A 4QZCA 4F5RA 3RJJA 5F3XB 1DOQA 4OJPA 4F5OA 3IM1A 3VCBA 5KAIU 2IHMA 4PH5A 4RQ1A 1L3VA 2Y9UA 4O3SA 3PZPA 5J0UA 2RQ5A 5KG1A 4C8OA 2K4IA 4ECTA 1QSYA 4F8RA 2GH1A 1PVQA 5KFPA 2DL0A 7ICUA 2DUYA 1FFVA 3B0YA 2BPCA 1Z1BA 2I1QA 2F8KA 2JXJA 2W55A 3K1RB 3H4BA 3AM9A 1ZQXA 8ICOA 3F5AA 1BPZA 5CHGA 5KFXA 2VJ4A 5AI5A 1PUZA 3EZ5A 3CW2C 1B43A 2AH5A 2NO4A 3OTQA 4C7ZA 4ECWA 3MR5A 2J6TA 3PVXA 4Q44A 5ALKA 2R8JA 4EBCA 3RB6A 1JX4A 4UB3A 2L5YA 1KW4A 5HP4A 2Z7JA 3PX0A 4TQRA 4RU9A 3FC4A 3QEAZ 3BQ1A 3L5KA 2DGZA 5J2KA 4GC7A 5HR6A 4IQUA 2XIDA 2XCPA 5GTIU 4KX5A 3RBEA 3WK8A 1JUDA 4QJFB 1ZQGA 4EEYA 1TAMA 3SEIA 5J29A 3JPQA 4ECZA 5AKJA 9ICUA 1YZ7A 2GWSA 3C2LA 2ZXIA 4YR0A 9ICXA 5KFAA 5HNKA 4CRXA 2HBJA 5KFEA 1D9DA 1Q8KA 5DB8A 7ICIA 3WKAA 3TI0A 4DSFA 2DBYA 3GDXA 4K4IA 4Y2VA 1BVSA 5J0XA 5A0LA 2K8CB 5L1KA 3C29A 4RQ8A 2JRZA 3IG8A 5ALQA 3PMNA 2BQUA 2R8IA 3BZCA 4CF4A 4JK1A 5KG2A 4DSKA 3G6VA 5AICA 5CWRA 1J2MA 2VIXA 5CP2A 2CXYA 4EZ9A 1Q3VA 2QB0B 3GFKB 5HR7A 2KKVA 4QZBA 1RPLA 4I28A 2ZJAA 1NZPA 4UAWA 2XY5A 8ICMA 5B5EU 2FLLA 4CGZA 4F4YA 1TVAA 2A1JA 4DL7A 4UBBA 3PV8A 4ZH4A 1C20A 1WWVA 4KLJA 4UARA 1D8LA 3HRDD 3H8MA 4RUAA 1Z19A 9ICLA 4F4XA 4Q8EA 3ORYA 1JIHA 1WG8A 4IQTA 5HHIA 5KFWA 3PO4A 3WKEA 2JMGA 2WB1F 3JPNA 3MGIA 3ZD8A 4NLGA 2C22A 4Y2SA 2P6UA 4DOBA 2NO5A 2KD1A 1V9PA 5KG5A 5G5GA 3RFAA 5J0OA 4YMOA 4B9NA 1S5LU 3LDAA 2ZIWB 2IOHA 4IRCA 5G5HA 2WB1C 4Z6FA 3E0FA 4RNMA 5J2BA 1FEZA 4YMNA 5EOZA 2WAQF 4ED8A 5HMMA 3M6KA 2KN7A 4NM2A 1ZQLA 4ED3A 2W3RA 2JH1A 3B9JA 4KLIA 7ICVA 1N61A 4YCXA 3M9OB 3NRWA 3NVVA 3QEBZ 4MFCA 1NJYA 8ICCA 2MUTB 2Q0ZX 2FMPA 3LWLA 1L5UA 1JI7A 2F77X 4ICAA 4B9VA 2GO7A 4LJXA 4I2CA 1BNOA 2EAMA 2R18A 4FBUA 1WUDA 3FM9A 2D3DA 3IRUA 3C5GA 3PW5A 1S0MA 4US9A 2HW3A 4HYKA 1NJZA 2AJQA 2V9WA 2I5HA 1SL1A 3ETLA 4DL5A 1N2XA 2PFOA 4B9LA 1AQ6A 3Q8PB 2ZXHA 3HJEA 2KJ5A 2CPRA 5L1IA 2IA6A 2O6KA 1L8OA 2KKPA 5KFGA 1XO0A 2N1RA 1J2NA 2W03A 5DLFA 4B9MA 2FLNA 2LHTA 4U6PA 3UMCA 5ALVA 4NLBA 1U47A 2RLTA 5AKGA 4KLUA 2W04A 1BPEA 1KL9A 9ICEA 5AKXA 1ZQFA 1RYSA 2K4PA 3VC8A 2EH9A 4WJ3B 4KN7A 3WK4A 2MRLA 4BX9C 4RQ5A 3GV5B 2W9CA 5IIMA 4QZ8A 3C5FA 1IG6A 5J2JA 1L7PA 5CA7A 2F8LA 1HJPA 2YY6A 4YP3A 3LWMA 2HVIA 1NK9A 5KG6A 1BPDA 3HILA 2KJ9A 3O0FA 4KLFA 8ICNA 5KFHA 5ALRA 2ALZA 3MFIA 1YZ6A 4CNQA 4DSLA 5KFMA 3TFRA 3V72A 2W9AA 2QB1A 4DL2A 1UT8A 4KLQA 4A8EA 1U4BA 3RBDA 3AU2A 4NY8A 2KZ3A 3EUB2 4RPXA 2W9MA 5ALUA 3Q8LA 4NLKA 4Z6DA 4C0ZA 3SMVA 2NYVA 5KG4A 2R8HA 5DB7A 8ICEA 4TUPA 1JALA 3NVYA 3TADA 2KFNA 5ALXA 3LVWA 5ALYA 3HPOA 2JH7A 1IXRA 3KKAA 4MFFA 2IMWP 3T3FA 2FMQA 2G5HB 2EZYA 3AU6A 3WK9A 1ZQHA 4M9HA 4O3NA 3IDWA 1LKYA 5AKZA 4TURA 1ZQUA 1TFRA 3PMLA 2G08A 5KTQA 2I9GA 2RHFA 3Q8MA 1T3QA 3T5LA 2WTFA 5EE9A 5AM3A 4E0DA 2ZUDA 4PHDA 1KLNA 4QZ9A 4P0QB 3KTQA 4ELVA 2AGPA 3G6YA 1SZPA 1S77D 5AI8A 2LYHA 3C1YA 2R8GA 3QE9Y 2E8OA 2KMDA 2ASJA 4RQ0A 3T5HA 3H0RB 3HWTA 5ALZA 2OHFA 3SD7A 5KG0A 5BPCA 3H7IA 2ISPA 1JN3A 2KV2A 5BOLA 4M0AA 4UB5A 3RJIA 4C80A 5CR0A 3GU3A 4O3QA 2F76X 1OUQA 1SL2A 4EX6A 1ZQVA 4MEYA 3SYZA 2B0CA 7ICQA 3V6JA 3AN1A 1SKRA 1F5SA 1ZQOA 1WCNA 5DBBA 1XSNA 1NKCA 5IIJA 4KLLA 1ECWA 2VA8A 4MHVA 2YB4A 1MN8A 5CJ7A 4DQRA 2MA1A 2AHOB 4YD1A 3C2KA 5HHHA 5DGAA 7ICSA 5AK6A 4O5CA 3V7KA 4JB3A 1NK0A 2HBMA 4IQWA 4O5EA 3QX7A 1PK1B 3E2EA 5B66U 1DXSA 4J9MA 1Q46A 1Z00A 5C0YA 4GIBA 4KMOB 3N7RC 1LB2B 2FPMA 1ZD3A 2HI0A 5KFJA 3CNHA 5L1JA 1Y88A 1WCLA 5J2EA 3L4PA 4GXIA 7ICHA 2OYYA 4FZNA 4ECRA 5AK4A 1BPBA 1T3NA 5EE1A 4DL6A 3H0MB 3QU2A 1X40A 3RJEA 2QARA 3MR3A 3NVZA 3H40A 3BZKA 7ICEA 2E1FA 2JEJA 5ALWA 1ZQJA 2B21A 4F2RA 5KT2A 2BQ3A 2BCRA 5IIIA 3TACB 4ACOA 2ISOA 3RH5A 1RG6A 2D6FC 5J0QA 1SWVA 3KHRA 4FZLA 1K5OA 4USAA 3PSIA 3PSPA 1N5XA 3K1ZA 1H38A 3NGDA 4B9TA 1UCVA 3N7PD 2PXIA 4DCCA 5EWEA 1NK6A 3Q8KA 5KT7A 1WWUA 4R8UB 3BJYA 5KL1B 1Z4NA 3Q8SB 2W8KA 1IIPA 2RDIA 2W9BB 1T4GA 3M1YA 4I27A 5J0YA 5IIOA 4RQ2A 4I2JA 4BGDA 1X2IA 5KFFA 2FI1A 1XWLA 1JXEA 5ALHA 5IINA 5AK3A 3KZXA 2WF8A 1XS9D 4OJ6A 4CDGA 5DLGA 3F5EA 2UVWA 2G09A 3LVVA 4IRDA 3M9MB 2JV3A 1T8EA 1ZD5A 4LZDA 3G6XA 4YFKA 1TKDA 3HT3A 1D9FA 3F2BA 5AKHA 1SL0A 4KLEA 4TUSA 2IOFK 1ZJNA 4F71A 5H2FU 1A6SA 4EENA 1Z4OA 2W7OA 5ALNA 2HHVA 3EW9A 4M04A 3TFSA 4UB8U 2LMRA 1NJXA 4IL6U 4PHEA 7ICLA 3UMBA 4X5VA 2PI5A 4ECVA 2AQ4A 8ICTA 4GXJA 9ICGA 4J9OA 1ED1A 3N4MB 5DB6A 7ICFA 3PW4A 1VJ5A 2KICA 3V6KA 2LM1A 1S76D 2JHDA 4QZFA 3PNCA 2BCUA 4O5KA 1ZQZA 2JEGA 4O3RA 4Y2TA 3UXOA 4CF3A 4DQIA 2WF6A 2KG5A 2XY6A 2E5SA 3OPXA 1L6NA 2HHXA 2HHWA 3PX6A 2HHQA 1C7YA 5KFIA 1MSWD 3PR4A 2DWQA 1BPXA 3TADC 2VA2A 4R63A 2KP7A 1X66A 2PFNA 2K89A 3KKAC 2YB1A 2LPEA 4ZOHC 3ZI4A 4RQ7A 3UMGA 4QIWF 1EXNA 7ICRA 2W3SA 2ZTEA 4M6WA 7ICGA 4OCZA 3BS5A 2ZIUA 4KN4A 2G06A 2ZUCA 2F44A 3GIJA 2HMXA 4DFJA 4MF2A 2KHQA 4AP9A 4DQPA 1XSPA 2HOFA 4QIWC 3CYMA 5FP0A 1GO3F 1KTQA 4P0PA 5DB9A 1F0MA 3D2SA 4YN4A 3RJGA 4ED2A 3WK7A 2YN4A 1Q3UA 5DKWA 2K8BB 2W11A 3OHAA 3J81j 4I2FA 3HKZF 1KFSA 1ZQSA 2AGOA 1XNSA 3NRZA 4B6JA 8ICQA 3C2MA 4UQGA 4PGYA 1ZQBA 2BPGA 2XGPA 5F9NA 4KITB 3RH6A 1TAUA 1S0NA 3E58A 1ZYQA 2ES6A 2KZZA 1X9SA 2NRVA 4DLGA 7ICTA 1CEZA 4XA5A 9ICWA 3HKZC 2V4QA 5KG3A 1NNLA 5K4LA 4C4RA 3KD3A 3WK6A 9ICAA 3SQIA 3TARA 4FBTA 5KFLA 4EEKA 2Y0SF
chains in the Genus database with same CATH topology
2JGAA 2HBJA 2F76X 2MRLA 4P0QA 4BX9C 2LYAA 2ZIUB 2H3QA 1OUQA 3N7PD 3NUQA 2LYBA 2WAQF 4OO1J 4OJOA 1P7DA 2XVTA 2K89A 1ZQ1C 2YB1A 2XICA 2F8LA 3M6KA 3ONNA 2HOIA 2F2AB 4AYBC 2VJ5A 3M6ZA 1CRXA 5KL1B 4KX3A 1HEKA 2K4HA 3N7SC 1IIPA 2NV3A 4OJ5A 3IG5A 2K4EA 2G5IB 2KJ9A 4QIWF 2M0NA 2RRDA 1NZBA 4OJPA 2JH1A 3O0FA 5A0LA 3RF9A 2ZIXB 2ZIWA 4P0PB 4JMUA 2KVCA 1ECWA 2K8CB 3VCBA 3KFUF 2YB4A 2XI9A 3C29A 3F53A 4GFJA 2MA1A 3IG8A 4QNLA 3ALRA 3NRWA 1DRGA 3KZXA 1YT3A 2G0AA 3PZPA 2H3IA 2ZIUA 4A8EA 4OJ6A 2K4IA 4CDGA 2G06A 3F5EA 2VIXA 2KOBA 2GOLA 2HBMA 4NLCA 2G09A 2GH1A 1PVPA 3IN5A 5T14A 2HMXA 2ZIVB 3LVVA 1SZHA 2G07A 2F77X 3C28A 2KHQA 1A0PA 2HBLA 5HR7A 2KKVA 4ICAA 2KNJA 2HOFA 2DQNB 3MGVA 2YX8A 3GZFA 3LYSA 4C0ZA 1Z1BA 3SMVA 4QIWC 3CYMA 3F2BA 2R18A 1WUDA 5C0YA 1GO3F 4KMOB 2VKQA 1UPHA 2PMZF 3N7RC 4CGZA 2ZIXA 3F5AA 4P0PA 1A6SA 2K8AA 2Y0SF 3LVWA 2JH7A 2KEYA 2H3VA 3PSTA 4BUGA 2VJ4A 4FE3A 3D2NA 1D8BA 2W7OA 3D2SA 2Y0SC 2OXOA 3SAHA 3H0LB 4OJLA 2OYYA 4NWIA 2BDUA 1Q3VA 2HBKA 4FZNA 2G5HB 2LKYA 1HIWA 1Q3UA 2K8BB 2WAQC 3CP8A 4U7CA 1KBUA 3HKZF 2ZIVA 3DEEA 3H0MB 1Z19A 1XNSA 2G08A 3AL0B 1T94A 2KHVA 2Z7JA 3T79A 2RHFA 1MA7A 2A3VA 3F2DA 4O3MA 1ED1A 2ZXHA 4PL2A 2PMZC 2HOQA 2KJ5A 2CPRA 3D2QA 2JMGA 2CN1A 2E1FA 2CRXA 2WB1F 2H3ZA 2OM6A 4P0QB 2KKPA 2KICA 1F44A 2H3FA 3F2CA 2KIWA 3AQEA 4FZMA 4BJQA 2DGZA 2Q4TA 2W7PA 4CRXA 2JHDA 1PVRA 2KD1A 1XO0A 5HR6A 5CRXA 2E1EA 2RP5A 2XIDA 2N1RA 3AQFA 3M7DA 3PSFA 4KX5A 3HKZC 2W03A 2DF4B 3H0RB 4NV0A 5KL8B 4ACOA 4QJFB 4AYBF 2OH2A 2D6FC 3RFAA 2LHTA 4PL1A 4U6PA 1TAMA 3ICXA 4IC9A 4NLBA 2LBOA 4FZLA 2ZIWB 2ZG6A 2E5SA 3OPXA 3CRXA 1L6NA 3SQIA 3PSIA 2KV2A 3SAGA 3L3FX 3PSPA 1PVQA 2W04A 2WB1C 2ZXIA 3IP4B 3K1ZA 3SAFA 4WJ3B 3E0FA 3VC8A 2KJ8A 3GU3A 1URJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRW A;  2KIW A;  2OXO A;  1DRG A;  1OUQ A;  1PVR A;  4A8E A;  2KD1 A;  1XO0 A;  1Q3U A;  5CRX A;  1P7D A;  2KOB A;  1PVQ A;  1PVP A;  1KBU A;  1Q3V A;  2HOI A;  3C28 A;  4ACO A;  2KHQ A;  1A0P A;  2KKV A;  1CRX A;  1Z19 A;  1XNS A;  2HOF A;  3MGV A;  2KHV A;  3LYS A;  1Z1B A;  2KJ9 A;  1NZB A;  1MA7 A;  3CRX A;  2A3V A;  2KJ5 A;  2CRX A;  3C29 A;  2KEY A;  2KKP A;  2KJ8 A;  1F44 A;  4CRX A; 
#chains in the Genus database with same CATH topology
 2JGA A;  3RR7 A;  5J0W A;  3RTV A;  1DGS A;  4R65 A;  3TKA A;  3K75 D;  2M9N A;  2F2A B;  4DSI A;  5AIB A;  2K4H A;  4OJ5 A;  3MAB A;  2DPJ A;  5AI4 A;  4JWN A;  5KFS A;  2A1J B;  5J2F A;  5J2C A;  4BXO B;  1B4F A;  3T5J A;  2YMM A;  1DK3 A;  1PK3 A;  2G0A A;  5DDY A;  2RDJ A;  3DDH A;  2C28 A;  3THV A;  2HHU A;  8ICP A;  1SZH A;  2F1I A;  2E8M A;  5J0S A;  3KHL A;  2C2D A;  1ZQR A;  2YX8 A;  4KLT A;  8ICF A;  4DS5 A;  4UAU A;  4ECU A;  2PFP A;  4QZD A;  2PMZ F;  2ZIX A;  1ZQQ A;  2KEY A;  4I2I A;  2WF5 A;  3MDA A;  3N97 B;  4OJL A;  9ICP A;  3LK9 A;  2LKY A;  2WAQ C;  1X6J A;  5D49 A;  8ICY A;  1MA7 A;  3GV8 B;  1S97 A;  2PMZ C;  3D2Q A;  2CRX A;  2LM4 A;  1V38 A;  1QQ6 A;  4UB4 A;  3F2C A;  1BGX T;  3MDC A;  4EBE A;  1PVR A;  4IR1 A;  3HP6 A;  4DOC A;  4PJ0 U;  3KOO A;  2HCF A;  7ICM A;  2E3T A;  4NV0 A;  2OH2 A;  3NS1 A;  1IV8 A;  1VDV A;  1N5W A;  1QQ5 A;  2OCE A;  5DBA A;  4ELT A;  4IR9 A;  4P2H A;  7ICJ A;  4ECX A;  4NXZ A;  4FS1 A;  3I76 A;  1B0X A;  3RAQ A;  2H3V A;  1QH9 A;  4DSE A;  3NUQ A;  5AI0 A;  5KT3 A;  5J2I A;  2ESE A;  3FAH A;  1ZQ1 C;  2HOI A;  1ZQA A;  3KZI U;  3M6Z A;  2NV3 A;  5AKK A;  2RRD A;  3QU4 A;  4NJ8 A;  3MR6 A;  3BQT A;  1SGG A;  2FDR A;  1RYU A;  2EDU A;  2NRW A;  1CUK A;  1B22 A;  4O9M A;  2KSO A;  2YMP A;  2H3I A;  1NK7 A;  5IIK A;  2GOL A;  4F93 B;  3OSP A;  4MF8 A;  2G07 A;  3RB3 A;  8ICR A;  2KNJ A;  4KLS A;  2UVV A;  1ZET A;  2EZX A;  2K8A A;  4BWJ A;  4JV0 A;  3WKB A;  1L7M A;  9ICM A;  1ZD2 P;  5CB1 A;  1QTM A;  2ASL A;  1RXW A;  3ZD9 A;  2HBK A;  4ECS A;  4P4P A;  1Z3E B;  3AL0 B;  3Q8R B;  2EQY A;  5DG8 A;  3OJU A;  3QU7 A;  4F5Q A;  4I29 A;  3I1Y A;  4OD0 A;  5DGB A;  5ALL A;  1U49 A;  2W9C B;  3BQ0 A;  1F44 A;  3C23 A;  2KIW A;  3A0B U;  3RR8 A;  2PI4 A;  4Y2Q A;  2XCA A;  3SI8 A;  3M7D A;  5D46 A;  2KK0 A;  1ZRN A;  3BQ2 A;  5C5J A;  2BZF A;  4YR2 A;  5ALM A;  2XY7 A;  4KLG A;  1ZQE A;  8ICX A;  3QYP A;  4CCH A;  4QWD A;  3BQ7 A;  4PZO A;  4NL9 C;  3JPP A;  3NAS A;  4UB2 A;  2AXT U;  1J97 A;  4M2Y A;  8ICA A;  2G5I B;  9ICH A;  4BDP A;  3RF9 A;  3EPG A;  2XI9 A;  3F53 A;  2ZTC A;  4R64 A;  3KHG A;  3ALR A;  4UB6 U;  4PZN A;  3QXG A;  1T7P A;  4RQ3 A;  1LKY B;  4GLX A;  2W54 A;  4DF4 A;  3GZF A;  4YVZ A;  2NRZ A;  2Y9T A;  2BCS A;  2PFQ A;  4DL3 A;  2NRX A;  3ZDB A;  4IQV A;  4RT3 A;  5AK5 A;  1NK5 A;  2FJ6 A;  3EWA A;  9ICJ A;  3AMZ A;  2OXO A;  8ICW A;  4NWI A;  2FPL A;  1HIW A;  5KFC A;  1JRO A;  3UXP A;  3RJH A;  2J6U A;  4J9R A;  4J03 A;  1MQ2 A;  2ZIV A;  3S6J A;  1XSL A;  2JR5 A;  4DWI A;  4I2H A;  5EE0 A;  4F72 A;  3TQ1 A;  5KFR A;  3OGU A;  2MAX A;  3JPT A;  1V85 A;  1ZXI A;  3GV7 B;  4EZ6 A;  2OM6 A;  1UT5 A;  1L3U A;  5EWG A;  1NI3 A;  4HAI A;  4QWA A;  2IHN A;  2RP5 A;  2E8P A;  7ICK A;  3MFH A;  2YMQ A;  2VAN A;  4DOA A;  2JZB A;  5DQG A;  3C21 A;  2YQE A;  3SAF A;  1TK8 A;  4KMU A;  1URJ A;  2VA3 A;  4I2B A;  2C2E A;  5JRT A;  2XIC A;  3ISB A;  1UA1 A;  5J0P A;  4I2A A;  3QUC A;  4R66 A;  4K4H A;  4KX3 A;  4DFM A;  4NM1 A;  1UHU A;  2HDO A;  1Z00 B;  3FYH A;  3IG5 A;  3GII A;  1O03 A;  4QZA A;  1O08 A;  3ISC A;  4Y2X A;  4Q8F A;  3PW0 A;  4GC6 A;  3EYZ A;  5J2A A;  8ICJ A;  3IN5 A;  4Y2P A;  1HUZ A;  2QAR B;  3JPO A;  4O3O A;  2YTU A;  4RQ4 A;  1SXE A;  2ASD A;  5J2H A;  2VKQ A;  1SV4 A;  4FS2 A;  1LV5 A;  4M9J A;  5JUM A;  4RZR A;  4UB1 A;  3H0L B;  5AI9 A;  3OSN A;  2KE7 A;  1PZN A;  3CP8 A;  3QUT A;  1ZQD A;  5F9L A;  5ALF A;  3DEE A;  1SIJ A;  4O3P A;  3AUO A;  4EBD A;  1RYR A;  2QKQ A;  1SWW A;  1KN5 A;  4PGX A;  4JV2 A;  2Q4T A;  5ALI A;  4QWC A;  3M9N B;  1ZRM A;  1ZD4 A;  4XRH A;  4JWM A;  2E1E A;  4BWM A;  4DFD A;  1S10 A;  4IRK A;  4DL4 A;  4ED0 A;  5KT4 A;  2LBO A;  2K60 A;  2WF9 A;  3L3F X;  1SB3 C;  2LI6 A;  4QZI A;  3A0H U;  5DDM A;  4DS4 A;  5J8Y A;  9ICF A;  4J9S A;  2ZJ5 A;  4DSJ A;  1VLB A;  2W8L A;  1ZQK A;  1QSS A;  4UW9 A;  3ZDC A;  2BDP A;  3QUQ A;  5DG9 A;  1Z1V A;  1NZB A;  8ICS A;  2FE9 A;  1UQV A;  4EEL A;  2B6G A;  4M9L A;  3QZ8 A;  3SZ2 A;  1YT3 A;  5AKL A;  4J9K A;  4I2D A;  4F91 B;  4QWE A;  4NLC A;  9ICB A;  3TAN A;  1A0P A;  2HBL A;  2DQN B;  8ICH A;  1N60 A;  3PW2 A;  1ZQW A;  1CI4 A;  1RDF A;  1ZOL A;  4PHA A;  2WHE A;  1SKS A;  1QLN A;  1ZQC A;  1L3S A;  1RQL A;  1K1Q A;  4FE3 A;  4RNO A;  5AIA A;  4CF5 A;  3R9K A;  2BDU A;  5ALE A;  5ALT A;  5KFN A;  2J6S A;  8ICI A;  1QSL A;  1DGJ A;  1KBU A;  1OXJ A;  2AQ0 A;  2QB0 A;  4RUC A;  5E79 U;  2A19 A;  1S9F A;  2KHV A;  3T79 A;  3MGH A;  7ICO A;  2A3V A;  4NL9 A;  4PL2 A;  2EAN A;  2CN1 A;  1X9X A;  1ZQM A;  3PX4 A;  1S0O A;  1L7O A;  2MU2 A;  2W7P A;  1BNP A;  4J9L A;  1FIQ A;  3V7L A;  2Y1J A;  3RB4 A;  1XU4 A;  9ICN A;  1S8O A;  5KG7 A;  4IC9 A;  1RQN A;  1NJW A;  1L7N A;  4O0I A;  1NOM A;  3CRX A;  4KLM A;  1S0V A;  4M6W B;  1NKE A;  5GTH U;  4C8K A;  3IP4 B;  2MSN A;  4ECY A;  4XUS A;  5TZV A;  3BS5 B;  2ZIU B;  2H3Q A;  2KVS A;  4PPX A;  5DBC A;  4OO1 J;  4Z6E A;  3V7J A;  4C8N A;  2BHN A;  1ZJM A;  1JMS A;  1HUO A;  5DQI A;  5KFK A;  3TAQ A;  2M0N A;  2ZIW A;  4P0P B;  4YD2 A;  2W43 A;  1SXD A;  3Q8Q B;  3D6J A;  4BXO A;  5DQH A;  2BCV A;  5JTI A;  3H8J A;  4F4K A;  3FDS A;  4MFA A;  5ALO A;  3WKC A;  5CEH A;  1SV0 C;  2KOB A;  1ZQN A;  1U9L A;  3N28 A;  1IM4 A;  5ALD A;  3LYS A;  4LZG A;  3OHB A;  5L9X A;  9ICK A;  4ELU A;  5J0T A;  1X42 A;  4YXM A;  1KEJ A;  4F50 A;  2PKE A;  4B9U A;  1D8B A;  2GLE A;  3QU9 A;  1ZQY A;  2Y0S C;  2ODG A;  5IIL A;  1FO4 A;  1DK2 A;  4G9B A;  2NRT A;  2MUT A;  5AKI A;  5EWF A;  3RB0 A;  3PR5 B;  4O3M A;  4I2E A;  4XQ8 A;  1QQ7 A;  2H3Z A;  8ICL A;  2QLT A;  2FPK A;  4DF8 A;  1A76 A;  5L1L A;  4YMM A;  5KFB A;  3EPI A;  1XC9 A;  3AQF A;  1KSP A;  4PL1 A;  1TAQ A;  3ICX A;  2V4R A;  4GXK A;  2BPF A;  5J0R A;  2FMS A;  4Z6C A;  8ICV A;  4US8 A;  5ALJ A;  4RQM A;  1RM6 C;  5AI6 A;  4DFP A;  2KJ8 A;  3RRG A;  4JUZ A;  4ED7 A;  3QUB A;  2OEH A;  4JV1 A;  1P7D A;  3ZDD A;  2I6X A;  3ONN A;  2VJ5 A;  3WU2 U;  4YQW A;  4RPZ A;  1RXV A;  2ZIX B;  3KFU F;  4DQQ A;  1COK A;  4EYI B;  3KBB A;  3DV9 A;  4GFJ A;  5KFV A;  1V97 A;  5HML A;  4QNL A;  2DKZ A;  1MC8 A;  3IV6 A;  4KLD A;  4F92 B;  4QZH A;  1WYG A;  3H4D A;  2ZTD A;  2IBK A;  4QZE A;  5KFU A;  9ICR A;  9ICS A;  1X6I A;  4F5N A;  1RZT A;  2YML A;  2EAO A;  3SEN A;  5KT5 A;  3GQC A;  3H8W A;  2JEI A;  1TK5 A;  3UXN A;  5BOM A;  1N56 A;  1TE2 A;  4RNN A;  4P4M A;  5D4B A;  5KFY A;  4KLH A;  3I28 A;  3WK5 A;  4U7C A;  3GIK A;  8ICK A;  1NK8 A;  4Q43 A;  2HHT A;  5J8Y C;  4EYH B;  4PGQ A;  4C8L A;  4Y2R A;  1BPY A;  4IS7 A;  1UA0 A;  7ICP A;  3MR2 A;  3QNM A;  2HOQ A;  3QZ7 A;  3ISD A;  1QCK A;  4UAZ A;  4NLZ A;  3AQE A;  4FZM A;  2UVU A;  4QWB A;  3UQ0 A;  5CRX A;  1FFU A;  4B9S A;  5KL8 B;  9ICV A;  3H8S A;  4AYB F;  4CE6 A;  5AKE A;  4Y2Y A;  3RRH A;  2R8K A;  5KNI A;  4C4S A;  3AEV A;  2HSZ A;  5KFZ A;  4QZG A;  9ICT A;  2BKE A;  5ALG A;  4UAV A;  3KHH A;  8ICB A;  2KSO B;  4P0Q A;  2LYA A;  1K1S A;  4ED6 A;  5AM1 A;  2HHS A;  2KIV A;  4NLN A;  4FFD A;  3GIL A;  8ICU A;  9ICQ A;  4AYB C;  3SV4 A;  3TAP A;  1A77 A;  1X9W A;  4Y2U A;  3ZDE A;  2WFA A;  2K4E A;  2AU0 A;  2BR0 A;  2KVC A;  3GIM A;  2DFL A;  5KFO A;  3ETR A;  4DEZ A;  1TV9 A;  4TUQ A;  2JEF A;  9ICC A;  5AHX A;  3RAX A;  2F1H A;  3T5K A;  4Q45 A;  4FO6 A;  3OJS A;  4DFK A;  4UAS A;  1M6Y A;  4YG2 A;  3HW8 A;  4UAY A;  1UPH A;  4M47 A;  1NK4 A;  4ECQ A;  2P35 A;  4RQ6 A;  3BS7 A;  1KFD A;  3PST A;  3NVW A;  4BUG A;  3D2N A;  4F3O A;  3PW7 A;  4QW9 A;  3RJK A;  5ALP A;  1U45 A;  1KRP A;  2KFZ A;  3K4G A;  5AM4 A;  1JRP A;  2ZUB A;  5L1M A;  2D8C A;  2BGW A;  2BQR A;  3NTU A;  5J2G A;  1T94 A;  1PK1 A;  1MQ3 A;  5KFT A;  1L8L A;  2F1J A;  2DPI A;  4LVS A;  3ED5 A;  4RQN A;  5J2D A;  5EE3 A;  3U26 A;  3M8S A;  4M9N A;  5DG7 A;  3ZDA A;  9ICI A;  3PSF A;  1ARO P;  4C7Y A;  2HVH A;  3M8R A;  3B0X A;  4EX7 A;  1XO1 A;  1KDH A;  2DKX A;  4QW8 A;  1SKW A;  1COO A;  8ICZ A;  1X9M A;  3MC1 A;  1SV0 A;  4I2G A;  3UQ2 A;  2LYB A;  4OJO A;  5TIS U;  1NKB A;  3V6H A;  4RT2 A;  1LVH A;  1HEK A;  3N7S C;  4F4Z A;  4UBC A;  4JMU A;  1TK0 A;  1KQQ A;  2XGQ A;  4P4O A;  2EAP A;  1DRG A;  3UPQ A;  2P6R A;  1JXL A;  5AKY A;  2XO7 A;  4UAT A;  4KLO A;  3RJF A;  2H5X A;  2WF7 A;  1ZQP A;  1PVP A;  4F2S A;  2OWO A;  5T14 A;  2ZIV B;  3C28 A;  4R8U A;  4DLE A;  3MGV A;  4J9Q A;  2UVR A;  3SV3 A;  2W9B A;  2P66 A;  2F3N A;  9ICO A;  1U48 A;  3UM9 A;  1N48 A;  3SAH A;  3SR6 A;  4C8M A;  2A1A A;  8ICG A;  2C2R A;  3JPR A;  4G3I A;  3MBY A;  3IHQ B;  5JU5 A;  5KAF U;  5KFD A;  2EZZ A;  2E8N A;  4TQS A;  2ATL A;  3QU5 A;  1N62 A;  4Y2J A;  2JZB B;  1L3T A;  3PO5 A;  2Y1I A;  3F2D A;  4DO9 A;  4MEX A;  4J9P A;  5AM5 A;  3PY8 A;  3RH4 A;  3HX0 A;  7ICN A;  2H3F A;  4J9N A;  4BJQ A;  2FLP A;  4PHP A;  2BCQ A;  3JPS A;  2DF4 B;  4K4G A;  2KZM A;  4M9G A;  1KKX A;  4DQS A;  2ZG6 A;  3BDP A;  4F4W A;  4F5P A;  5KT6 A;  3WKD A;  3SAG A;  1D8Y A;  5KFQ A;  2KTQ A;  1ZQT A;  4C4T A;  4KTQ A;  5AM2 A;  1OW5 A;  4ED1 A;  4YXJ A;  2ZJ8 A;  4RPY A;  4YR3 A;  1KFT A;  2AGQ A;  2IOF A;  2XVT A;  5ALS A;  1N63 A;  2XC9 A;  1ZQI A;  1CRX A;  3C1Z A;  5AM0 A;  4QZC A;  4F5R A;  3RJJ A;  5F3X B;  1DOQ A;  4OJP A;  4F5O A;  3IM1 A;  3VCB A;  5KAI U;  2IHM A;  4PH5 A;  4RQ1 A;  1L3V A;  2Y9U A;  4O3S A;  3PZP A;  5J0U A;  2RQ5 A;  5KG1 A;  4C8O A;  2K4I A;  4ECT A;  1QSY A;  4F8R A;  2GH1 A;  1PVQ A;  5KFP A;  2DL0 A;  7ICU A;  2DUY A;  1FFV A;  3B0Y A;  2BPC A;  1Z1B A;  2I1Q A;  2F8K A;  2JXJ A;  2W55 A;  3K1R B;  3H4B A;  3AM9 A;  1ZQX A;  8ICO A;  3F5A A;  1BPZ A;  5CHG A;  5KFX A;  2VJ4 A;  5AI5 A;  1PUZ A;  3EZ5 A;  3CW2 C;  1B43 A;  2AH5 A;  2NO4 A;  3OTQ A;  4C7Z A;  4ECW A;  3MR5 A;  2J6T A;  3PVX A;  4Q44 A;  5ALK A;  2R8J A;  4EBC A;  3RB6 A;  1JX4 A;  4UB3 A;  2L5Y A;  1KW4 A;  5HP4 A;  2Z7J A;  3PX0 A;  4TQR A;  4RU9 A;  3FC4 A;  3QEA Z;  3BQ1 A;  3L5K A;  2DGZ A;  5J2K A;  4GC7 A;  5HR6 A;  4IQU A;  2XID A;  2XCP A;  5GTI U;  4KX5 A;  3RBE A;  3WK8 A;  1JUD A;  4QJF B;  1ZQG A;  4EEY A;  1TAM A;  3SEI A;  5J29 A;  3JPQ A;  4ECZ A;  5AKJ A;  9ICU A;  1YZ7 A;  2GWS A;  3C2L A;  2ZXI A;  4YR0 A;  9ICX A;  5KFA A;  5HNK A;  4CRX A;  2HBJ A;  5KFE A;  1D9D A;  1Q8K A;  5DB8 A;  7ICI A;  3WKA A;  3TI0 A;  4DSF A;  2DBY A;  3GDX A;  4K4I A;  4Y2V A;  1BVS A;  5J0X A;  5A0L A;  2K8C B;  5L1K A;  3C29 A;  4RQ8 A;  2JRZ A;  3IG8 A;  5ALQ A;  3PMN A;  2BQU A;  2R8I A;  3BZC A;  4CF4 A;  4JK1 A;  5KG2 A;  4DSK A;  3G6V A;  5AIC A;  5CWR A;  1J2M A;  2VIX A;  5CP2 A;  2CXY A;  4EZ9 A;  1Q3V A;  2QB0 B;  3GFK B;  5HR7 A;  2KKV A;  4QZB A;  1RPL A;  4I28 A;  2ZJA A;  1NZP A;  4UAW A;  2XY5 A;  8ICM A;  5B5E U;  2FLL A;  4CGZ A;  4F4Y A;  1TVA A;  2A1J A;  4DL7 A;  4UBB A;  3PV8 A;  4ZH4 A;  1C20 A;  1WWV A;  4KLJ A;  4UAR A;  1D8L A;  3HRD D;  3H8M A;  4RUA A;  1Z19 A;  9ICL A;  4F4X A;  4Q8E A;  3ORY A;  1JIH A;  1WG8 A;  4IQT A;  5HHI A;  5KFW A;  3PO4 A;  3WKE A;  2JMG A;  2WB1 F;  3JPN A;  3MGI A;  3ZD8 A;  4NLG A;  2C22 A;  4Y2S A;  2P6U A;  4DOB A;  2NO5 A;  2KD1 A;  1V9P A;  5KG5 A;  5G5G A;  3RFA A;  5J0O A;  4YMO A;  4B9N A;  1S5L U;  3LDA A;  2ZIW B;  2IOH A;  4IRC A;  5G5H A;  2WB1 C;  4Z6F A;  3E0F A;  4RNM A;  5J2B A;  1FEZ A;  4YMN A;  5EOZ A;  2WAQ F;  4ED8 A;  5HMM A;  3M6K A;  2KN7 A;  4NM2 A;  1ZQL A;  4ED3 A;  2W3R A;  2JH1 A;  3B9J A;  4KLI A;  7ICV A;  1N61 A;  4YCX A;  3M9O B;  3NRW A;  3NVV A;  3QEB Z;  4MFC A;  1NJY A;  8ICC A;  2MUT B;  2Q0Z X;  2FMP A;  3LWL A;  1L5U A;  1JI7 A;  2F77 X;  4ICA A;  4B9V A;  2GO7 A;  4LJX A;  4I2C A;  1BNO A;  2EAM A;  2R18 A;  4FBU A;  1WUD A;  3FM9 A;  2D3D A;  3IRU A;  3C5G A;  3PW5 A;  1S0M A;  4US9 A;  2HW3 A;  4HYK A;  1NJZ A;  2AJQ A;  2V9W A;  2I5H A;  1SL1 A;  3ETL A;  4DL5 A;  1N2X A;  2PFO A;  4B9L A;  1AQ6 A;  3Q8P B;  2ZXH A;  3HJE A;  2KJ5 A;  2CPR A;  5L1I A;  2IA6 A;  2O6K A;  1L8O A;  2KKP A;  5KFG A;  1XO0 A;  2N1R A;  1J2N A;  2W03 A;  5DLF A;  4B9M A;  2FLN A;  2LHT A;  4U6P A;  3UMC A;  5ALV A;  4NLB A;  1U47 A;  2RLT A;  5AKG A;  4KLU A;  2W04 A;  1BPE A;  1KL9 A;  9ICE A;  5AKX A;  1ZQF A;  1RYS A;  2K4P A;  3VC8 A;  2EH9 A;  4WJ3 B;  4KN7 A;  3WK4 A;  2MRL A;  4BX9 C;  4RQ5 A;  3GV5 B;  2W9C A;  5IIM A;  4QZ8 A;  3C5F A;  1IG6 A;  5J2J A;  1L7P A;  5CA7 A;  2F8L A;  1HJP A;  2YY6 A;  4YP3 A;  3LWM A;  2HVI A;  1NK9 A;  5KG6 A;  1BPD A;  3HIL A;  2KJ9 A;  3O0F A;  4KLF A;  8ICN A;  5KFH A;  5ALR A;  2ALZ A;  3MFI A;  1YZ6 A;  4CNQ A;  4DSL A;  5KFM A;  3TFR A;  3V72 A;  2W9A A;  2QB1 A;  4DL2 A;  1UT8 A;  4KLQ A;  4A8E A;  1U4B A;  3RBD A;  3AU2 A;  4NY8 A;  2KZ3 A;  3EUB 2;  4RPX A;  2W9M A;  5ALU A;  3Q8L A;  4NLK A;  4Z6D A;  4C0Z A;  3SMV A;  2NYV A;  5KG4 A;  2R8H A;  5DB7 A;  8ICE A;  4TUP A;  1JAL A;  3NVY A;  3TAD A;  2KFN A;  5ALX A;  3LVW A;  5ALY A;  3HPO A;  2JH7 A;  1IXR A;  3KKA A;  4MFF A;  2IMW P;  3T3F A;  2FMQ A;  2G5H B;  2EZY A;  3AU6 A;  3WK9 A;  1ZQH A;  4M9H A;  4O3N A;  3IDW A;  1LKY A;  5AKZ A;  4TUR A;  1ZQU A;  1TFR A;  3PML A;  2G08 A;  5KTQ A;  2I9G A;  2RHF A;  3Q8M A;  1T3Q A;  3T5L A;  2WTF A;  5EE9 A;  5AM3 A;  4E0D A;  2ZUD A;  4PHD A;  1KLN A;  4QZ9 A;  4P0Q B;  3KTQ A;  4ELV A;  2AGP A;  3G6Y A;  1SZP A;  1S77 D;  5AI8 A;  2LYH A;  3C1Y A;  2R8G A;  3QE9 Y;  2E8O A;  2KMD A;  2ASJ A;  4RQ0 A;  3T5H A;  3H0R B;  3HWT A;  5ALZ A;  2OHF A;  3SD7 A;  5KG0 A;  5BPC A;  3H7I A;  2ISP A;  1JN3 A;  2KV2 A;  5BOL A;  4M0A A;  4UB5 A;  3RJI A;  4C80 A;  5CR0 A;  3GU3 A;  4O3Q A;  2F76 X;  1OUQ A;  1SL2 A;  4EX6 A;  1ZQV A;  4MEY A;  3SYZ A;  2B0C A;  7ICQ A;  3V6J A;  3AN1 A;  1SKR A;  1F5S A;  1ZQO A;  1WCN A;  5DBB A;  1XSN A;  1NKC A;  5IIJ A;  4KLL A;  1ECW A;  2VA8 A;  4MHV A;  2YB4 A;  1MN8 A;  5CJ7 A;  4DQR A;  2MA1 A;  2AHO B;  4YD1 A;  3C2K A;  5HHH A;  5DGA A;  7ICS A;  5AK6 A;  4O5C A;  3V7K A;  4JB3 A;  1NK0 A;  2HBM A;  4IQW A;  4O5E A;  3QX7 A;  1PK1 B;  3E2E A;  5B66 U;  1DXS A;  4J9M A;  1Q46 A;  1Z00 A;  5C0Y A;  4GIB A;  4KMO B;  3N7R C;  1LB2 B;  2FPM A;  1ZD3 A;  2HI0 A;  5KFJ A;  3CNH A;  5L1J A;  1Y88 A;  1WCL A;  5J2E A;  3L4P A;  4GXI A;  7ICH A;  2OYY A;  4FZN A;  4ECR A;  5AK4 A;  1BPB A;  1T3N A;  5EE1 A;  4DL6 A;  3H0M B;  3QU2 A;  1X40 A;  3RJE A;  2QAR A;  3MR3 A;  3NVZ A;  3H40 A;  3BZK A;  7ICE A;  2E1F A;  2JEJ A;  5ALW A;  1ZQJ A;  2B21 A;  4F2R A;  5KT2 A;  2BQ3 A;  2BCR A;  5III A;  3TAC B;  4ACO A;  2ISO A;  3RH5 A;  1RG6 A;  2D6F C;  5J0Q A;  1SWV A;  3KHR A;  4FZL A;  1K5O A;  4USA A;  3PSI A;  3PSP A;  1N5X A;  3K1Z A;  1H38 A;  3NGD A;  4B9T A;  1UCV A;  3N7P D;  2PXI A;  4DCC A;  5EWE A;  1NK6 A;  3Q8K A;  5KT7 A;  1WWU A;  4R8U B;  3BJY A;  5KL1 B;  1Z4N A;  3Q8S B;  2W8K A;  1IIP A;  2RDI A;  2W9B B;  1T4G A;  3M1Y A;  4I27 A;  5J0Y A;  5IIO A;  4RQ2 A;  4I2J A;  4BGD A;  1X2I A;  5KFF A;  2FI1 A;  1XWL A;  1JXE A;  5ALH A;  5IIN A;  5AK3 A;  3KZX A;  2WF8 A;  1XS9 D;  4OJ6 A;  4CDG A;  5DLG A;  3F5E A;  2UVW A;  2G09 A;  3LVV A;  4IRD A;  3M9M B;  2JV3 A;  1T8E A;  1ZD5 A;  4LZD A;  3G6X A;  4YFK A;  1TKD A;  3HT3 A;  1D9F A;  3F2B A;  5AKH A;  1SL0 A;  4KLE A;  4TUS A;  2IOF K;  1ZJN A;  4F71 A;  5H2F U;  1A6S A;  4EEN A;  1Z4O A;  2W7O A;  5ALN A;  2HHV A;  3EW9 A;  4M04 A;  3TFS A;  4UB8 U;  2LMR A;  1NJX A;  4IL6 U;  4PHE A;  7ICL A;  3UMB A;  4X5V A;  2PI5 A;  4ECV A;  2AQ4 A;  8ICT A;  4GXJ A;  9ICG A;  4J9O A;  1ED1 A;  3N4M B;  5DB6 A;  7ICF A;  3PW4 A;  1VJ5 A;  2KIC A;  3V6K A;  2LM1 A;  1S76 D;  2JHD A;  4QZF A;  3PNC A;  2BCU A;  4O5K A;  1ZQZ A;  2JEG A;  4O3R A;  4Y2T A;  3UXO A;  4CF3 A;  4DQI A;  2WF6 A;  2KG5 A;  2XY6 A;  2E5S A;  3OPX A;  1L6N A;  2HHX A;  2HHW A;  3PX6 A;  2HHQ A;  1C7Y A;  5KFI A;  1MSW D;  3PR4 A;  2DWQ A;  1BPX A;  3TAD C;  2VA2 A;  4R63 A;  2KP7 A;  1X66 A;  2PFN A;  2K89 A;  3KKA C;  2YB1 A;  2LPE A;  4ZOH C;  3ZI4 A;  4RQ7 A;  3UMG A;  4QIW F;  1EXN A;  7ICR A;  2W3S A;  2ZTE A;  4M6W A;  7ICG A;  4OCZ A;  3BS5 A;  2ZIU A;  4KN4 A;  2G06 A;  2ZUC A;  2F44 A;  3GIJ A;  2HMX A;  4DFJ A;  4MF2 A;  2KHQ A;  4AP9 A;  4DQP A;  1XSP A;  2HOF A;  4QIW C;  3CYM A;  5FP0 A;  1GO3 F;  1KTQ A;  4P0P A;  5DB9 A;  1F0M A;  3D2S A;  4YN4 A;  3RJG A;  4ED2 A;  3WK7 A;  2YN4 A;  1Q3U A;  5DKW A;  2K8B B;  2W11 A;  3OHA A;  3J81 j;  4I2F A;  3HKZ F;  1KFS A;  1ZQS A;  2AGO A;  1XNS A;  3NRZ A;  4B6J A;  8ICQ A;  3C2M A;  4UQG A;  4PGY A;  1ZQB A;  2BPG A;  2XGP A;  5F9N A;  4KIT B;  3RH6 A;  1TAU A;  1S0N A;  3E58 A;  1ZYQ A;  2ES6 A;  2KZZ A;  1X9S A;  2NRV A;  4DLG A;  7ICT A;  1CEZ A;  4XA5 A;  9ICW A;  3HKZ C;  2V4Q A;  5KG3 A;  1NNL A;  5K4L A;  4C4R A;  3KD3 A;  3WK6 A;  9ICA A;  3SQI A;  3TAR A;  4FBT A;  5KFL A;  4EEK A;  2Y0S F; 
#chains in the Genus database with same CATH homology
 2JGA A;  2HBJ A;  2F76 X;  2MRL A;  4P0Q A;  4BX9 C;  2LYA A;  2ZIU B;  2H3Q A;  1OUQ A;  3N7P D;  3NUQ A;  2LYB A;  2WAQ F;  4OO1 J;  4OJO A;  1P7D A;  2XVT A;  2K89 A;  1ZQ1 C;  2YB1 A;  2XIC A;  2F8L A;  3M6K A;  3ONN A;  2HOI A;  2F2A B;  4AYB C;  2VJ5 A;  3M6Z A;  1CRX A;  5KL1 B;  4KX3 A;  1HEK A;  2K4H A;  3N7S C;  1IIP A;  2NV3 A;  4OJ5 A;  3IG5 A;  2K4E A;  2G5I B;  2KJ9 A;  4QIW F;  2M0N A;  2RRD A;  1NZB A;  4OJP A;  2JH1 A;  3O0F A;  5A0L A;  3RF9 A;  2ZIX B;  2ZIW A;  4P0P B;  4JMU A;  2KVC A;  1ECW A;  2K8C B;  3VCB A;  3KFU F;  2YB4 A;  2XI9 A;  3C29 A;  3F53 A;  4GFJ A;  2MA1 A;  3IG8 A;  4QNL A;  3ALR A;  3NRW A;  1DRG A;  3KZX A;  1YT3 A;  2G0A A;  3PZP A;  2H3I A;  2ZIU A;  4A8E A;  4OJ6 A;  2K4I A;  4CDG A;  2G06 A;  3F5E A;  2VIX A;  2KOB A;  2GOL A;  2HBM A;  4NLC A;  2G09 A;  2GH1 A;  1PVP A;  3IN5 A;  5T14 A;  2HMX A;  2ZIV B;  3LVV A;  1SZH A;  2G07 A;  2F77 X;  3C28 A;  2KHQ A;  1A0P A;  2HBL A;  5HR7 A;  2KKV A;  4ICA A;  2KNJ A;  2HOF A;  2DQN B;  3MGV A;  2YX8 A;  3GZF A;  3LYS A;  4C0Z A;  1Z1B A;  3SMV A;  4QIW C;  3CYM A;  3F2B A;  2R18 A;  1WUD A;  5C0Y A;  1GO3 F;  4KMO B;  2VKQ A;  1UPH A;  2PMZ F;  3N7R C;  4CGZ A;  2ZIX A;  3F5A A;  4P0P A;  1A6S A;  2K8A A;  2Y0S F;  3LVW A;  2JH7 A;  2KEY A;  2H3V A;  3PST A;  4BUG A;  2VJ4 A;  4FE3 A;  3D2N A;  1D8B A;  2W7O A;  3D2S A;  2Y0S C;  2OXO A;  3SAH A;  3H0L B;  4OJL A;  2OYY A;  4NWI A;  2BDU A;  1Q3V A;  2HBK A;  4FZN A;  2G5H B;  2LKY A;  1HIW A;  1Q3U A;  2K8B B;  2WAQ C;  3CP8 A;  4U7C A;  1KBU A;  3HKZ F;  2ZIV A;  3DEE A;  3H0M B;  1Z19 A;  1XNS A;  2G08 A;  3AL0 B;  1T94 A;  2KHV A;  2Z7J A;  3T79 A;  2RHF A;  1MA7 A;  2A3V A;  3F2D A;  4O3M A;  1ED1 A;  2ZXH A;  4PL2 A;  2PMZ C;  2HOQ A;  2KJ5 A;  2CPR A;  3D2Q A;  2JMG A;  2CN1 A;  2E1F A;  2CRX A;  2WB1 F;  2H3Z A;  2OM6 A;  4P0Q B;  2KKP A;  2KIC A;  1F44 A;  2H3F A;  3F2C A;  2KIW A;  3AQE A;  4FZM A;  4BJQ A;  2DGZ A;  2Q4T A;  2W7P A;  4CRX A;  2JHD A;  1PVR A;  2KD1 A;  1XO0 A;  5HR6 A;  5CRX A;  2E1E A;  2RP5 A;  2XID A;  2N1R A;  3AQF A;  3M7D A;  3PSF A;  4KX5 A;  3HKZ C;  2W03 A;  2DF4 B;  3H0R B;  4NV0 A;  5KL8 B;  4ACO A;  4QJF B;  4AYB F;  2OH2 A;  2D6F C;  3RFA A;  2LHT A;  4PL1 A;  4U6P A;  1TAM A;  3ICX A;  4IC9 A;  4NLB A;  2LBO A;  4FZL A;  2ZIW B;  2ZG6 A;  2E5S A;  3OPX A;  3CRX A;  1L6N A;  3SQI A;  3PSI A;  2KV2 A;  3SAG A;  3L3F X;  3PSP A;  1PVQ A;  2W04 A;  2WB1 C;  2ZXI A;  3IP4 B;  3K1Z A;  3SAF A;  4WJ3 B;  3E0F A;  3VC8 A;  2KJ8 A;  3GU3 A;  1URJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...