2KJ8A

Nmr structure of fragment 87-196 from the putative phage integrase ints of e. coli: northeast structural genomics consortium target er652a, psi-2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
118
structure length
118
Chain Sequence
SSNNNSFSAIYKEWYEHKKQVWSVGYATELAKMFDDDILPIIGGLEIQDIEPMQLLEVIRRFEDRGAMERANKARRRCGEVFRYAIVTGRAKYNPAPDLADAMKGYRKKNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of fragment 87-196 from the putative phage integrase IntS of E. coli
rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
molecule keywords Putative prophage CPS-53 integrase
total genus 42
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kj8A00
3C28A 2A3VA 1A0PA 3C29A 1KBUA 1PVRA 1DRGA 2HOFA 2KEYA 2KKVA 1OUQA 1Q3VA 1PVQA 1F44A 1XO0A 2HOIA 4A8EA 2CRXA 2KHQA 3LYSA 2KOBA 1Z1BA 1Z19A 3CRXA 3NRWA 1P7DA 2KJ5A 5CRXA 2KHVA 1XNSA 2KJ9A 1Q3UA 2KJ8A 3MGVA 2KD1A 1MA7A 2KIWA 1PVPA 2KKPA 4ACOA 2OXOA 4CRXA 1NZBA 1CRXA
chains in the Genus database with same CATH superfamily
4ZH4A 1N48A 1TV9A 1IIPA 3AEVA 3WKEA 1RZTA 3PX0A 4QZ8A 8ICLA 3QNMA 5JU5A 4NLNA 5HHHA 4Y2JA 2K4IA 4ECVA 9ICJA 5J2BA 4Q44A 3ICXA 5KT7A 4ECQA 4FS2A 2C2DA 4FBUA 4G3IA 2GH1A 3SENA 4HYKA 2A19A 5J2HA 3LVWA 2KK0A 1Z00A 1TFRA 4FZMA 4RNMA 3JPPA 2LM4A 5CHGA 5BOMA 2F3NA 9ICVA 3M6KA 2I6XA 5D49A 1HEKA 5IIMA 1TAUA 1UCVA 2WF7A 2DF4B 4KLSA 1FO4A 3PV8A 4YXJA 4Y2XA 1NI3A 2W55A 2YY6A 4IRDA 1NJYA 2ZIVB 1TK5A 1HUZA 3TFSA 2ZIWA 3QU4A 7ICUA 4DF8A 3LK9A 2KJ9A 1K1SA 3FM9A 4ECUA 4KLDA 4AYBC 3Q8MA 2JV3A 1B4FA 3BQ0A 1OXJA 1BNOA 1SWVA 4R63A 3PMLA 3D6JA 4OJPA 1KFDA 5AM4A 5ALYA 4ED0A 2W7OA 4M47A 2LYHA 1U45A 1PVQA 3QEAZ 1ZQCA 2F44A 5KAFU 1AQ6A 4QZEA 3ISCA 4EBCA 5J2KA 3EYZA 1PUZA 3IM1A 2RP5A 2V4QA 5AK5A 4DO9A 5DB7A 4I27A 2OXOA 5J0YA 2BCVA 1O03A 9ICOA 4UB3A 3QZ7A 2DKXA 5J0OA 1KBUA 4RQ7A 2PFOA 4ECTA 4BWMA 3MFIA 1LKYB 3WKCA 5DGBA 4US8A 4EBDA 4ECRA 1U9LA 5F9NA 4YMOA 5KG0A 3MFHA 3M6ZA 1RQNA 2I1QA 3AU6A 2DPIA 1COKA 4JB3A 2HHVA 2R8JA 1N56A 2IOFK 2D6FC 3NVZA 1UPHA 2OWOA 1X9WA 2CXYA 3NVVA 5KFLA 5EWGA 5AK3A 4OD0A 3BJYA 2BQ3A 4IC9A 4P2HA 5TZVA 5ALTA 4QW9A 5G5GA 5DQHA 2LHTA 1JUDA 3SYZA 3Q8PB 3V7JA 1NK4A 3KTQA 3GIMA 1QTMA 4RUCA 5AKJA 7ICRA 5ALWA 4KLHA 3TQ1A 2KV2A 4C8KA 2E8PA 4CDGA 1L7OA 2J6TA 4OJ6A 4TUQA 4UB4A 4NLKA 3QZ8A 2M0NA 4U6PA 5CR0A 5DGAA 2K89A 1SKSA 4RQ5A 2G08A 4CE6A 4GXJA 5KFRA 1QSSA 4R64A 8ICBA 3RB0A 3TKAA 1NKEA 1WCLA 2PFNA 7ICSA 2V4RA 4R66A 4Z6FA 3TI0A 2I5HA 4IL6U 5EWEA 4O3NA 3H4BA 5KAIU 1ZQIA 3SZ2A 2NO5A 2W9CA 3SEIA 2UVUA 1S0NA 8ICSA 1NKCA 4RPZA 4EEYA 4F5QA 3BZCA 3IDWA 2K8CB 3ZD8A 3LDAA 2LYBA 5HR7A 1QH9A 4Y2UA 3G6XA 5J2AA 2VJ5A 2HHTA 4B6JA 5KT2A 2EZZA 1SIJA 4DSKA 1HJPA 4OO1J 1NK5A 1XSNA 9ICIA 3MABA 1ZQOA 4P4OA 4C8MA 4P4PA 4KTQA 5ALEA 3C1ZA 1S10A 2WF5A 2JRZA 9ICHA 2YMPA 1UT5A 3CYMA 1KLNA 4Y2YA 4Y2TA 1Z4OA 2P6RA 2ZJ5A 4EELA 4YR2A 4QWDA 4B9UA 2O6KA 5JRTA 1SL1A 1SL2A 2J6UA 4EBEA 3EWAA 4NLBA 1ZQTA 4JV2A 1KL9A 3NTUA 2DGZA 4FZNA 3AQEA 2N1RA 1T3QA 4BXOA 1XNSA 1PVPA 5J8YC 2RQ5A 4DFMA 4FFDA 2MUTB 4MF8A 2GWSA 1KW4A 1DGJA 2W3RA 2XVTA 1B43A 4DQPA 9ICQA 4HAIA 1HUOA 1FEZA 4I2GA 4I29A 4QWCA 5ALOA 5H2FU 1JN3A 4JWMA 4LZGA 4NL9C 2BPGA 9ICUA 1TKDA 2R18A 5J0WA 5KFJA 3ETRA 3SR6A 2HOIA 4IRCA 2W43A 1BPZA 4X5VA 1OW5A 2VKQA 1LKYA 4US9A 3UM9A 3T5HA 8ICQA 2KG5A 1WWVA 2WHEA 1QSLA 4IS7A 3JPOA 1SWWA 3UQ0A 4ECSA 1J2NA 4DLEA 2B6GA 2KKVA 5KFSA 3QU5A 5J0PA 1ZQRA 2PMZC 4M04A 2FMSA 5C5JA 4K4GA 5KL8B 3VCBA 1ZQYA 5AM5A 2ISOA 5KFYA 4K4HA 3QUQA 2QARA 1NK7A 3IN5A 3CP8A 3PO4A 1ZOLA 1D8BA 4DFPA 2VA2A 4I2BA 3HW8A 2YQEA 3TARA 3DDHA 3E0FA 3EZ5A 5ALGA 1Q46A 4ELVA 4EX7A 1H38A 4QZ9A 4IQTA 4YMMA 2ZIXB 4O5KA 4O3RA 2F1JA 4O5CA 3IG5A 1BPBA 5KT6A 2KMDA 3H8MA 4F2SA 2ZIVA 2CPRA 5AM2A 5AHXA 3BQ7A 1BGXT 5AKEA 4I2HA 3E58A 4KLOA 4O3QA 2OM6A 1ZD2P 7ICLA 4NV0A 1U47A 4QNLA 3RB6A 2KJ5A 4DQQA 2PFQA 2JEGA 3KKAC 1MQ2A 3GV7B 2G0AA 3AMZA 8ICRA 4O3MA 2C22A 1NJZA 1YT3A 3T5JA 3OHAA 2ES6A 5AIBA 4F8RA 9ICSA 1RG6A 3IV6A 1D8YA 1KRPA 2YMMA 3C5GA 4EX6A 1X9XA 2FPMA 3RJIA 4YFKA 3GZFA 7ICMA 1SXEA 2WTFA 1ZQEA 1SZPA 4PGYA 2ZIXA 4ECZA 1NOMA 4R8UB 1ZQJA 3KBBA 5KTQA 2W9AA 2FLPA 4F92B 4DQRA 2IOFA 2KZ3A 4I2IA 3HILA 2F8LA 2M9NA 5ALVA 3RRGA 1K5OA 5L1KA 4IQVA 4JUZA 1M6YA 2XY6A 3AUOA 3K1ZA 2QARB 4BX9C 4NLCA 1UHUA 2XY5A 3M8SA 3V6HA 3UXOA 5KFAA 4J9PA 4CNQA 5DBCA 4FZLA 4J9NA 7ICQA 5KT5A 5DBBA 8ICYA 4O0IA 4F71A 4JK1A 1XWLA 5KFNA 1JXEA 3T3FA 5KFDA 2NRTA 4CRXA 2BCRA 4EENA 2AJQA 2MAXA 2ZJ8A 5EE0A 4QWEA 3GU3A 4PGXA 4B9MA 3WKDA 3LYSA 3OHBA 3MDCA 3C5FA 4LZDA 3HP6A 5G5HA 1V38A 1N5WA 2FI1A 5J0TA 8ICWA 3RB4A 5HMMA 1UT8A 1MN8A 4NM2A 1L8OA 4UAUA 1SV4A 3WKBA 2NRWA 2Y1IA 2JMGA 3ETLA 4DL5A 4DFJA 5K4LA 2LPEA 2GLEA 4QIWF 4Z6DA 2KFZA 3NRWA 4JMUA 1KQQA 2KIWA 3F2CA 4F4YA 4DSJA 3QE9Y 2EZYA 2NYVA 2BHNA 2F1IA 5AKLA 4OJ5A 3OJSA 1JX4A 1XU4A 1ZQLA 3ZDBA 2Y0SF 1Z1BA 4P0PB 5HNKA 5KT4A 4UASA 9ICGA 4C7ZA 2H5XA 1RXWA 8ICCA 2ZTEA 2MUTA 9ICTA 5ALLA 4NXZA 5ALMA 2ODGA 4UB5A 1GO3F 3IHQB 9ICFA 1EXNA 1DXSA 2NRZA 5KL1B 5J2DA 1SB3C 1J2MA 4GXIA 2HCFA 9ICWA 4CGZA 4O9MA 3PSFA 2YB4A 2ZIUA 4B9VA 5B66U 3L4PA 4RU9A 3WU2U 4BGDA 2VJ4A 7ICPA 4MFAA 5KT3A 4RQ1A 1S8OA 5KG1A 3NVWA 2DQNB 3H8WA 2KSOB 4DF4A 1COOA 4Y2SA 4PHEA 2BGWA 4DL6A 3JPTA 4M9LA 1BNPA 5DG9A 1N62A 2YTUA 2QB0A 5J2CA 4BDPA 3PR4A 2ISPA 5KFTA 1T4GA 4NWIA 2UVWA 3JPNA 3ED5A 1ZQXA 3ALRA 4F5OA 1UA0A 4UQGA 1DK2A 1V85A 1ED1A 3IP4B 1QCKA 3KKAA 4YG2A 5J2JA 4CF5A 4KLIA 4PGQA 2W7PA 1ZQNA 3GFKB 4Q43A 2ZIUB 3RRHA 4ECYA 3KHHA 2XI9A 3MC1A 2HBJA 1F5SA 5KFBA 3SQIA 2ASJA 2Y1JA 2FMQA 1NNLA 3CRXA 1L3TA 4YD1A 3H7IA 5L1MA 4GIBA 2G07A 4UBCA 7ICEA 1Z4NA 3RJGA 3RH4A 1PZNA 3H0LB 1Q3UA 8ICNA 3C28A 4UAYA 2PI5A 1S97A 4UW9A 4F4ZA 3GDXA 2CN1A 1JALA 4KMUA 2W9MA 3NRZA 2NV3A 3N28A 2CRXA 3ZDAA 3KOOA 4F2RA 4NY8A 5KFXA 2QLTA 3NS1A 3O0FA 4DFKA 8ICJA 1S77D 4F50A 2OEHA 5KG3A 5IIJA 3FYHA 4I2JA 1JI7A 1VJ5A 1KDHA 2AH5A 4QIWC 5DKWA 2HHUA 2E8OA 4A8EA 4F4XA 5KFZA 3PW0A 9ICAA 5CEHA 4MFCA 3RBEA 4QZFA 5AKGA 4DL7A 3G6VA 4KLJA 5AI9A 4NJ8A 3GIKA 3T79A 4I2EA 2KVCA 1T7PA 3QYPA 5CP2A 4B9NA 1NK6A 1K1QA 5L9XA 3F2DA 5EE1A 2LYAA 2EZXA 1ZRNA 4MEYA 1B22A 1ZD5A 1XO1A 3QXGA 5J29A 2ALZA 2KVSA 3BQ2A 3V6KA 1NK8A 3N97B 4KLTA 3WK7A 9ICLA 1BPDA 4C4TA 3VC8A 9ICPA 2WF8A 4QW8A 2QKQA 1SV0A 3RJFA 3LWLA 3JPSA 5ALHA 5J0RA 5L1JA 5HP4A 5J0QA 4ECXA 4YD2A 2G5IB 3OSNA 2OCEA 4QWAA 4UBBA 1KTQA 5ALPA 4PZNA 3MGVA 1MA7A 2F1HA 1X9SA 1N2XA 3N7SC 2XGQA 3BQ1A 5DQGA 2HDOA 3NGDA 1XC9A 2LI6A 1ZQVA 2BKEA 2FPKA 2E1EA 1MQ3A 2H3VA 2RDJA 5HHIA 3QU7A 2FJ6A 5KG5A 2GOLA 4PZOA 4CF4A 3ONNA 3N7RC 3I28A 7ICTA 4TQSA 3WK9A 4IQUA 1A77A 2IHNA 3AU2A 3D2SA 5J2GA 1V97A 5DLFA 4NLZA 3MDAA 2I9GA 2NO4A 4UB6U 3FC4A 4RQ6A 1NZPA 4Z6EA 4ED2A 1N63A 2LM1A 3SAGA 4F5NA 3KZIU 2QB0B 4O5EA 1WWUA 5ALZA 1ZXIA 4J9MA 1SV0C 4J9SA 5KFHA 1TE2A 1L7NA 5J2FA 4GXKA 2JEIA 2KE7A 1JRPA 4F4WA 3PW7A 1BPEA 3HPOA 4JWNA 1X40A 4Y2QA 4DOCA 2Y0SC 2ZUCA 4XUSA 3ISDA 4EZ9A 3OGUA 2KOBA 4C7YA 3IRUA 4J9RA 5KFKA 5AKKA 3IG8A 3FDSA 4ELUA 3AN1A 5KFFA 4C8OA 2KTQA 4UB2A 1ZYQA 2NRXA 3Q8SB 4P0QB 4C4SA 2OH2A 3M1YA 3DV9A 4TURA 1QQ6A 3C23A 5F9LA 3GIJA 3PNCA 2F76X 3FAHA 4C4RA 8ICAA 1S76D 5ALDA 2IOHA 4Q8EA 2A1JB 4IR1A 4I2AA 2EANA 3H8JA 3WK5A 2LBOA 1WG8A 5DB8A 1L7PA 4Q8FA 2ZTCA 3NUQA 3RH6A 8ICFA 5KG4A 2JGAA 3K75D 1Z1VA 2Q0ZX 3RTVA 5AM3A 3G6YA 4ED7A 1CUKA 4B9TA 3RH5A 1ZQMA 2XY7A 2KD1A 3RB3A 4KLMA 1C20A 1A76A 4OJLA 4RT2A 2W11A 3UXPA 5J2EA 4F93B 5J8YA 4F5PA 5DLGA 4QJFB 1Y88A 2BPFA 1D9DA 4PHAA 3EPIA 3M8RA 4M9HA 3ZI4A 2KJ8A 3ZDCA 2MRLA 3EPGA 2HHSA 2AQ4A 4KMOB 4MF2A 4DEZA 5KFEA 3OPXA 5GTIU 1KEJA 3HX0A 1T8EA 4WJ3B 1F0MA 5BPCA 5AKXA 2K8BB 4M0AA 3F53A 2VANA 3PR5B 9ICEA 9ICXA 1FFUA 2DPJA 4UAZA 4FS1A 3DEEA 3BZKA 2KKPA 2DBYA 3LWMA 4DSEA 3J81j 2JR5A 5KG7A 2EH9A 5IIKA 5ALSA 1PVRA 4R8UA 1X2IA 4BJQA 2FLNA 1SXDA 5AKIA 4QWBA 3SD7A 3SI8A 3MGIA 1ZQDA 3E2EA 3ZDEA 1L3SA 2IBKA 4PL2A 8ICMA 1XSLA 5AK6A 1SKRA 1S0VA 4QZHA 5EWFA 1ZQBA 4GFJA 3SV3A 2E8NA 2XGPA 4TQRA 1X42A 4XQ8A 1WUDA 1L3VA 2KHQA 3CNHA 2B0CA 1D8LA 2W9CB 1LV5A 2JHDA 1QLNA 2P35A 4ECWA 3UQ2A 1X66A 2IA6A 5AI5A 4KLQA 2BDUA 8ICHA 3C2LA 2FMPA 3K1RB 2AGPA 2Q4TA 3RAQA 1B0XA 4NL9A 2HHWA 2K4PA 2EAMA 2FPLA 1X9MA 1XS9D 2KP7A 3TAPA 5ALJA 2H3FA 1RPLA 8ICOA 2MSNA 5BOLA 4YVZA 5ALQA 5EE9A 2BDPA 2R8GA 5CJ7A 3QUCA 3HT3A 7ICGA 2JXJA 1TK8A 4YR3A 4LVSA 3B0XA 1ZETA 5AKZA 4DS5A 2HHQA 3B0YA 4EYIB 4KLFA 4KX3A 3MR3A 5ALKA 4PPXA 2VIXA 4USAA 5AICA 2JZBB 1NKBA 1VLBA 2W3SA 4MEXA 4NM1A 2HVHA 1OUQA 1FIQA 2VA8A 3V7LA 4MHVA 3RR8A 3HKZC 1NJXA 1TAQA 1L5UA 2LKYA 5CRXA 8ICPA 2KHVA 2XICA 3F5AA 2JH1A 4JV0A 4DFDA 1QQ7A 3KHLA 3UPQA 4FE3A 4IR9A 3KD3A 5ALUA 7ICIA 2IHMA 3BDPA 1YZ7A 5DDMA 5AM1A 4RT3A 1F44A 2WB1C 4LJXA 1AROP 3GV5B 2PKEA 4QZAA 2BCUA 4F4KA 3M9OB 5DG7A 5KFCA 9ICMA 2W04A 4OJOA 5IINA 1CEZA 3F2BA 4J03A 2HOFA 4KLUA 5KFGA 4RQNA 5KG6A 1JXLA 2EQYA 1LB2B 2OYYA 3KZXA 4C0ZA 1ZQUA 1CI4A 4QZBA 8ICEA 2A1AA 3CW2C 2HBLA 2WAQC 4Q45A 4KN7A 5J0SA 5ALIA 1BPYA 4UARA 4DL3A 2MU2A 4RQMA 1RDFA 9ICRA 5JUMA 2ESEA 5DQIA 3SMVA 3JPRA 3C29A 2W8LA 2KEYA 4R65A 1RYUA 5EE3A 5IIIA 2YB1A 3I76A 4DOAA 5ALNA 2XCPA 3C2KA 1Z19A 5KFWA 2RLTA 2K4HA 3N4MB 5KFPA 4YQWA 7ICJA 2HBMA 3SAHA 2PMZF 5L1IA 4YCXA 4YXMA 2Y9UA 4ED6A 1A6SA 4GC7A 2ZIWB 4UAVA 1YZ6A 8ICZA 3Q8KA 1XSPA 3TAQA 4XA5A 2BQRA 5IIOA 2J6SA 1PK3A 4RZRA 4UAWA 4RQ4A 2EDUA 1T3NA 4C8NA 4I2FA 4F72A 4I2CA 2ZXIA 2C2RA 3TANA 2D3DA 2DWQA 2QB1A 4DOBA 2HVIA 1UQVA 2DL0A 3MR6A 4DSIA 8ICUA 3ZDDA 5AI6A 4YP3A 5E79U 3PY8A 1RYSA 4M6WA 2XO7A 3B9JA 2KZMA 3HWTA 1PK1A 2WF9A 4DCCA 1CRXA 3Q8QB 1N5XA 2KSOA 4KITB 1T94A 4P4MA 3KHRA 3MBYA 5CA7A 4Y2VA 2KFNA 2RHFA 2KN7A 3C2MA 2ZXHA 4M9NA 1Z3EB 4RQ8A 3A0HU 2FDRA 4YN4A 2PI4A 4M2YA 3F5EA 3Q8RB 1A0PA 3PW4A 1J97A 4DL4A 1DOQA 1Q8KA 1U48A 1ZQAA 1KFTA 4G9BA 9ICBA 4K4IA 4JV1A 4KLEA 2BCSA 4BWJA 1ZD3A 8ICGA 4DQSA 2F2AB 2PXIA 1MC8A 1TAMA 4ED3A 3PW2A 2F77X 2D8CA 4RPYA 1IXRA 3ISBA 3PX4A 2KNJA 2L5YA 3H4DA 1ZJMA 2AXTU 1PK1B 1ECWA 4KLLA 3HKZF 1XO0A 5J0UA 2H3IA 2BZFA 4ED1A 4KX5A 3WK6A 2A3VA 2JEFA 1RXVA 2KZZA 5J2IA 2IMWP 1SZHA 1S9FA 1ZQSA 4B9LA 5ALFA 2G09A 2F8KA 5T14A 2AQ0A 2DFLA 5AKYA 4PHDA 2C2EA 2ZUDA 3BS5A 4PHPA 3V72A 3M9MB 3H0MB 4PL1A 4RNOA 4GLXA 4RUAA 3T5LA 2RRDA 8ICKA 4FBTA 3I1YA 2BQUA 2ZG6A 3C21A 2HSZA 2P6UA 4RQ3A 1FFVA 2NRVA 2K60A 1ZQ1C 2WB1F 8ICTA 9ICCA 1TK0A 7ICHA 5AK4A 2AHOB 2W9BB 7ICFA 4EZ6A 1RM6C 4C80A 1L3UA 2H3QA 2GO7A 1WCNA 5ALRA 4EYHB 3PZPA 1IM4A 5AKHA 4F3OA 3L3FX 4EEKA 5DDYA 3K4GA 3KHGA 1Q3VA 1C7YA 1BVSA 2UVRA 7ICKA 3QX7A 1VDVA 2PFPA 3HRDD 5EOZA 2G06A 1IG6A 4B9SA 3H0RB 5A0LA 1WYGA 1ZQGA 3BS7A 4IRKA 1KKXA 1UA1A 4J9LA 5KG2A 4ZOHC 3PW5A 2W03A 2C28A 2KIVA 4DL2A 2HHXA 5J0XA 1DRGA 5AI8A 4I28A 2AGOA 1KN5A 7ICVA 4P0PA 1IV8A 2E8MA 1L8LA 2W54A 3V7KA 3HJEA 4XRHA 1TVAA 1SL0A 8ICIA 3M7DA 3QUBA 2HW3A 4O3OA 3ORYA 4UB8U 2HMXA 3NVYA 4BXOB 3SV4A 5GTHU 3QU9A 3EW9A 4ELTA 5CB1A 5CWRA 3PVXA 1MSWD 4AP9A 5D46A 5IILA 4NLGA 4DQIA 1DGSA 3THVA 5AI4A 4F5RA 3AL0B 1NJWA 1S0MA 2E3TA 4UB1A 3D2QA 3L5KA 2ZTDA 3RJEA 4DLGA 5AM0A 3R9KA 1U4BA 5TISU 4P0QA 3PMNA 1V9PA 2ASDA 2E1FA 1ZQZA 1SGGA 3RJHA 4UATA 1HIWA 4IQWA 3PO5A 4PJ0U 5KFOA 4MFFA 4KLGA 1JROA 3AM9A 3TACB 1ZD4A 2A1JA 4QZGA 1ZQPA 3T5KA 3WK8A 3MGHA 2YMLA 2ASLA 2OHFA 4PH5A 5JTIA 1L6NA 4I2DA 5DG8A 4E0DA 3TADC 2ZUBA 2HI0A 4ICAA 9ICKA 1O08A 4O3SA 4TUPA 2AU0A 4BUGA 4Y2RA 2R8HA 4DSLA 4YR0A 2XCAA 3GQCA 2BPCA 1S5LU 4M6WB 3KFUF 1ZQKA 4O3PA 3OTQA 2JH7A 5HMLA 1Z00B 1ZQFA 2HBKA 3PSPA 8ICVA 2FE9A 3TFRA 3BQTA 5B5EU 5F3XB 3Q8LA 1NK0A 5AI0A 3PSTA 3JPQA 4AYBF 2K8AA 1U49A 5KFMA 3RBDA 4CCHA 5KNIA 4OCZA 5C0YA 3QU2A 3N7PD 2BR0A 2HOQA 3V6JA 1P7DA 3SAFA 1DK3A 5FP0A 3ZD9A 3RAXA 3PSIA 3BS5B 2LMRA 3C1YA 3TADA 1SKWA 2BCQA 2WFAA 4U7CA 1X6IA 5HR6A 2MA1A 3H40A 4Z6CA 2EAOA 2DKZA 5L1LA 4CF3A 3S6JA 1QSYA 1JIHA 2G5HB 5DB9A 1NK9A 3MR2A 1BPXA 2AGQA 3U26A 4QZCA 4RNNA 2RDIA 3RJJA 3QEBZ 4C8LA 5AIAA 1URJA 3D2NA 5KFVA 1D9FA 1RQLA 5DB6A 3RR7A 4KN4A 3GILA 3M9NB 4J9QA 3LVVA 4RPXA 3RF9A 3AQFA 4RQ0A 2H3ZA 1ZQWA 4QZDA 4DS4A 4YMNA 5KFQA 4RQ2A 1NZBA 5ALXA 2V9WA 3RJKA 3EUB2 3GV8B 2WAQF 2B21A 4M9JA 2KICA 3NASA 4GC6A 2YN4A 1KFSA 1S0OA 4Y2PA 1L7MA 3WK4A 1X6JA 3PX6A 3WKAA 3A0BU 1ZRMA 3OJUA 7ICNA 2E5SA 2EAPA 2DUYA 2XIDA 2JEJA 1ZQHA 4DWIA 1N60A 1LVHA 2R8IA 4J9OA 3QUTA 3MR5A 2UVVA 3RFAA 5DBAA 2ATLA 8ICXA 2W9BA 5KFUA 5KFIA 4F91B 2XC9A 2Y9TA 5D4BA 2K4EA 4QZIA 1N61A 4J9KA 4DSFA 2FLLA 2JZBA 3UMBA 4M9GA 3UXNA 2R8KA 1JMSA 2YX8A 3OSPA 2YMQA 2ZJAA 2WF6A 3H8SA 2Z7JA 4FO6A 1ZJNA 1RYRA 3UMCA 4ED8A 2W8KA 9ICNA 7ICOA 3GIIA 1QQ5A 1KSPA 2VA3A 4ACOA 3UMGA 4TUSA 2P66A 1ZQQA
chains in the Genus database with same CATH topology
3OPXA 3SMVA 3PZPA 1A0PA 3C29A 1KBUA 1IIPA 1URJA 3D2NA 3L3FX 3F2DA 2LYAA 2KEYA 2Y0SC 4WJ3B 2JMGA 1Q3VA 4ICAA 2HOIA 2YB1A 4NWIA 2K8CB 2K8BB 4QIWF 3LVVA 3F53A 2KOBA 2F2AB 2VKQA 3AQFA 3RF9A 2G06A 3NRWA 2H3ZA 3ALRA 4BUGA 1Z19A 1TAMA 4JMUA 5HR7A 2LYBA 3GZFA 3IG8A 2F77X 3H0RB 2K4IA 5A0LA 2K4HA 3VC8A 3DEEA 3M6ZA 2VJ5A 2KIWA 4KMOB 4KX3A 3KFUF 2KKPA 3IP4B 1ED1A 3F2CA 2VIXA 3ICXA 2KNJA 2JH7A 1NZBA 2HBMA 3SAHA 2W7PA 4OJ5A 2PMZF 2W03A 2ZIXA 2ZIUB 1ECWA 2WAQF 2GH1A 1PVRA 2KICA 1DRGA 2D6FC 4OO1J 2KKVA 2G5IB 1UPHA 3HKZF 4BJQA 2HBKA 2XI9A 3LVWA 3PSPA 1XO0A 1OUQA 4P0PA 2OH2A 2HBJA 4P0QB 1A6SA 4FZMA 3SQIA 2ZIWB 3HKZC 2Y0SF 1Z1BA 3CRXA 3M7DA 2F76X 2LKYA 2PMZC 5CRXA 4P0PB 2F8LA 2KHVA 2H3IA 4IC9A 5KL8B 2G07A 3M6KA 3VCBA 4PL2A 2XICA 3MGVA 1MA7A 3F5AA 2JH1A 2HMXA 2E5SA 3PSTA 3CYMA 1HEKA 2K8AA 4AYBF 2LBOA 2XIDA 3N7SC 4KX5A 4FE3A 3H0LB 3K1ZA 3NUQA 2LHTA 3CP8A 1GO3F 3IN5A 3C28A 1Q3UA 4BX9C 4NLCA 2A3VA 2DF4B 1D8BA 2CN1A 5C0YA 4GFJA 2E1EA 2JGAA 2ZXIA 2H3VA 3RFAA 5KL1B 4NLBA 1F44A 1SZHA 2KV2A 2NV3A 3N7PD 2GOLA 2DGZA 2WB1C 2CRXA 4FZLA 2ZIVB 1WUDA 2G09A 2HOQA 3AQEA 2KHQA 4FZNA 4CDGA 5T14A 2N1RA 4OJ6A 3E0FA 2JHDA 4CGZA 2ZIWA 3O0FA 3ONNA 1P7DA 3AL0B 3N7RC 3SAFA 2M0NA 4U6PA 1XNSA 2K4EA 2KJ9A 3H0MB 4PL1A 2KD1A 2W04A 2K89A 3PSFA 4AYBC 1PVPA 3D2QA 3PSIA 2YB4A 2ZIUA 2ZIXB 4OJOA 4CRXA 2G08A 3F2BA 3IG5A 2BDUA 2HOFA 4OJLA 2RRDA 2VJ4A 1CRXA 3D2SA 4OJPA 2Q4TA 2CPRA 2ZG6A 2ZIVA 1T94A 2YX8A 4P0QA 4U7CA 5HR6A 2OYYA 3KZXA 2XVTA 4QIWC 2E1FA 2W7OA 4C0ZA 2MA1A 3GU3A 1ZQ1C 1PVQA 2WB1F 4QJFB 2DQNB 4A8EA 2OM6A 2Z7JA 1HIWA 4NV0A 4QNLA 2HBLA 2RHFA 3LYSA 2ZXHA 2KJ5A 2WAQC 1L6NA 3SAGA 2KJ8A 2G0AA 2G5HB 2H3FA 2MRLA 2RP5A 4O3MA 3T79A 4ACOA 2H3QA 2OXOA 3F5EA 2KVCA 1YT3A 2R18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C28 A;  2A3V A;  1A0P A;  3C29 A;  1KBU A;  1PVR A;  1DRG A;  2HOF A;  2KEY A;  2KKV A;  1OUQ A;  1Q3V A;  1PVQ A;  1F44 A;  1XO0 A;  2HOI A;  4A8E A;  2CRX A;  2KHQ A;  3LYS A;  2KOB A;  1Z1B A;  1Z19 A;  3CRX A;  3NRW A;  1P7D A;  2KJ5 A;  5CRX A;  2KHV A;  1XNS A;  2KJ9 A;  1Q3U A;  2KJ8 A;  3MGV A;  2KD1 A;  1MA7 A;  2KIW A;  1PVP A;  2KKP A;  4ACO A;  2OXO A;  4CRX A;  1NZB A;  1CRX A; 
#chains in the Genus database with same CATH topology
 4ZH4 A;  1N48 A;  1TV9 A;  1IIP A;  3AEV A;  3WKE A;  1RZT A;  3PX0 A;  4QZ8 A;  8ICL A;  3QNM A;  5JU5 A;  4NLN A;  5HHH A;  4Y2J A;  2K4I A;  4ECV A;  9ICJ A;  5J2B A;  4Q44 A;  3ICX A;  5KT7 A;  4ECQ A;  4FS2 A;  2C2D A;  4FBU A;  4G3I A;  2GH1 A;  3SEN A;  4HYK A;  2A19 A;  5J2H A;  3LVW A;  2KK0 A;  1Z00 A;  1TFR A;  4FZM A;  4RNM A;  3JPP A;  2LM4 A;  5CHG A;  5BOM A;  2F3N A;  9ICV A;  3M6K A;  2I6X A;  5D49 A;  1HEK A;  5IIM A;  1TAU A;  1UCV A;  2WF7 A;  2DF4 B;  4KLS A;  1FO4 A;  3PV8 A;  4YXJ A;  4Y2X A;  1NI3 A;  2W55 A;  2YY6 A;  4IRD A;  1NJY A;  2ZIV B;  1TK5 A;  1HUZ A;  3TFS A;  2ZIW A;  3QU4 A;  7ICU A;  4DF8 A;  3LK9 A;  2KJ9 A;  1K1S A;  3FM9 A;  4ECU A;  4KLD A;  4AYB C;  3Q8M A;  2JV3 A;  1B4F A;  3BQ0 A;  1OXJ A;  1BNO A;  1SWV A;  4R63 A;  3PML A;  3D6J A;  4OJP A;  1KFD A;  5AM4 A;  5ALY A;  4ED0 A;  2W7O A;  4M47 A;  2LYH A;  1U45 A;  1PVQ A;  3QEA Z;  1ZQC A;  2F44 A;  5KAF U;  1AQ6 A;  4QZE A;  3ISC A;  4EBC A;  5J2K A;  3EYZ A;  1PUZ A;  3IM1 A;  2RP5 A;  2V4Q A;  5AK5 A;  4DO9 A;  5DB7 A;  4I27 A;  2OXO A;  5J0Y A;  2BCV A;  1O03 A;  9ICO A;  4UB3 A;  3QZ7 A;  2DKX A;  5J0O A;  1KBU A;  4RQ7 A;  2PFO A;  4ECT A;  4BWM A;  3MFI A;  1LKY B;  3WKC A;  5DGB A;  4US8 A;  4EBD A;  4ECR A;  1U9L A;  5F9N A;  4YMO A;  5KG0 A;  3MFH A;  3M6Z A;  1RQN A;  2I1Q A;  3AU6 A;  2DPI A;  1COK A;  4JB3 A;  2HHV A;  2R8J A;  1N56 A;  2IOF K;  2D6F C;  3NVZ A;  1UPH A;  2OWO A;  1X9W A;  2CXY A;  3NVV A;  5KFL A;  5EWG A;  5AK3 A;  4OD0 A;  3BJY A;  2BQ3 A;  4IC9 A;  4P2H A;  5TZV A;  5ALT A;  4QW9 A;  5G5G A;  5DQH A;  2LHT A;  1JUD A;  3SYZ A;  3Q8P B;  3V7J A;  1NK4 A;  3KTQ A;  3GIM A;  1QTM A;  4RUC A;  5AKJ A;  7ICR A;  5ALW A;  4KLH A;  3TQ1 A;  2KV2 A;  4C8K A;  2E8P A;  4CDG A;  1L7O A;  2J6T A;  4OJ6 A;  4TUQ A;  4UB4 A;  4NLK A;  3QZ8 A;  2M0N A;  4U6P A;  5CR0 A;  5DGA A;  2K89 A;  1SKS A;  4RQ5 A;  2G08 A;  4CE6 A;  4GXJ A;  5KFR A;  1QSS A;  4R64 A;  8ICB A;  3RB0 A;  3TKA A;  1NKE A;  1WCL A;  2PFN A;  7ICS A;  2V4R A;  4R66 A;  4Z6F A;  3TI0 A;  2I5H A;  4IL6 U;  5EWE A;  4O3N A;  3H4B A;  5KAI U;  1ZQI A;  3SZ2 A;  2NO5 A;  2W9C A;  3SEI A;  2UVU A;  1S0N A;  8ICS A;  1NKC A;  4RPZ A;  4EEY A;  4F5Q A;  3BZC A;  3IDW A;  2K8C B;  3ZD8 A;  3LDA A;  2LYB A;  5HR7 A;  1QH9 A;  4Y2U A;  3G6X A;  5J2A A;  2VJ5 A;  2HHT A;  4B6J A;  5KT2 A;  2EZZ A;  1SIJ A;  4DSK A;  1HJP A;  4OO1 J;  1NK5 A;  1XSN A;  9ICI A;  3MAB A;  1ZQO A;  4P4O A;  4C8M A;  4P4P A;  4KTQ A;  5ALE A;  3C1Z A;  1S10 A;  2WF5 A;  2JRZ A;  9ICH A;  2YMP A;  1UT5 A;  3CYM A;  1KLN A;  4Y2Y A;  4Y2T A;  1Z4O A;  2P6R A;  2ZJ5 A;  4EEL A;  4YR2 A;  4QWD A;  4B9U A;  2O6K A;  5JRT A;  1SL1 A;  1SL2 A;  2J6U A;  4EBE A;  3EWA A;  4NLB A;  1ZQT A;  4JV2 A;  1KL9 A;  3NTU A;  2DGZ A;  4FZN A;  3AQE A;  2N1R A;  1T3Q A;  4BXO A;  1XNS A;  1PVP A;  5J8Y C;  2RQ5 A;  4DFM A;  4FFD A;  2MUT B;  4MF8 A;  2GWS A;  1KW4 A;  1DGJ A;  2W3R A;  2XVT A;  1B43 A;  4DQP A;  9ICQ A;  4HAI A;  1HUO A;  1FEZ A;  4I2G A;  4I29 A;  4QWC A;  5ALO A;  5H2F U;  1JN3 A;  4JWM A;  4LZG A;  4NL9 C;  2BPG A;  9ICU A;  1TKD A;  2R18 A;  5J0W A;  5KFJ A;  3ETR A;  3SR6 A;  2HOI A;  4IRC A;  2W43 A;  1BPZ A;  4X5V A;  1OW5 A;  2VKQ A;  1LKY A;  4US9 A;  3UM9 A;  3T5H A;  8ICQ A;  2KG5 A;  1WWV A;  2WHE A;  1QSL A;  4IS7 A;  3JPO A;  1SWW A;  3UQ0 A;  4ECS A;  1J2N A;  4DLE A;  2B6G A;  2KKV A;  5KFS A;  3QU5 A;  5J0P A;  1ZQR A;  2PMZ C;  4M04 A;  2FMS A;  5C5J A;  4K4G A;  5KL8 B;  3VCB A;  1ZQY A;  5AM5 A;  2ISO A;  5KFY A;  4K4H A;  3QUQ A;  2QAR A;  1NK7 A;  3IN5 A;  3CP8 A;  3PO4 A;  1ZOL A;  1D8B A;  4DFP A;  2VA2 A;  4I2B A;  3HW8 A;  2YQE A;  3TAR A;  3DDH A;  3E0F A;  3EZ5 A;  5ALG A;  1Q46 A;  4ELV A;  4EX7 A;  1H38 A;  4QZ9 A;  4IQT A;  4YMM A;  2ZIX B;  4O5K A;  4O3R A;  2F1J A;  4O5C A;  3IG5 A;  1BPB A;  5KT6 A;  2KMD A;  3H8M A;  4F2S A;  2ZIV A;  2CPR A;  5AM2 A;  5AHX A;  3BQ7 A;  1BGX T;  5AKE A;  4I2H A;  3E58 A;  4KLO A;  4O3Q A;  2OM6 A;  1ZD2 P;  7ICL A;  4NV0 A;  1U47 A;  4QNL A;  3RB6 A;  2KJ5 A;  4DQQ A;  2PFQ A;  2JEG A;  3KKA C;  1MQ2 A;  3GV7 B;  2G0A A;  3AMZ A;  8ICR A;  4O3M A;  2C22 A;  1NJZ A;  1YT3 A;  3T5J A;  3OHA A;  2ES6 A;  5AIB A;  4F8R A;  9ICS A;  1RG6 A;  3IV6 A;  1D8Y A;  1KRP A;  2YMM A;  3C5G A;  4EX6 A;  1X9X A;  2FPM A;  3RJI A;  4YFK A;  3GZF A;  7ICM A;  1SXE A;  2WTF A;  1ZQE A;  1SZP A;  4PGY A;  2ZIX A;  4ECZ A;  1NOM A;  4R8U B;  1ZQJ A;  3KBB A;  5KTQ A;  2W9A A;  2FLP A;  4F92 B;  4DQR A;  2IOF A;  2KZ3 A;  4I2I A;  3HIL A;  2F8L A;  2M9N A;  5ALV A;  3RRG A;  1K5O A;  5L1K A;  4IQV A;  4JUZ A;  1M6Y A;  2XY6 A;  3AUO A;  3K1Z A;  2QAR B;  4BX9 C;  4NLC A;  1UHU A;  2XY5 A;  3M8S A;  3V6H A;  3UXO A;  5KFA A;  4J9P A;  4CNQ A;  5DBC A;  4FZL A;  4J9N A;  7ICQ A;  5KT5 A;  5DBB A;  8ICY A;  4O0I A;  4F71 A;  4JK1 A;  1XWL A;  5KFN A;  1JXE A;  3T3F A;  5KFD A;  2NRT A;  4CRX A;  2BCR A;  4EEN A;  2AJQ A;  2MAX A;  2ZJ8 A;  5EE0 A;  4QWE A;  3GU3 A;  4PGX A;  4B9M A;  3WKD A;  3LYS A;  3OHB A;  3MDC A;  3C5F A;  4LZD A;  3HP6 A;  5G5H A;  1V38 A;  1N5W A;  2FI1 A;  5J0T A;  8ICW A;  3RB4 A;  5HMM A;  1UT8 A;  1MN8 A;  4NM2 A;  1L8O A;  4UAU A;  1SV4 A;  3WKB A;  2NRW A;  2Y1I A;  2JMG A;  3ETL A;  4DL5 A;  4DFJ A;  5K4L A;  2LPE A;  2GLE A;  4QIW F;  4Z6D A;  2KFZ A;  3NRW A;  4JMU A;  1KQQ A;  2KIW A;  3F2C A;  4F4Y A;  4DSJ A;  3QE9 Y;  2EZY A;  2NYV A;  2BHN A;  2F1I A;  5AKL A;  4OJ5 A;  3OJS A;  1JX4 A;  1XU4 A;  1ZQL A;  3ZDB A;  2Y0S F;  1Z1B A;  4P0P B;  5HNK A;  5KT4 A;  4UAS A;  9ICG A;  4C7Z A;  2H5X A;  1RXW A;  8ICC A;  2ZTE A;  2MUT A;  9ICT A;  5ALL A;  4NXZ A;  5ALM A;  2ODG A;  4UB5 A;  1GO3 F;  3IHQ B;  9ICF A;  1EXN A;  1DXS A;  2NRZ A;  5KL1 B;  5J2D A;  1SB3 C;  1J2M A;  4GXI A;  2HCF A;  9ICW A;  4CGZ A;  4O9M A;  3PSF A;  2YB4 A;  2ZIU A;  4B9V A;  5B66 U;  3L4P A;  4RU9 A;  3WU2 U;  4BGD A;  2VJ4 A;  7ICP A;  4MFA A;  5KT3 A;  4RQ1 A;  1S8O A;  5KG1 A;  3NVW A;  2DQN B;  3H8W A;  2KSO B;  4DF4 A;  1COO A;  4Y2S A;  4PHE A;  2BGW A;  4DL6 A;  3JPT A;  4M9L A;  1BNP A;  5DG9 A;  1N62 A;  2YTU A;  2QB0 A;  5J2C A;  4BDP A;  3PR4 A;  2ISP A;  5KFT A;  1T4G A;  4NWI A;  2UVW A;  3JPN A;  3ED5 A;  1ZQX A;  3ALR A;  4F5O A;  1UA0 A;  4UQG A;  1DK2 A;  1V85 A;  1ED1 A;  3IP4 B;  1QCK A;  3KKA A;  4YG2 A;  5J2J A;  4CF5 A;  4KLI A;  4PGQ A;  2W7P A;  1ZQN A;  3GFK B;  4Q43 A;  2ZIU B;  3RRH A;  4ECY A;  3KHH A;  2XI9 A;  3MC1 A;  2HBJ A;  1F5S A;  5KFB A;  3SQI A;  2ASJ A;  2Y1J A;  2FMQ A;  1NNL A;  3CRX A;  1L3T A;  4YD1 A;  3H7I A;  5L1M A;  4GIB A;  2G07 A;  4UBC A;  7ICE A;  1Z4N A;  3RJG A;  3RH4 A;  1PZN A;  3H0L B;  1Q3U A;  8ICN A;  3C28 A;  4UAY A;  2PI5 A;  1S97 A;  4UW9 A;  4F4Z A;  3GDX A;  2CN1 A;  1JAL A;  4KMU A;  2W9M A;  3NRZ A;  2NV3 A;  3N28 A;  2CRX A;  3ZDA A;  3KOO A;  4F2R A;  4NY8 A;  5KFX A;  2QLT A;  3NS1 A;  3O0F A;  4DFK A;  8ICJ A;  1S77 D;  4F50 A;  2OEH A;  5KG3 A;  5IIJ A;  3FYH A;  4I2J A;  1JI7 A;  1VJ5 A;  1KDH A;  2AH5 A;  4QIW C;  5DKW A;  2HHU A;  2E8O A;  4A8E A;  4F4X A;  5KFZ A;  3PW0 A;  9ICA A;  5CEH A;  4MFC A;  3RBE A;  4QZF A;  5AKG A;  4DL7 A;  3G6V A;  4KLJ A;  5AI9 A;  4NJ8 A;  3GIK A;  3T79 A;  4I2E A;  2KVC A;  1T7P A;  3QYP A;  5CP2 A;  4B9N A;  1NK6 A;  1K1Q A;  5L9X A;  3F2D A;  5EE1 A;  2LYA A;  2EZX A;  1ZRN A;  4MEY A;  1B22 A;  1ZD5 A;  1XO1 A;  3QXG A;  5J29 A;  2ALZ A;  2KVS A;  3BQ2 A;  3V6K A;  1NK8 A;  3N97 B;  4KLT A;  3WK7 A;  9ICL A;  1BPD A;  4C4T A;  3VC8 A;  9ICP A;  2WF8 A;  4QW8 A;  2QKQ A;  1SV0 A;  3RJF A;  3LWL A;  3JPS A;  5ALH A;  5J0R A;  5L1J A;  5HP4 A;  5J0Q A;  4ECX A;  4YD2 A;  2G5I B;  3OSN A;  2OCE A;  4QWA A;  4UBB A;  1KTQ A;  5ALP A;  4PZN A;  3MGV A;  1MA7 A;  2F1H A;  1X9S A;  1N2X A;  3N7S C;  2XGQ A;  3BQ1 A;  5DQG A;  2HDO A;  3NGD A;  1XC9 A;  2LI6 A;  1ZQV A;  2BKE A;  2FPK A;  2E1E A;  1MQ3 A;  2H3V A;  2RDJ A;  5HHI A;  3QU7 A;  2FJ6 A;  5KG5 A;  2GOL A;  4PZO A;  4CF4 A;  3ONN A;  3N7R C;  3I28 A;  7ICT A;  4TQS A;  3WK9 A;  4IQU A;  1A77 A;  2IHN A;  3AU2 A;  3D2S A;  5J2G A;  1V97 A;  5DLF A;  4NLZ A;  3MDA A;  2I9G A;  2NO4 A;  4UB6 U;  3FC4 A;  4RQ6 A;  1NZP A;  4Z6E A;  4ED2 A;  1N63 A;  2LM1 A;  3SAG A;  4F5N A;  3KZI U;  2QB0 B;  4O5E A;  1WWU A;  5ALZ A;  1ZXI A;  4J9M A;  1SV0 C;  4J9S A;  5KFH A;  1TE2 A;  1L7N A;  5J2F A;  4GXK A;  2JEI A;  2KE7 A;  1JRP A;  4F4W A;  3PW7 A;  1BPE A;  3HPO A;  4JWN A;  1X40 A;  4Y2Q A;  4DOC A;  2Y0S C;  2ZUC A;  4XUS A;  3ISD A;  4EZ9 A;  3OGU A;  2KOB A;  4C7Y A;  3IRU A;  4J9R A;  5KFK A;  5AKK A;  3IG8 A;  3FDS A;  4ELU A;  3AN1 A;  5KFF A;  4C8O A;  2KTQ A;  4UB2 A;  1ZYQ A;  2NRX A;  3Q8S B;  4P0Q B;  4C4S A;  2OH2 A;  3M1Y A;  3DV9 A;  4TUR A;  1QQ6 A;  3C23 A;  5F9L A;  3GIJ A;  3PNC A;  2F76 X;  3FAH A;  4C4R A;  8ICA A;  1S76 D;  5ALD A;  2IOH A;  4Q8E A;  2A1J B;  4IR1 A;  4I2A A;  2EAN A;  3H8J A;  3WK5 A;  2LBO A;  1WG8 A;  5DB8 A;  1L7P A;  4Q8F A;  2ZTC A;  3NUQ A;  3RH6 A;  8ICF A;  5KG4 A;  2JGA A;  3K75 D;  1Z1V A;  2Q0Z X;  3RTV A;  5AM3 A;  3G6Y A;  4ED7 A;  1CUK A;  4B9T A;  3RH5 A;  1ZQM A;  2XY7 A;  2KD1 A;  3RB3 A;  4KLM A;  1C20 A;  1A76 A;  4OJL A;  4RT2 A;  2W11 A;  3UXP A;  5J2E A;  4F93 B;  5J8Y A;  4F5P A;  5DLG A;  4QJF B;  1Y88 A;  2BPF A;  1D9D A;  4PHA A;  3EPI A;  3M8R A;  4M9H A;  3ZI4 A;  2KJ8 A;  3ZDC A;  2MRL A;  3EPG A;  2HHS A;  2AQ4 A;  4KMO B;  4MF2 A;  4DEZ A;  5KFE A;  3OPX A;  5GTI U;  1KEJ A;  3HX0 A;  1T8E A;  4WJ3 B;  1F0M A;  5BPC A;  5AKX A;  2K8B B;  4M0A A;  3F53 A;  2VAN A;  3PR5 B;  9ICE A;  9ICX A;  1FFU A;  2DPJ A;  4UAZ A;  4FS1 A;  3DEE A;  3BZK A;  2KKP A;  2DBY A;  3LWM A;  4DSE A;  3J81 j;  2JR5 A;  5KG7 A;  2EH9 A;  5IIK A;  5ALS A;  1PVR A;  4R8U A;  1X2I A;  4BJQ A;  2FLN A;  1SXD A;  5AKI A;  4QWB A;  3SD7 A;  3SI8 A;  3MGI A;  1ZQD A;  3E2E A;  3ZDE A;  1L3S A;  2IBK A;  4PL2 A;  8ICM A;  1XSL A;  5AK6 A;  1SKR A;  1S0V A;  4QZH A;  5EWF A;  1ZQB A;  4GFJ A;  3SV3 A;  2E8N A;  2XGP A;  4TQR A;  1X42 A;  4XQ8 A;  1WUD A;  1L3V A;  2KHQ A;  3CNH A;  2B0C A;  1D8L A;  2W9C B;  1LV5 A;  2JHD A;  1QLN A;  2P35 A;  4ECW A;  3UQ2 A;  1X66 A;  2IA6 A;  5AI5 A;  4KLQ A;  2BDU A;  8ICH A;  3C2L A;  2FMP A;  3K1R B;  2AGP A;  2Q4T A;  3RAQ A;  1B0X A;  4NL9 A;  2HHW A;  2K4P A;  2EAM A;  2FPL A;  1X9M A;  1XS9 D;  2KP7 A;  3TAP A;  5ALJ A;  2H3F A;  1RPL A;  8ICO A;  2MSN A;  5BOL A;  4YVZ A;  5ALQ A;  5EE9 A;  2BDP A;  2R8G A;  5CJ7 A;  3QUC A;  3HT3 A;  7ICG A;  2JXJ A;  1TK8 A;  4YR3 A;  4LVS A;  3B0X A;  1ZET A;  5AKZ A;  4DS5 A;  2HHQ A;  3B0Y A;  4EYI B;  4KLF A;  4KX3 A;  3MR3 A;  5ALK A;  4PPX A;  2VIX A;  4USA A;  5AIC A;  2JZB B;  1NKB A;  1VLB A;  2W3S A;  4MEX A;  4NM1 A;  2HVH A;  1OUQ A;  1FIQ A;  2VA8 A;  3V7L A;  4MHV A;  3RR8 A;  3HKZ C;  1NJX A;  1TAQ A;  1L5U A;  2LKY A;  5CRX A;  8ICP A;  2KHV A;  2XIC A;  3F5A A;  2JH1 A;  4JV0 A;  4DFD A;  1QQ7 A;  3KHL A;  3UPQ A;  4FE3 A;  4IR9 A;  3KD3 A;  5ALU A;  7ICI A;  2IHM A;  3BDP A;  1YZ7 A;  5DDM A;  5AM1 A;  4RT3 A;  1F44 A;  2WB1 C;  4LJX A;  1ARO P;  3GV5 B;  2PKE A;  4QZA A;  2BCU A;  4F4K A;  3M9O B;  5DG7 A;  5KFC A;  9ICM A;  2W04 A;  4OJO A;  5IIN A;  1CEZ A;  3F2B A;  4J03 A;  2HOF A;  4KLU A;  5KFG A;  4RQN A;  5KG6 A;  1JXL A;  2EQY A;  1LB2 B;  2OYY A;  3KZX A;  4C0Z A;  1ZQU A;  1CI4 A;  4QZB A;  8ICE A;  2A1A A;  3CW2 C;  2HBL A;  2WAQ C;  4Q45 A;  4KN7 A;  5J0S A;  5ALI A;  1BPY A;  4UAR A;  4DL3 A;  2MU2 A;  4RQM A;  1RDF A;  9ICR A;  5JUM A;  2ESE A;  5DQI A;  3SMV A;  3JPR A;  3C29 A;  2W8L A;  2KEY A;  4R65 A;  1RYU A;  5EE3 A;  5III A;  2YB1 A;  3I76 A;  4DOA A;  5ALN A;  2XCP A;  3C2K A;  1Z19 A;  5KFW A;  2RLT A;  2K4H A;  3N4M B;  5KFP A;  4YQW A;  7ICJ A;  2HBM A;  3SAH A;  2PMZ F;  5L1I A;  4YCX A;  4YXM A;  2Y9U A;  4ED6 A;  1A6S A;  4GC7 A;  2ZIW B;  4UAV A;  1YZ6 A;  8ICZ A;  3Q8K A;  1XSP A;  3TAQ A;  4XA5 A;  2BQR A;  5IIO A;  2J6S A;  1PK3 A;  4RZR A;  4UAW A;  4RQ4 A;  2EDU A;  1T3N A;  4C8N A;  4I2F A;  4F72 A;  4I2C A;  2ZXI A;  2C2R A;  3TAN A;  2D3D A;  2DWQ A;  2QB1 A;  4DOB A;  2HVI A;  1UQV A;  2DL0 A;  3MR6 A;  4DSI A;  8ICU A;  3ZDD A;  5AI6 A;  4YP3 A;  5E79 U;  3PY8 A;  1RYS A;  4M6W A;  2XO7 A;  3B9J A;  2KZM A;  3HWT A;  1PK1 A;  2WF9 A;  4DCC A;  1CRX A;  3Q8Q B;  1N5X A;  2KSO A;  4KIT B;  1T94 A;  4P4M A;  3KHR A;  3MBY A;  5CA7 A;  4Y2V A;  2KFN A;  2RHF A;  2KN7 A;  3C2M A;  2ZXH A;  4M9N A;  1Z3E B;  4RQ8 A;  3A0H U;  2FDR A;  4YN4 A;  2PI4 A;  4M2Y A;  3F5E A;  3Q8R B;  1A0P A;  3PW4 A;  1J97 A;  4DL4 A;  1DOQ A;  1Q8K A;  1U48 A;  1ZQA A;  1KFT A;  4G9B A;  9ICB A;  4K4I A;  4JV1 A;  4KLE A;  2BCS A;  4BWJ A;  1ZD3 A;  8ICG A;  4DQS A;  2F2A B;  2PXI A;  1MC8 A;  1TAM A;  4ED3 A;  3PW2 A;  2F77 X;  2D8C A;  4RPY A;  1IXR A;  3ISB A;  3PX4 A;  2KNJ A;  2L5Y A;  3H4D A;  1ZJM A;  2AXT U;  1PK1 B;  1ECW A;  4KLL A;  3HKZ F;  1XO0 A;  5J0U A;  2H3I A;  2BZF A;  4ED1 A;  4KX5 A;  3WK6 A;  2A3V A;  2JEF A;  1RXV A;  2KZZ A;  5J2I A;  2IMW P;  1SZH A;  1S9F A;  1ZQS A;  4B9L A;  5ALF A;  2G09 A;  2F8K A;  5T14 A;  2AQ0 A;  2DFL A;  5AKY A;  4PHD A;  2C2E A;  2ZUD A;  3BS5 A;  4PHP A;  3V72 A;  3M9M B;  3H0M B;  4PL1 A;  4RNO A;  4GLX A;  4RUA A;  3T5L A;  2RRD A;  8ICK A;  4FBT A;  3I1Y A;  2BQU A;  2ZG6 A;  3C21 A;  2HSZ A;  2P6U A;  4RQ3 A;  1FFV A;  2NRV A;  2K60 A;  1ZQ1 C;  2WB1 F;  8ICT A;  9ICC A;  1TK0 A;  7ICH A;  5AK4 A;  2AHO B;  2W9B B;  7ICF A;  4EZ6 A;  1RM6 C;  4C80 A;  1L3U A;  2H3Q A;  2GO7 A;  1WCN A;  5ALR A;  4EYH B;  3PZP A;  1IM4 A;  5AKH A;  4F3O A;  3L3F X;  4EEK A;  5DDY A;  3K4G A;  3KHG A;  1Q3V A;  1C7Y A;  1BVS A;  2UVR A;  7ICK A;  3QX7 A;  1VDV A;  2PFP A;  3HRD D;  5EOZ A;  2G06 A;  1IG6 A;  4B9S A;  3H0R B;  5A0L A;  1WYG A;  1ZQG A;  3BS7 A;  4IRK A;  1KKX A;  1UA1 A;  4J9L A;  5KG2 A;  4ZOH C;  3PW5 A;  2W03 A;  2C28 A;  2KIV A;  4DL2 A;  2HHX A;  5J0X A;  1DRG A;  5AI8 A;  4I28 A;  2AGO A;  1KN5 A;  7ICV A;  4P0P A;  1IV8 A;  2E8M A;  1L8L A;  2W54 A;  3V7K A;  3HJE A;  4XRH A;  1TVA A;  1SL0 A;  8ICI A;  3M7D A;  3QUB A;  2HW3 A;  4O3O A;  3ORY A;  4UB8 U;  2HMX A;  3NVY A;  4BXO B;  3SV4 A;  5GTH U;  3QU9 A;  3EW9 A;  4ELT A;  5CB1 A;  5CWR A;  3PVX A;  1MSW D;  4AP9 A;  5D46 A;  5IIL A;  4NLG A;  4DQI A;  1DGS A;  3THV A;  5AI4 A;  4F5R A;  3AL0 B;  1NJW A;  1S0M A;  2E3T A;  4UB1 A;  3D2Q A;  3L5K A;  2ZTD A;  3RJE A;  4DLG A;  5AM0 A;  3R9K A;  1U4B A;  5TIS U;  4P0Q A;  3PMN A;  1V9P A;  2ASD A;  2E1F A;  1ZQZ A;  1SGG A;  3RJH A;  4UAT A;  1HIW A;  4IQW A;  3PO5 A;  4PJ0 U;  5KFO A;  4MFF A;  4KLG A;  1JRO A;  3AM9 A;  3TAC B;  1ZD4 A;  2A1J A;  4QZG A;  1ZQP A;  3T5K A;  3WK8 A;  3MGH A;  2YML A;  2ASL A;  2OHF A;  4PH5 A;  5JTI A;  1L6N A;  4I2D A;  5DG8 A;  4E0D A;  3TAD C;  2ZUB A;  2HI0 A;  4ICA A;  9ICK A;  1O08 A;  4O3S A;  4TUP A;  2AU0 A;  4BUG A;  4Y2R A;  2R8H A;  4DSL A;  4YR0 A;  2XCA A;  3GQC A;  2BPC A;  1S5L U;  4M6W B;  3KFU F;  1ZQK A;  4O3P A;  3OTQ A;  2JH7 A;  5HML A;  1Z00 B;  1ZQF A;  2HBK A;  3PSP A;  8ICV A;  2FE9 A;  3TFR A;  3BQT A;  5B5E U;  5F3X B;  3Q8L A;  1NK0 A;  5AI0 A;  3PST A;  3JPQ A;  4AYB F;  2K8A A;  1U49 A;  5KFM A;  3RBD A;  4CCH A;  5KNI A;  4OCZ A;  5C0Y A;  3QU2 A;  3N7P D;  2BR0 A;  2HOQ A;  3V6J A;  1P7D A;  3SAF A;  1DK3 A;  5FP0 A;  3ZD9 A;  3RAX A;  3PSI A;  3BS5 B;  2LMR A;  3C1Y A;  3TAD A;  1SKW A;  2BCQ A;  2WFA A;  4U7C A;  1X6I A;  5HR6 A;  2MA1 A;  3H40 A;  4Z6C A;  2EAO A;  2DKZ A;  5L1L A;  4CF3 A;  3S6J A;  1QSY A;  1JIH A;  2G5H B;  5DB9 A;  1NK9 A;  3MR2 A;  1BPX A;  2AGQ A;  3U26 A;  4QZC A;  4RNN A;  2RDI A;  3RJJ A;  3QEB Z;  4C8L A;  5AIA A;  1URJ A;  3D2N A;  5KFV A;  1D9F A;  1RQL A;  5DB6 A;  3RR7 A;  4KN4 A;  3GIL A;  3M9N B;  4J9Q A;  3LVV A;  4RPX A;  3RF9 A;  3AQF A;  4RQ0 A;  2H3Z A;  1ZQW A;  4QZD A;  4DS4 A;  4YMN A;  5KFQ A;  4RQ2 A;  1NZB A;  5ALX A;  2V9W A;  3RJK A;  3EUB 2;  3GV8 B;  2WAQ F;  2B21 A;  4M9J A;  2KIC A;  3NAS A;  4GC6 A;  2YN4 A;  1KFS A;  1S0O A;  4Y2P A;  1L7M A;  3WK4 A;  1X6J A;  3PX6 A;  3WKA A;  3A0B U;  1ZRM A;  3OJU A;  7ICN A;  2E5S A;  2EAP A;  2DUY A;  2XID A;  2JEJ A;  1ZQH A;  4DWI A;  1N60 A;  1LVH A;  2R8I A;  4J9O A;  3QUT A;  3MR5 A;  2UVV A;  3RFA A;  5DBA A;  2ATL A;  8ICX A;  2W9B A;  5KFU A;  5KFI A;  4F91 B;  2XC9 A;  2Y9T A;  5D4B A;  2K4E A;  4QZI A;  1N61 A;  4J9K A;  4DSF A;  2FLL A;  2JZB A;  3UMB A;  4M9G A;  3UXN A;  2R8K A;  1JMS A;  2YX8 A;  3OSP A;  2YMQ A;  2ZJA A;  2WF6 A;  3H8S A;  2Z7J A;  4FO6 A;  1ZJN A;  1RYR A;  3UMC A;  4ED8 A;  2W8K A;  9ICN A;  7ICO A;  3GII A;  1QQ5 A;  1KSP A;  2VA3 A;  4ACO A;  3UMG A;  4TUS A;  2P66 A;  1ZQQ A; 
#chains in the Genus database with same CATH homology
 3OPX A;  3SMV A;  3PZP A;  1A0P A;  3C29 A;  1KBU A;  1IIP A;  1URJ A;  3D2N A;  3L3F X;  3F2D A;  2LYA A;  2KEY A;  2Y0S C;  4WJ3 B;  2JMG A;  1Q3V A;  4ICA A;  2HOI A;  2YB1 A;  4NWI A;  2K8C B;  2K8B B;  4QIW F;  3LVV A;  3F53 A;  2KOB A;  2F2A B;  2VKQ A;  3AQF A;  3RF9 A;  2G06 A;  3NRW A;  2H3Z A;  3ALR A;  4BUG A;  1Z19 A;  1TAM A;  4JMU A;  5HR7 A;  2LYB A;  3GZF A;  3IG8 A;  2F77 X;  3H0R B;  2K4I A;  5A0L A;  2K4H A;  3VC8 A;  3DEE A;  3M6Z A;  2VJ5 A;  2KIW A;  4KMO B;  4KX3 A;  3KFU F;  2KKP A;  3IP4 B;  1ED1 A;  3F2C A;  2VIX A;  3ICX A;  2KNJ A;  2JH7 A;  1NZB A;  2HBM A;  3SAH A;  2W7P A;  4OJ5 A;  2PMZ F;  2W03 A;  2ZIX A;  2ZIU B;  1ECW A;  2WAQ F;  2GH1 A;  1PVR A;  2KIC A;  1DRG A;  2D6F C;  4OO1 J;  2KKV A;  2G5I B;  1UPH A;  3HKZ F;  4BJQ A;  2HBK A;  2XI9 A;  3LVW A;  3PSP A;  1XO0 A;  1OUQ A;  4P0P A;  2OH2 A;  2HBJ A;  4P0Q B;  1A6S A;  4FZM A;  3SQI A;  2ZIW B;  3HKZ C;  2Y0S F;  1Z1B A;  3CRX A;  3M7D A;  2F76 X;  2LKY A;  2PMZ C;  5CRX A;  4P0P B;  2F8L A;  2KHV A;  2H3I A;  4IC9 A;  5KL8 B;  2G07 A;  3M6K A;  3VCB A;  4PL2 A;  2XIC A;  3MGV A;  1MA7 A;  3F5A A;  2JH1 A;  2HMX A;  2E5S A;  3PST A;  3CYM A;  1HEK A;  2K8A A;  4AYB F;  2LBO A;  2XID A;  3N7S C;  4KX5 A;  4FE3 A;  3H0L B;  3K1Z A;  3NUQ A;  2LHT A;  3CP8 A;  1GO3 F;  3IN5 A;  3C28 A;  1Q3U A;  4BX9 C;  4NLC A;  2A3V A;  2DF4 B;  1D8B A;  2CN1 A;  5C0Y A;  4GFJ A;  2E1E A;  2JGA A;  2ZXI A;  2H3V A;  3RFA A;  5KL1 B;  4NLB A;  1F44 A;  1SZH A;  2KV2 A;  2NV3 A;  3N7P D;  2GOL A;  2DGZ A;  2WB1 C;  2CRX A;  4FZL A;  2ZIV B;  1WUD A;  2G09 A;  2HOQ A;  3AQE A;  2KHQ A;  4FZN A;  4CDG A;  5T14 A;  2N1R A;  4OJ6 A;  3E0F A;  2JHD A;  4CGZ A;  2ZIW A;  3O0F A;  3ONN A;  1P7D A;  3AL0 B;  3N7R C;  3SAF A;  2M0N A;  4U6P A;  1XNS A;  2K4E A;  2KJ9 A;  3H0M B;  4PL1 A;  2KD1 A;  2W04 A;  2K89 A;  3PSF A;  4AYB C;  1PVP A;  3D2Q A;  3PSI A;  2YB4 A;  2ZIU A;  2ZIX B;  4OJO A;  4CRX A;  2G08 A;  3F2B A;  3IG5 A;  2BDU A;  2HOF A;  4OJL A;  2RRD A;  2VJ4 A;  1CRX A;  3D2S A;  4OJP A;  2Q4T A;  2CPR A;  2ZG6 A;  2ZIV A;  1T94 A;  2YX8 A;  4P0Q A;  4U7C A;  5HR6 A;  2OYY A;  3KZX A;  2XVT A;  4QIW C;  2E1F A;  2W7O A;  4C0Z A;  2MA1 A;  3GU3 A;  1ZQ1 C;  1PVQ A;  2WB1 F;  4QJF B;  2DQN B;  4A8E A;  2OM6 A;  2Z7J A;  1HIW A;  4NV0 A;  4QNL A;  2HBL A;  2RHF A;  3LYS A;  2ZXH A;  2KJ5 A;  2WAQ C;  1L6N A;  3SAG A;  2KJ8 A;  2G0A A;  2G5H B;  2H3F A;  2MRL A;  2RP5 A;  4O3M A;  3T79 A;  4ACO A;  2H3Q A;  2OXO A;  3F5E A;  2KVC A;  1YT3 A;  2R18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...