2KJ8A

Nmr structure of fragment 87-196 from the putative phage integrase ints of e. coli: northeast structural genomics consortium target er652a, psi-2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
118
structure length
118
Chain Sequence
SSNNNSFSAIYKEWYEHKKQVWSVGYATELAKMFDDDILPIIGGLEIQDIEPMQLLEVIRRFEDRGAMERANKARRRCGEVFRYAIVTGRAKYNPAPDLADAMKGYRKKNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative prophage CPS-53 integrase
publication title NMR structure of fragment 87-196 from the putative phage integrase IntS of E. coli
rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
total genus 42
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kj8A00
1CRXA 1DRGA 3C28A 1XO0A 1A0PA 3LYSA 1PVRA 1KBUA 4ACOA 2CRXA 1PVPA 2KEYA 4CRXA 1PVQA 2A3VA 1XNSA 1Q3UA 2OXOA 5CRXA 2KD1A 1MA7A 2KJ9A 4A8EA 2KJ5A 3CRXA 1P7DA 2KJ8A 2KOBA 1Z1BA 2KHVA 2HOFA 2KKPA 1Q3VA 3MGVA 1Z19A 2KHQA 2KKVA 3C29A 1F44A 3NRWA 1NZBA 2KIWA 1OUQA 2HOIA
chains in the Genus database with same CATH superfamily
5AK3A 3PY8A 1XO1A 5ALGA 4F50A 3PSPA 5KFHA 4RPYA 4UAYA 4FBUA 1FEZA 5DDYA 5KFJA 4HYKA 2KOBA 2E1EA 2P66A 2HOFA 2B21A 1ZQOA 4RQ4A 5AI4A 3K75D 2RHFA 3M6ZA 4J9LA 1NZBA 4BGDA 4OO1J 4K4HA 5DB6A 2BR0A 1XO0A 2RP5A 3Q8LA 3C2LA 4K4GA 1DOQA 1U47A 4CGZA 2XGPA 5J2HA 3NVWA 4RU9A 1L7NA 2KHVA 2OHFA 4DSLA 4O9MA 2ZIUA 7ICNA 4DLEA 4QZ8A 4I2EA 3PX0A 4RNMA 2AJQA 1B43A 5AKJA 5ALOA 1QTMA 5L1IA 2M9NA 4P0QB 4KLGA 2AU0A 2DGZA 3WK9A 1DGSA 4KMUA 2H3QA 2CXYA 5AI0A 3WK4A 2Q4TA 3PX4A 3UXPA 4DSFA 3R9KA 4ELUA 4YP3A 5KNIA 4DOAA 5AKXA 4IRKA 5L1KA 4CRXA 4YVZA 5CR0A 4Y2PA 3EUB2 5ALYA 4F72A 2ATLA 7ICRA 3RH4A 4PZNA 4DQSA 5ALKA 5KT3A 1IIPA 4GFJA 2ZG6A 4ED3A 4EX7A 2PI5A 1DGJA 2PFPA 1U49A 5AIBA 3QU5A 3IHQB 1DXSA 3ZDCA 4I2IA 4B9VA 1KW4A 3T5HA 9ICCA 3H4DA 3ZDDA 5B5EU 1NK8A 1ZQSA 2V9WA 4RZRA 4UAZA 4PJ0U 2H3FA 1IXRA 1AQ6A 2CPRA 5DG9A 1ZQKA 4KLJA 2BDUA 3BJYA 4FZMA 2XO7A 4MF2A 2UVUA 3RRHA 2UVVA 4XA5A 3TQ1A 2E8MA 2LPEA 2C2RA 3MGVA 2EZZA 8ICAA 2MUTB 5DBCA 4M6WA 3AN1A 2KNJA 4QWDA 3L3FX 7ICSA 2HVIA 4Y2VA 3K1ZA 5KFXA 8ICTA 2YB1A 5AKGA 4J9PA 2R8HA 4YXMA 5GTIU 2G07A 3OSPA 2Y0SC 2LYBA 3QZ8A 3T5LA 1N61A 7ICFA 9ICNA 3JPSA 4I2HA 3LVVA 4MHVA 2MAXA 5AKLA 2ZTCA 1ZQGA 2A3VA 3RJFA 2OYYA 3VCBA 3HKZC 2LKYA 2XI9A 3HPOA 3OJSA 2HBKA 5DB9A 3F53A 5D46A 2D3DA 2ZUCA 7ICVA 4F5PA 1AROP 3QEBZ 4LZDA 4OJ6A 4DS5A 5KG3A 5IILA 3AQFA 5ALRA 4AYBC 4TUPA 5F9NA 1SKWA 2OM6A 4IS7A 4ECVA 3V6KA 5KFZA 4O3RA 3PO4A 3OPXA 8ICYA 4RQ2A 1PUZA 3NS1A 5JRTA 3H8JA 3PSFA 4GXJA 1QQ5A 5J0XA 3D6JA 2KTQA 3QU4A 4YMMA 4F4WA 3BS5B 1QCKA 3V7KA 1X66A 2V4RA 4UQGA 4UAWA 5KFMA 5CB1A 2KIVA 2KVSA 5ALDA 1FO4A 4DQPA 4YN4A 2WF8A 5AKIA 5EOZA 5J0OA 3ZDBA 3C21A 3V6JA 2RDJA 3TI0A 4DFMA 1NKEA 2KJ8A 2Y0SF 1ZQYA 1FIQA 4Z6CA 1M6YA 2VIXA 4KN7A 4C4TA 4FZNA 1KDHA 3KHRA 4Y2UA 1X40A 3C5FA 2BPFA 4O3SA 2N1RA 4F5RA 1L3TA 7ICOA 8ICOA 4JV2A 1Z1BA 4NY8A 3G6XA 2B0CA 1LKYA 2NRZA 2DL0A 4BX9C 3U26A 3BDPA 2ZIWB 4R63A 1NI3A 8ICHA 5DGBA 4AYBF 2DQNB 3K4GA 1UPHA 4BDPA 4F2SA 1V85A 3PZPA 4J9RA 4UAVA 2F1IA 2A19A 4DL5A 4EEYA 5ALEA 2F8KA 2KKPA 4QZAA 4K4IA 1Z1VA 2OEHA 3HX0A 4QNLA 4F5OA 1D8YA 2GH1A 3QUCA 1SV0C 4BXOB 2K4PA 2GOLA 1Q3UA 4QZEA 2F3NA 3UQ2A 1YT3A 1ZQTA 3BQTA 4QWEA 2EH9A 3IRUA 2KG5A 3L5KA 3V6HA 1ZJMA 9ICJA 2KSOA 1CRXA 8ICMA 4C7YA 3T79A 3JPRA 5ALSA 3WKEA 2ZIXA 8ICWA 3GFKB 4ZOHC 3SI8A 4B9LA 2BCUA 3UXNA 1V97A 5AM4A 5AI8A 3GIJA 4ECWA 2AH5A 2RLTA 3H8SA 5KFBA 4QWBA 3N7RC 1NK9A 4UBCA 5ALZA 1NK7A 3L4PA 2LYHA 1HJPA 2F1JA 2ALZA 1U9LA 1SB3C 2DWQA 2NRXA 1ZQPA 5DBAA 2KZ3A 1D8BA 5KFFA 5KT5A 2WAQC 2C22A 1ZQZA 3Q8MA 4UB3A 3QUTA 5J2CA 1O03A 1B0XA 2XGQA 4JK1A 4F5QA 1SV0A 3UM9A 2PMZC 3IM1A 5T14A 2ZIUB 1UCVA 1Z4NA 5KFLA 1F44A 2VANA 3SAGA 5ALVA 3UXOA 2JRZA 8ICBA 1UT8A 1JMSA 4NL9A 3RTVA 1S9FA 3H8MA 4QZFA 4KLLA 2KJ9A 4YFKA 1Z3EB 1T3QA 5ALNA 2K60A 9ICGA 5KFUA 3RFAA 1T94A 1ECWA 1SL1A 3EZ5A 2WF6A 5HHHA 1XSPA 2C28A 9ICMA 2ZIWA 3C1YA 4YCXA 4Q8EA 2ZUBA 4FS1A 7ICIA 3AL0B 1LVHA 3ISBA 1ZQVA 2PFQA 2IBKA 2XY6A 4OD0A 4RQ3A 2KKVA 4F93B 1OUQA 8ICXA 5KL1B 5AKKA 4R66A 1JUDA 3QXGA 3PR5B 4Y2TA 1ZQBA 3AMZA 3H40A 2BCVA 4PL1A 4DFPA 7ICLA 5CA7A 1UT5A 3MR3A 2QLTA 2VA3A 5KFKA 3HP6A 2YTUA 1S0VA 2RDIA 3SZ2A 1NOMA 4KITB 1PK1A 4DLGA 2XVTA 4Y2XA 2PMZF 3AQEA 1PVQA 5J2DA 8ICEA 4R8UA 3IP4B 4J03A 2KVCA 2HHWA 3JPQA 5HMMA 4UARA 4J9NA 2K89A 5TZVA 2WHEA 5AK6A 1N5WA 4J9MA 4NM1A 1X9MA 5AK4A 1KLNA 3KHHA 4M6WB 3C29A 3MFHA 1SZHA 1J2NA 4RT3A 1DRGA 1RYSA 1B22A 1KBUA 4ACOA 3NVYA 2FMSA 3T5JA 4XQ8A 9ICOA 4RPXA 4KLEA 5G5GA 2BKEA 3EWAA 1L5UA 3I1YA 3SAFA 3PW4A 3KZIU 4C8LA 1SKSA 4DSEA 5KT4A 4KLTA 2OCEA 3F5EA 2NRVA 4ED8A 9ICTA 1IM4A 4EZ9A 3CP8A 4DF8A 5J8YC 2ZIVA 4QZ9A 3PVXA 4PZOA 3GV8B 2HCFA 5KFAA 4R64A 2YMPA 2G08A 2LHTA 2HHUA 1KL9A 2MA1A 1XWLA 5ALTA 3QYPA 4QZIA 4RQ0A 4UB2A 1XS9D 4RQMA 2Y1IA 2F77X 2W9AA 1CEZA 5EE9A 3BS7A 4Y2QA 4RQ5A 2FPLA 3F5AA 2KZMA 9ICEA 1URJA 2CN1A 2W8LA 5ALLA 4CE6A 5CHGA 1P7DA 3M9NB 3RH5A 2F76X 1N63A 4UAUA 3OHAA 2C2EA 2HSZA 4DL4A 1CUKA 2MU2A 4Y2JA 4RQNA 4GC7A 3RJGA 2W9CA 5AM2A 4EZ6A 2DF4B 4KLMA 2KEYA 4KLQA 4OJOA 1BPYA 2P6UA 2IA6A 3H0MB 1ZQJA 2J6UA 4JB3A 3PR4A 1RDFA 4M2YA 2PKEA 3CYMA 3OTQA 2NO4A 5ALFA 3ETLA 5CJ7A 5AI5A 2EAOA 3N7SC 1QSLA 3NUQA 3THVA 2KFZA 1SIJA 3RJJA 3F2DA 2JHDA 2XY5A 1XSLA 2KD1A 3FDSA 5ALWA 2JEGA 1L8LA 3MR6A 3GIIA 4C4RA 5CEHA 5KFQA 3MDAA 1Q3VA 3I28A 1Q46A 8ICJA 7ICTA 2G5IB 3SEIA 4M9GA 8ICGA 3KTQA 5FP0A 8ICKA 1A6SA 5JTIA 1ZRNA 4DWIA 9ICAA 2W3RA 4PHPA 4TQRA 1TAQA 1LKYB 3OHBA 1ZYQA 5J2FA 4NM2A 3RBDA 2FLPA 1YZ7A 9ICLA 2DFLA 4NLKA 2A1JA 1ZQLA 4QIWC 2AGPA 3RH6A 5IIMA 1D8LA 3LYSA 5AKYA 5DGAA 2AQ0A 2BCSA 2ZXIA 4DQQA 2AHOB 2KICA 4TURA 4MFCA 4P4MA 2F1HA 3V72A 3QEAZ 1Z00A 3VC8A 3WKCA 4IQVA 4F4ZA 1FFVA 3SMVA 1N5XA 7ICHA 1F5SA 2FI1A 1X6JA 4TQSA 2YX8A 1DK3A 1S0OA 4I28A 3KHGA 4CCHA 4EEKA 4PGXA 4X5VA 2YQEA 5BPCA 2RRDA 2E8PA 2KSOB 4Z6FA 2I5HA 3GILA 1BPXA 5CP2A 4F91B 1RZTA 2ZIXB 2YMQA 5J2JA 1YZ6A 3Q8QB 4J9OA 2JGAA 2EAMA 2JEIA 4JV0A 2K4IA 4B9MA 3G6YA 4XUSA 4PHDA 1XNSA 3BZCA 4MEYA 1XU4A 1RPLA 1OW5A 2QB1A 1WCNA 4MF8A 2ASLA 5KG0A 3M9MB 4ED1A 3TFSA 8ICCA 1KQQA 3E2EA 3WU2U 3AM9A 2K8BB 4NLCA 3H7IA 2DKXA 8ICVA 4G9BA 3B9JA 3RJHA 3FYHA 3EW9A 3RAXA 1S97A 2F44A 1SGGA 4MFFA 5KL8B 2XIDA 1C7YA 3KFUF 2BQ3A 3PSIA 5DB7A 4MFAA 4I27A 3MGIA 4QIWF 2K4HA 4P2HA 1S0MA 2H3IA 3I76A 4I2DA 5JUMA 1JI7A 8ICPA 3TFRA 9ICIA 2W7PA 3PW0A 3M9OB 4IQTA 3DEEA 3NGDA 4ECQA 4E0DA 2ZTDA 3KHLA 1N48A 9ICKA 2QB0B 3EPGA 2JEFA 3WKBA 3QZ7A 2XC9A 5AKZA 4GXKA 2W55A 4Q8FA 1QLNA 3T3FA 3MABA 1WYGA 5EWEA 1ZQWA 9ICQA 5J0YA 2YY6A 1ZQUA 3KZXA 4KLSA 4CDGA 4MEXA 4F2RA 4RNOA 3SR6A 2IHMA 4JWMA 2LM4A 5AI9A 2BQUA 2ZJAA 3AU6A 4EBDA 1KSPA 1CI4A 4CNQA 3MR5A 3RAQA 4I2CA 1S76D 2QARA 4KX5A 4I2GA 4IRCA 2Y9TA 3GV7B 3M8RA 3TANA 3LVWA 4IL6U 4DOBA 8ICQA 2VA2A 3NTUA 1ZQDA 2H3VA 1NNLA 1KFSA 3ICXA 4O3OA 1LV5A 2ISPA 2ZUDA 3PV8A 4US9A 5DDMA 3O0FA 4UB1A 5C5JA 2DPIA 3H0LB 1X42A 2HI0A 1S10A 4M9JA 3B0XA 3GIMA 2FLNA 4C0ZA 2EZYA 3NVVA 3H0RB 2ESEA 3ZD8A 3TKAA 4AP9A 1TK8A 5KT6A 1PK1B 2K4EA 3WK5A 3RB3A 1QSYA 8ICLA 5IIOA 3QU2A 9ICPA 4YXJA 3IDWA 5DG7A 4R8UB 2BQRA 2R8JA 4ECXA 4BWJA 2DPJA 2HHTA 5KT2A 1HUOA 4KLUA 5ALQA 4F4YA 2ZJ5A 3BQ2A 4B9NA 4C8OA 2KP7A 3NASA 3SD7A 3PMNA 4RQ7A 4R65A 4FFDA 1L8OA 4ECTA 1ZD5A 2HDOA 3GQCA 4YQWA 3AUOA 2KZZA 1NK0A 2WF9A 4DO9A 5L1MA 1ZRMA 4DS4A 3AU2A 1ZETA 1BPEA 3LDAA 2FPMA 3UMCA 2ZIVB 5K4LA 5EE3A 1MSWD 4F3OA 1JROA 1JXLA 2XCPA 3ZDEA 1NJXA 4DQIA 4RNNA 1S5LU 3UMGA 3Q8SB 1X9XA 1F0MA 5ALHA 4G3IA 4B6JA 4ZH4A 5DLFA 3MBYA 3CRXA 2JV3A 5F3XB 4O3NA 4IR9A 3BZKA 2DBYA 5DG8A 1ZQEA 4QZHA 2QB0A 3SV3A 3RBEA 3EYZA 1TVAA 2HOIA 5L1LA 4M0AA 3PMLA 1MN8A 2V4QA 3A0BU 4C8KA 3M1YA 3MGHA 5KFPA 1L7OA 4RT2A 2LBOA 5IIIA 4J9QA 4KX3A 7ICEA 4P4OA 2MSNA 2BDPA 3C2MA 2W9CB 3KKAC 4M9HA 1NK4A 2GO7A 4C80A 5KFDA 3N7PD 1KEJA 4YD1A 8ICFA 2BPGA 5KTQA 4NLNA 2ODGA 2UVWA 1SL0A 9ICRA 1MQ2A 1PK3A 1NJYA 1UQVA 3DDHA 2IOFA 3RRGA 2AXTU 1ZD4A 2ES6A 3OJUA 2MRLA 2D8CA 1BNPA 2VJ4A 3M6KA 4YR0A 4HAIA 3GZFA 1ZQXA 2JZBA 2BPCA 2W03A 2PFOA 5CRXA 4QZCA 2BHNA 1N62A 2Q0ZX 4QZGA 1SWWA 1KN5A 4GC6A 3M8SA 7ICJA 3QNMA 2Y1JA 1UA0A 4BWMA 2E8OA 4QJFB 4B9TA 4DL2A 3AEVA 4EBEA 1ZQNA 2J6SA 1A0PA 1COKA 2HW3A 5AIAA 4DFJA 3QUBA 2G06A 2LM1A 1LB2B 3E58A 4UBBA 1D9FA 2GWSA 2A1JB 1L3SA 2ZXHA 4JV1A 1ZQMA 3FAHA 3QU9A 3OGUA 3GIKA 2BCQA 2FMPA 3WK8A 4UB6U 3J81j 2HHSA 1VDVA 2BZFA 1L7MA 7ICGA 4F5NA 4M04A 1Z00B 5DB8A 3IN5A 4ELTA 4PL2A 3RJEA 3DV9A 4C8NA 4KLIA 3D2SA 9ICSA 5A0LA 5BOMA 4Q45A 4JUZA 3S6JA 5KFTA 1Z4OA 1H38A 5KAFU 9ICFA 1TAUA 5BOLA 3NRZA 5KG1A 3IV6A 3TARA 2NRTA 3QX7A 1ZQ1C 5DQGA 3HILA 5HR6A 3WKAA 5EWFA 1EXNA 5AM1A 1NZPA 4EBCA 5DLGA 3N28A 3WK7A 3KBBA 4EELA 3SENA 2A1AA 4PH5A 4F4KA 2KIWA 4I2BA 3PX6A 4M47A 3ED5A 2LYAA 2R8GA 3IG5A 4KLDA 1RQNA 4M9NA 1L3VA 5J2KA 3MR2A 5HR7A 5J0PA 4ED0A 1XC9A 2XICA 3SQIA 3RB6A 1S0NA 3UPQA 5J2BA 2AQ4A 4UB8U 3IG8A 1UHUA 1B4FA 4FBTA 3JPNA 3HT3A 9ICBA 4Z6EA 3ISDA 4ICAA 4PPXA 1TK5A 3MC1A 4GLXA 2W3SA 3PW5A 1TFRA 2Z7JA 4ECZA 3G6VA 2IOFK 1VJ5A 4KLHA 2LMRA 4OCZA 1XSNA 1X6IA 2E8NA 2DUYA 4Q44A 1SZPA 1JALA 1X9WA 5HP4A 1WWUA 2WB1C 1SKRA 2W54A 2W9MA 1TK0A 4ED2A 3KD3A 1ZJNA 1RG6A 3SV4A 1Y88A 3MDCA 5J8YA 4KLOA 3HW8A 2F2AB 3RR8A 4DL3A 9ICWA 2NYVA 2FPKA 2HBMA 3D2QA 4IC9A 2K8AA 2UVRA 2P6RA 5B66U 5J0TA 2GLEA 3NVZA 4ECSA 2IHNA 4QWCA 1Z19A 1HUZA 4C7ZA 2Y9UA 1ZD2P 5KFGA 4OJPA 1D9DA 1A76A 3CNHA 3RB4A 1SL2A 1WCLA 4Q43A 2RQ5A 2OXOA 2E5SA 1NJZA 4QW8A 4NV0A 4DEZA 1Q8KA 3ETRA 2HOQA 1A77A 2YN4A 4OJ5A 4Y2YA 5HMLA 1ED1A 4C4SA 1BPBA 4O3MA 3LWMA 3RB0A 3T5KA 5J0SA 3H8WA 3C1ZA 1JRPA 4P0PA 5L1JA 9ICXA 2FLLA 2W04A 2HHXA 2W9BA 2QARB 5CWRA 5DKWA 5HHIA 3H4BA 1BPZA 1L7PA 9ICUA 1QH9A 1MQ3A 4BJQA 2XCAA 3F2BA 2JMGA 1X2IA 1JX4A 1TV9A 2WTFA 1QSSA 4NXZA 3RR7A 4RPZA 2W7OA 3JPTA 1X9SA 2R8KA 2FMQA 1FFUA 3Q8PB 3E0FA 1PVPA 4QZBA 2VJ5A 3SAHA 5D49A 5KFEA 4A8EA 2WB1F 4PHEA 2I1QA 2H5XA 4F8RA 5KFCA 3GDXA 4NLGA 3ONNA 3NRWA 3BQ0A 7ICMA 2QKQA 2AGQA 1ZQQA 1TAMA 4YMNA 3ZI4A 1T3NA 2P35A 5KFYA 5KG5A 4O5KA 1KTQA 5G5HA 2OH2A 1KFTA 4DSIA 4NJ8A 5EE1A 3WK6A 2KMDA 5AK5A 4US8A 5KFVA 3UQ0A 1U45A 4FZLA 1JIHA 1K5OA 4GXIA 4YMOA 5KFNA 8ICZA 4UW9A 2NV3A 3C23A 4J9SA 4WJ3B 3TADC 4ECRA 4IR1A 1L3UA 3CW2C 2PFNA 4P0QA 1RXWA 2W8KA 2PXIA 9ICHA 4TUQA 1N56A 5J2EA 5GTHU 5KG2A 1OXJA 5AKHA 2HBLA 4O3PA 2KHQA 3C5GA 3N4MB 3BQ1A 3F2CA 2JXJA 3JPPA 1BVSA 1TE2A 2IOHA 5ALIA 2PI4A 1PVRA 2FDRA 4PGQA 2WFAA 4DQRA 1RXVA 4IQWA 2W11A 3KOOA 2L5YA 2IMWP 4U6PA 1U48A 3V7JA 2HHQA 1HEKA 4BUGA 4LZGA 3ALRA 1K1QA 7ICKA 1NKCA 5J0WA 4QWAA 5IIJA 8ICSA 3K1RB 4KN4A 5KFWA 1RQLA 2BCRA 4ELVA 5J2IA 3M7DA 3RJIA 1O08A 3QU7A 2HHVA 1V38A 4JWNA 4C8MA 5E79U 1ZQHA 4FS2A 3QUQA 2ASDA 1SWVA 2DKZA 5ALXA 4Z6DA 2I9GA 3HKZF 4PGYA 1L6NA 5KG7A 4FO6A 2VA8A 4B9SA 1J97A 2JH1A 3UMBA 4U7CA 3TAQA 1S8OA 2FE9A 1ZQIA 4EENA 3TADA 4DL6A 4NLZA 5AM5A 2ZJ8A 5ALPA 5KAIU 3OSNA 3TAPA 2HBJA 5TISU 5ALUA 5KFOA 4M9LA 1V9PA 4PHAA 4ED6A 2XY7A 3C2KA 2JZBB 2R18A 4Y2SA 1ZQRA 2MUTA 3PSTA 4EX6A 2NO5A 3LWLA 1SXDA 7ICPA 2F8LA 3LK9A 1BNOA 4I2JA 2VKQA 5EE0A 7ICQA 1KKXA 5KG6A 2EZXA 3C28A 2EAPA 4ECYA 1WWVA 4EYIB 1N2XA 2R8IA 1U4BA 1ZXIA 4UASA 1ZQFA 1IV8A 5IIKA 4O3QA 5J2AA 2H3ZA 1BGXT 1JXEA 4J9KA 2HVHA 1RYUA 1SXEA 4GIBA 4DOCA 7ICUA 4NWIA 1K1SA 3GU3A 5J0QA 1KRPA 1BPDA 1SV4A 2O6KA 5IINA 1WG8A 3N97B 1KFDA 2OWOA 4I2AA 5C0YA 8ICUA 3Q8RB 3PW7A 3V7LA 4NL9C 3ORYA 3A0HU 2JEJA 4KMOB 3TACB 3FC4A 4OJLA 9ICVA 5JU5A 4KLFA 4F92B 3PW2A 3ISCA 5J0UA 5D4BA 5KFRA 2ASJA 2ISOA 4DCCA 4DSKA 8ICIA 2K8CB 1NK5A 1T8EA 4DFDA 3JPOA 1NKBA 4F71A 5KFSA 4O5EA 2E3TA 2EDUA 2EANA 1ZQCA 4LJXA 2EQYA 4CF5A 2G5HB 2JH7A 2KV2A 4QZDA 4KTQA 1MC8A 2C2DA 4CF3A 1ZOLA 3HWTA 1DK2A 1ZD3A 3Q8KA 2E1FA 3BS5A 5J0RA 2JR5A 1NJWA 2G0AA 1RM6C 2YB4A 2HMXA 4Y2RA 2B6GA 2BGWA 4I29A 1C20A 4DFKA 5H2FU 4O0IA 5KT7A 5ALMA 4RUCA 4YD2A 1UA1A 2ZTEA 4DSJA 4P4PA 1JN3A 5KFIA 3HRDD 2WF7A 2W43A 4O5CA 3WKDA 4UB5A 2KN7A 1RYRA 4UB4A 5F9LA 5AKEA 4DL7A 3BQ7A 3EPIA 4EYHB 5DBBA 4DF4A 3GV5B 4F4XA 2YMLA 1QQ6A 4RQ6A 2KJ5A 5DQIA 3MFIA 4IQUA 2LI6A 5L9XA 4LVSA 3SYZA 2WF5A 4RUAA 5AI6A 1GO3F 1COOA 4USAA 4FE3A 2KK0A 4NLBA 4B9UA 5EWGA 2CRXA 2KE7A 1J2MA 4QW9A 1NK6A 1HIWA 3PO5A 4ED7A 2D6FC 4ECUA 4XRHA 2YMMA 2KFNA 4YR3A 3RJKA 1PZNA 4IRDA 2J6TA 2I6XA 3QE9Y 5AM0A 1T4GA 5ALJA 3RF9A 4I2FA 4UATA 1ZQAA 4JMUA 5AHXA 2M0NA 3FM9A 3ZD9A 1VLBA 2WAQF 3PNCA 3B0YA 4BXOA 5DQHA 1WUDA 5AICA 4RQ8A 5J29A 4P0PB 1TKDA 8ICRA 5AM3A 3D2NA 3KKAA 2W9BB 1N60A 1S77D 2G09A 2FJ6A 4RQ1A 4TUSA 8ICNA 4YR2A 3HJEA 1QQ7A 1MA7A 2AGOA 1IG6A 5KG4A 4CF4A 5J2GA 1T7PA 5HNKA 2NRWA 4YG2A 3ZDAA
chains in the Genus database with same CATH topology
2ZG6A 4OJ6A 2LYAA 3C28A 3PSPA 3IG5A 4P0PA 1PVRA 3GZFA 2DQNB 4AYBF 2XVTA 2YX8A 3AQFA 1UPHA 2DF4B 2KEYA 2W04A 2PMZF 3AQEA 4OJOA 1PVQA 2W03A 3IP4B 2H3ZA 4AYBC 5CRXA 3H0MB 5HR7A 3KZXA 3PZPA 2PMZC 4BJQA 2KJ5A 2OM6A 4U6PA 2KVCA 2KOBA 2RRDA 4NWIA 2XICA 2ZIUB 5T14A 3F2BA 3SQIA 3GU3A 4CDGA 2E1EA 2K89A 2JMGA 1HEKA 2HOFA 2KKPA 4BUGA 3IG8A 2ZIVB 3CYMA 3ALRA 2W7OA 2RHFA 3M6ZA 1F44A 3C29A 3OPXA 1GO3F 1SZHA 4QJFB 1NZBA 4OO1J 4ICAA 3SAGA 5C0YA 3E0FA 2ZIXB 1DRGA 4FE3A 2H3FA 1XO0A 1A0PA 4NLBA 2JGAA 4QNLA 2Z7JA 3N7SC 4ACOA 2CPRA 3PSFA 3NUQA 1KBUA 2CRXA 2RP5A 1PVPA 2GH1A 2G06A 2K4IA 4KMOB 3F2DA 1XNSA 2BDUA 2GOLA 2VJ5A 4OJLA 1Q3UA 4CGZA 2JHDA 3M7DA 4FZMA 3SAHA 2KD1A 1HIWA 2KJ9A 4A8EA 2WB1F 3SAFA 3CRXA 4KX5A 1YT3A 2ZXHA 2D6FC 2KHVA 3RFAA 1T94A 3LVWA 1ECWA 3F5EA 2WB1C 2K8CB 1Q3VA 3MGVA 2ZIUA 3ONNA 2H3VA 3NRWA 3CP8A 2G5IB 2HOIA 2K8BB 1CRXA 4NLCA 2ZIVA 4GFJA 3HKZF 3ICXA 1L6NA 3T79A 2ZIWA 3IN5A 1TAMA 2KNJA 1A6SA 3L3FX 3O0FA 4P0QB 2ZIXA 4PL2A 2G5HB 2DGZA 2F2AB 2LBOA 3RF9A 2OH2A 3H0LB 4KX3A 3K1ZA 2JH1A 2JH7A 2H3QA 2KV2A 2HBMA 3D2QA 2M0NA 4IC9A 4JMUA 4U7CA 2K8AA 2WAQF 5KL8B 3D2SA 2G08A 2XIDA 2KJ8A 2Y0SF 2YB1A 4C0ZA 3KFUF 3H0RB 2LHTA 2Q4TA 5A0LA 3N7RC 2HBJA 1WUDA 2MA1A 3PSIA 4FZLA 2G07A 2E1FA 2VIXA 4QIWF 2K4HA 2Y0SC 4P0PB 2K4EA 1Z19A 2KKVA 4FZNA 3D2NA 2LYBA 2H3IA 1OUQA 2G0AA 2YB4A 3AL0B 2HMXA 4QIWC 2R18A 3N7PD 3LVVA 3LYSA 4OJPA 2F77X 5KL1B 2G09A 2W7PA 2NV3A 2ZXIA 4CRXA 3DEEA 2KICA 2A3VA 2OYYA 3F5AA 2OXOA 1ZQ1C 2E5SA 3HKZC 1URJA 2CN1A 3PSTA 3VCBA 2LKYA 2N1RA 4WJ3B 4NV0A 2XI9A 1MA7A 4PL1A 5HR6A 2F8LA 4P0QA 1P7DA 2VKQA 2HOQA 2HBKA 3VC8A 4OJ5A 1Z1BA 1D8BA 3F53A 2F76X 4BX9C 2WAQC 2HBLA 2ZIWB 1ED1A 3SMVA 2MRLA 1IIPA 2KHQA 4O3MA 3F2CA 2KIWA 2VJ4A 3M6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CRX A;  1DRG A;  3C28 A;  1XO0 A;  1A0P A;  3LYS A;  1PVR A;  1KBU A;  4ACO A;  2CRX A;  1PVP A;  2KEY A;  4CRX A;  1PVQ A;  2A3V A;  1XNS A;  1Q3U A;  2OXO A;  5CRX A;  2KD1 A;  1MA7 A;  2KJ9 A;  4A8E A;  2KJ5 A;  3CRX A;  1P7D A;  2KJ8 A;  2KOB A;  1Z1B A;  2KHV A;  2HOF A;  2KKP A;  1Q3V A;  3MGV A;  1Z19 A;  2KHQ A;  2KKV A;  3C29 A;  1F44 A;  3NRW A;  1NZB A;  2KIW A;  1OUQ A;  2HOI A; 
#chains in the Genus database with same CATH topology
 5AK3 A;  3PY8 A;  1XO1 A;  5ALG A;  4F50 A;  3PSP A;  5KFH A;  4RPY A;  4UAY A;  4FBU A;  1FEZ A;  5DDY A;  5KFJ A;  4HYK A;  2KOB A;  2E1E A;  2P66 A;  2HOF A;  2B21 A;  1ZQO A;  4RQ4 A;  5AI4 A;  3K75 D;  2RHF A;  3M6Z A;  4J9L A;  1NZB A;  4BGD A;  4OO1 J;  4K4H A;  5DB6 A;  2BR0 A;  1XO0 A;  2RP5 A;  3Q8L A;  3C2L A;  4K4G A;  1DOQ A;  1U47 A;  4CGZ A;  2XGP A;  5J2H A;  3NVW A;  4RU9 A;  1L7N A;  2KHV A;  2OHF A;  4DSL A;  4O9M A;  2ZIU A;  7ICN A;  4DLE A;  4QZ8 A;  4I2E A;  3PX0 A;  4RNM A;  2AJQ A;  1B43 A;  5AKJ A;  5ALO A;  1QTM A;  5L1I A;  2M9N A;  4P0Q B;  4KLG A;  2AU0 A;  2DGZ A;  3WK9 A;  1DGS A;  4KMU A;  2H3Q A;  2CXY A;  5AI0 A;  3WK4 A;  2Q4T A;  3PX4 A;  3UXP A;  4DSF A;  3R9K A;  4ELU A;  4YP3 A;  5KNI A;  4DOA A;  5AKX A;  4IRK A;  5L1K A;  4CRX A;  4YVZ A;  5CR0 A;  4Y2P A;  3EUB 2;  5ALY A;  4F72 A;  2ATL A;  7ICR A;  3RH4 A;  4PZN A;  4DQS A;  5ALK A;  5KT3 A;  1IIP A;  4GFJ A;  2ZG6 A;  4ED3 A;  4EX7 A;  2PI5 A;  1DGJ A;  2PFP A;  1U49 A;  5AIB A;  3QU5 A;  3IHQ B;  1DXS A;  3ZDC A;  4I2I A;  4B9V A;  1KW4 A;  3T5H A;  9ICC A;  3H4D A;  3ZDD A;  5B5E U;  1NK8 A;  1ZQS A;  2V9W A;  4RZR A;  4UAZ A;  4PJ0 U;  2H3F A;  1IXR A;  1AQ6 A;  2CPR A;  5DG9 A;  1ZQK A;  4KLJ A;  2BDU A;  3BJY A;  4FZM A;  2XO7 A;  4MF2 A;  2UVU A;  3RRH A;  2UVV A;  4XA5 A;  3TQ1 A;  2E8M A;  2LPE A;  2C2R A;  3MGV A;  2EZZ A;  8ICA A;  2MUT B;  5DBC A;  4M6W A;  3AN1 A;  2KNJ A;  4QWD A;  3L3F X;  7ICS A;  2HVI A;  4Y2V A;  3K1Z A;  5KFX A;  8ICT A;  2YB1 A;  5AKG A;  4J9P A;  2R8H A;  4YXM A;  5GTI U;  2G07 A;  3OSP A;  2Y0S C;  2LYB A;  3QZ8 A;  3T5L A;  1N61 A;  7ICF A;  9ICN A;  3JPS A;  4I2H A;  3LVV A;  4MHV A;  2MAX A;  5AKL A;  2ZTC A;  1ZQG A;  2A3V A;  3RJF A;  2OYY A;  3VCB A;  3HKZ C;  2LKY A;  2XI9 A;  3HPO A;  3OJS A;  2HBK A;  5DB9 A;  3F53 A;  5D46 A;  2D3D A;  2ZUC A;  7ICV A;  4F5P A;  1ARO P;  3QEB Z;  4LZD A;  4OJ6 A;  4DS5 A;  5KG3 A;  5IIL A;  3AQF A;  5ALR A;  4AYB C;  4TUP A;  5F9N A;  1SKW A;  2OM6 A;  4IS7 A;  4ECV A;  3V6K A;  5KFZ A;  4O3R A;  3PO4 A;  3OPX A;  8ICY A;  4RQ2 A;  1PUZ A;  3NS1 A;  5JRT A;  3H8J A;  3PSF A;  4GXJ A;  1QQ5 A;  5J0X A;  3D6J A;  2KTQ A;  3QU4 A;  4YMM A;  4F4W A;  3BS5 B;  1QCK A;  3V7K A;  1X66 A;  2V4R A;  4UQG A;  4UAW A;  5KFM A;  5CB1 A;  2KIV A;  2KVS A;  5ALD A;  1FO4 A;  4DQP A;  4YN4 A;  2WF8 A;  5AKI A;  5EOZ A;  5J0O A;  3ZDB A;  3C21 A;  3V6J A;  2RDJ A;  3TI0 A;  4DFM A;  1NKE A;  2KJ8 A;  2Y0S F;  1ZQY A;  1FIQ A;  4Z6C A;  1M6Y A;  2VIX A;  4KN7 A;  4C4T A;  4FZN A;  1KDH A;  3KHR A;  4Y2U A;  1X40 A;  3C5F A;  2BPF A;  4O3S A;  2N1R A;  4F5R A;  1L3T A;  7ICO A;  8ICO A;  4JV2 A;  1Z1B A;  4NY8 A;  3G6X A;  2B0C A;  1LKY A;  2NRZ A;  2DL0 A;  4BX9 C;  3U26 A;  3BDP A;  2ZIW B;  4R63 A;  1NI3 A;  8ICH A;  5DGB A;  4AYB F;  2DQN B;  3K4G A;  1UPH A;  4BDP A;  4F2S A;  1V85 A;  3PZP A;  4J9R A;  4UAV A;  2F1I A;  2A19 A;  4DL5 A;  4EEY A;  5ALE A;  2F8K A;  2KKP A;  4QZA A;  4K4I A;  1Z1V A;  2OEH A;  3HX0 A;  4QNL A;  4F5O A;  1D8Y A;  2GH1 A;  3QUC A;  1SV0 C;  4BXO B;  2K4P A;  2GOL A;  1Q3U A;  4QZE A;  2F3N A;  3UQ2 A;  1YT3 A;  1ZQT A;  3BQT A;  4QWE A;  2EH9 A;  3IRU A;  2KG5 A;  3L5K A;  3V6H A;  1ZJM A;  9ICJ A;  2KSO A;  1CRX A;  8ICM A;  4C7Y A;  3T79 A;  3JPR A;  5ALS A;  3WKE A;  2ZIX A;  8ICW A;  3GFK B;  4ZOH C;  3SI8 A;  4B9L A;  2BCU A;  3UXN A;  1V97 A;  5AM4 A;  5AI8 A;  3GIJ A;  4ECW A;  2AH5 A;  2RLT A;  3H8S A;  5KFB A;  4QWB A;  3N7R C;  1NK9 A;  4UBC A;  5ALZ A;  1NK7 A;  3L4P A;  2LYH A;  1HJP A;  2F1J A;  2ALZ A;  1U9L A;  1SB3 C;  2DWQ A;  2NRX A;  1ZQP A;  5DBA A;  2KZ3 A;  1D8B A;  5KFF A;  5KT5 A;  2WAQ C;  2C22 A;  1ZQZ A;  3Q8M A;  4UB3 A;  3QUT A;  5J2C A;  1O03 A;  1B0X A;  2XGQ A;  4JK1 A;  4F5Q A;  1SV0 A;  3UM9 A;  2PMZ C;  3IM1 A;  5T14 A;  2ZIU B;  1UCV A;  1Z4N A;  5KFL A;  1F44 A;  2VAN A;  3SAG A;  5ALV A;  3UXO A;  2JRZ A;  8ICB A;  1UT8 A;  1JMS A;  4NL9 A;  3RTV A;  1S9F A;  3H8M A;  4QZF A;  4KLL A;  2KJ9 A;  4YFK A;  1Z3E B;  1T3Q A;  5ALN A;  2K60 A;  9ICG A;  5KFU A;  3RFA A;  1T94 A;  1ECW A;  1SL1 A;  3EZ5 A;  2WF6 A;  5HHH A;  1XSP A;  2C28 A;  9ICM A;  2ZIW A;  3C1Y A;  4YCX A;  4Q8E A;  2ZUB A;  4FS1 A;  7ICI A;  3AL0 B;  1LVH A;  3ISB A;  1ZQV A;  2PFQ A;  2IBK A;  2XY6 A;  4OD0 A;  4RQ3 A;  2KKV A;  4F93 B;  1OUQ A;  8ICX A;  5KL1 B;  5AKK A;  4R66 A;  1JUD A;  3QXG A;  3PR5 B;  4Y2T A;  1ZQB A;  3AMZ A;  3H40 A;  2BCV A;  4PL1 A;  4DFP A;  7ICL A;  5CA7 A;  1UT5 A;  3MR3 A;  2QLT A;  2VA3 A;  5KFK A;  3HP6 A;  2YTU A;  1S0V A;  2RDI A;  3SZ2 A;  1NOM A;  4KIT B;  1PK1 A;  4DLG A;  2XVT A;  4Y2X A;  2PMZ F;  3AQE A;  1PVQ A;  5J2D A;  8ICE A;  4R8U A;  3IP4 B;  4J03 A;  2KVC A;  2HHW A;  3JPQ A;  5HMM A;  4UAR A;  4J9N A;  2K89 A;  5TZV A;  2WHE A;  5AK6 A;  1N5W A;  4J9M A;  4NM1 A;  1X9M A;  5AK4 A;  1KLN A;  3KHH A;  4M6W B;  3C29 A;  3MFH A;  1SZH A;  1J2N A;  4RT3 A;  1DRG A;  1RYS A;  1B22 A;  1KBU A;  4ACO A;  3NVY A;  2FMS A;  3T5J A;  4XQ8 A;  9ICO A;  4RPX A;  4KLE A;  5G5G A;  2BKE A;  3EWA A;  1L5U A;  3I1Y A;  3SAF A;  3PW4 A;  3KZI U;  4C8L A;  1SKS A;  4DSE A;  5KT4 A;  4KLT A;  2OCE A;  3F5E A;  2NRV A;  4ED8 A;  9ICT A;  1IM4 A;  4EZ9 A;  3CP8 A;  4DF8 A;  5J8Y C;  2ZIV A;  4QZ9 A;  3PVX A;  4PZO A;  3GV8 B;  2HCF A;  5KFA A;  4R64 A;  2YMP A;  2G08 A;  2LHT A;  2HHU A;  1KL9 A;  2MA1 A;  1XWL A;  5ALT A;  3QYP A;  4QZI A;  4RQ0 A;  4UB2 A;  1XS9 D;  4RQM A;  2Y1I A;  2F77 X;  2W9A A;  1CEZ A;  5EE9 A;  3BS7 A;  4Y2Q A;  4RQ5 A;  2FPL A;  3F5A A;  2KZM A;  9ICE A;  1URJ A;  2CN1 A;  2W8L A;  5ALL A;  4CE6 A;  5CHG A;  1P7D A;  3M9N B;  3RH5 A;  2F76 X;  1N63 A;  4UAU A;  3OHA A;  2C2E A;  2HSZ A;  4DL4 A;  1CUK A;  2MU2 A;  4Y2J A;  4RQN A;  4GC7 A;  3RJG A;  2W9C A;  5AM2 A;  4EZ6 A;  2DF4 B;  4KLM A;  2KEY A;  4KLQ A;  4OJO A;  1BPY A;  2P6U A;  2IA6 A;  3H0M B;  1ZQJ A;  2J6U A;  4JB3 A;  3PR4 A;  1RDF A;  4M2Y A;  2PKE A;  3CYM A;  3OTQ A;  2NO4 A;  5ALF A;  3ETL A;  5CJ7 A;  5AI5 A;  2EAO A;  3N7S C;  1QSL A;  3NUQ A;  3THV A;  2KFZ A;  1SIJ A;  3RJJ A;  3F2D A;  2JHD A;  2XY5 A;  1XSL A;  2KD1 A;  3FDS A;  5ALW A;  2JEG A;  1L8L A;  3MR6 A;  3GII A;  4C4R A;  5CEH A;  5KFQ A;  3MDA A;  1Q3V A;  3I28 A;  1Q46 A;  8ICJ A;  7ICT A;  2G5I B;  3SEI A;  4M9G A;  8ICG A;  3KTQ A;  5FP0 A;  8ICK A;  1A6S A;  5JTI A;  1ZRN A;  4DWI A;  9ICA A;  2W3R A;  4PHP A;  4TQR A;  1TAQ A;  1LKY B;  3OHB A;  1ZYQ A;  5J2F A;  4NM2 A;  3RBD A;  2FLP A;  1YZ7 A;  9ICL A;  2DFL A;  4NLK A;  2A1J A;  1ZQL A;  4QIW C;  2AGP A;  3RH6 A;  5IIM A;  1D8L A;  3LYS A;  5AKY A;  5DGA A;  2AQ0 A;  2BCS A;  2ZXI A;  4DQQ A;  2AHO B;  2KIC A;  4TUR A;  4MFC A;  4P4M A;  2F1H A;  3V72 A;  3QEA Z;  1Z00 A;  3VC8 A;  3WKC A;  4IQV A;  4F4Z A;  1FFV A;  3SMV A;  1N5X A;  7ICH A;  1F5S A;  2FI1 A;  1X6J A;  4TQS A;  2YX8 A;  1DK3 A;  1S0O A;  4I28 A;  3KHG A;  4CCH A;  4EEK A;  4PGX A;  4X5V A;  2YQE A;  5BPC A;  2RRD A;  2E8P A;  2KSO B;  4Z6F A;  2I5H A;  3GIL A;  1BPX A;  5CP2 A;  4F91 B;  1RZT A;  2ZIX B;  2YMQ A;  5J2J A;  1YZ6 A;  3Q8Q B;  4J9O A;  2JGA A;  2EAM A;  2JEI A;  4JV0 A;  2K4I A;  4B9M A;  3G6Y A;  4XUS A;  4PHD A;  1XNS A;  3BZC A;  4MEY A;  1XU4 A;  1RPL A;  1OW5 A;  2QB1 A;  1WCN A;  4MF8 A;  2ASL A;  5KG0 A;  3M9M B;  4ED1 A;  3TFS A;  8ICC A;  1KQQ A;  3E2E A;  3WU2 U;  3AM9 A;  2K8B B;  4NLC A;  3H7I A;  2DKX A;  8ICV A;  4G9B A;  3B9J A;  3RJH A;  3FYH A;  3EW9 A;  3RAX A;  1S97 A;  2F44 A;  1SGG A;  4MFF A;  5KL8 B;  2XID A;  1C7Y A;  3KFU F;  2BQ3 A;  3PSI A;  5DB7 A;  4MFA A;  4I27 A;  3MGI A;  4QIW F;  2K4H A;  4P2H A;  1S0M A;  2H3I A;  3I76 A;  4I2D A;  5JUM A;  1JI7 A;  8ICP A;  3TFR A;  9ICI A;  2W7P A;  3PW0 A;  3M9O B;  4IQT A;  3DEE A;  3NGD A;  4ECQ A;  4E0D A;  2ZTD A;  3KHL A;  1N48 A;  9ICK A;  2QB0 B;  3EPG A;  2JEF A;  3WKB A;  3QZ7 A;  2XC9 A;  5AKZ A;  4GXK A;  2W55 A;  4Q8F A;  1QLN A;  3T3F A;  3MAB A;  1WYG A;  5EWE A;  1ZQW A;  9ICQ A;  5J0Y A;  2YY6 A;  1ZQU A;  3KZX A;  4KLS A;  4CDG A;  4MEX A;  4F2R A;  4RNO A;  3SR6 A;  2IHM A;  4JWM A;  2LM4 A;  5AI9 A;  2BQU A;  2ZJA A;  3AU6 A;  4EBD A;  1KSP A;  1CI4 A;  4CNQ A;  3MR5 A;  3RAQ A;  4I2C A;  1S76 D;  2QAR A;  4KX5 A;  4I2G A;  4IRC A;  2Y9T A;  3GV7 B;  3M8R A;  3TAN A;  3LVW A;  4IL6 U;  4DOB A;  8ICQ A;  2VA2 A;  3NTU A;  1ZQD A;  2H3V A;  1NNL A;  1KFS A;  3ICX A;  4O3O A;  1LV5 A;  2ISP A;  2ZUD A;  3PV8 A;  4US9 A;  5DDM A;  3O0F A;  4UB1 A;  5C5J A;  2DPI A;  3H0L B;  1X42 A;  2HI0 A;  1S10 A;  4M9J A;  3B0X A;  3GIM A;  2FLN A;  4C0Z A;  2EZY A;  3NVV A;  3H0R B;  2ESE A;  3ZD8 A;  3TKA A;  4AP9 A;  1TK8 A;  5KT6 A;  1PK1 B;  2K4E A;  3WK5 A;  3RB3 A;  1QSY A;  8ICL A;  5IIO A;  3QU2 A;  9ICP A;  4YXJ A;  3IDW A;  5DG7 A;  4R8U B;  2BQR A;  2R8J A;  4ECX A;  4BWJ A;  2DPJ A;  2HHT A;  5KT2 A;  1HUO A;  4KLU A;  5ALQ A;  4F4Y A;  2ZJ5 A;  3BQ2 A;  4B9N A;  4C8O A;  2KP7 A;  3NAS A;  3SD7 A;  3PMN A;  4RQ7 A;  4R65 A;  4FFD A;  1L8O A;  4ECT A;  1ZD5 A;  2HDO A;  3GQC A;  4YQW A;  3AUO A;  2KZZ A;  1NK0 A;  2WF9 A;  4DO9 A;  5L1M A;  1ZRM A;  4DS4 A;  3AU2 A;  1ZET A;  1BPE A;  3LDA A;  2FPM A;  3UMC A;  2ZIV B;  5K4L A;  5EE3 A;  1MSW D;  4F3O A;  1JRO A;  1JXL A;  2XCP A;  3ZDE A;  1NJX A;  4DQI A;  4RNN A;  1S5L U;  3UMG A;  3Q8S B;  1X9X A;  1F0M A;  5ALH A;  4G3I A;  4B6J A;  4ZH4 A;  5DLF A;  3MBY A;  3CRX A;  2JV3 A;  5F3X B;  4O3N A;  4IR9 A;  3BZK A;  2DBY A;  5DG8 A;  1ZQE A;  4QZH A;  2QB0 A;  3SV3 A;  3RBE A;  3EYZ A;  1TVA A;  2HOI A;  5L1L A;  4M0A A;  3PML A;  1MN8 A;  2V4Q A;  3A0B U;  4C8K A;  3M1Y A;  3MGH A;  5KFP A;  1L7O A;  4RT2 A;  2LBO A;  5III A;  4J9Q A;  4KX3 A;  7ICE A;  4P4O A;  2MSN A;  2BDP A;  3C2M A;  2W9C B;  3KKA C;  4M9H A;  1NK4 A;  2GO7 A;  4C80 A;  5KFD A;  3N7P D;  1KEJ A;  4YD1 A;  8ICF A;  2BPG A;  5KTQ A;  4NLN A;  2ODG A;  2UVW A;  1SL0 A;  9ICR A;  1MQ2 A;  1PK3 A;  1NJY A;  1UQV A;  3DDH A;  2IOF A;  3RRG A;  2AXT U;  1ZD4 A;  2ES6 A;  3OJU A;  2MRL A;  2D8C A;  1BNP A;  2VJ4 A;  3M6K A;  4YR0 A;  4HAI A;  3GZF A;  1ZQX A;  2JZB A;  2BPC A;  2W03 A;  2PFO A;  5CRX A;  4QZC A;  2BHN A;  1N62 A;  2Q0Z X;  4QZG A;  1SWW A;  1KN5 A;  4GC6 A;  3M8S A;  7ICJ A;  3QNM A;  2Y1J A;  1UA0 A;  4BWM A;  2E8O A;  4QJF B;  4B9T A;  4DL2 A;  3AEV A;  4EBE A;  1ZQN A;  2J6S A;  1A0P A;  1COK A;  2HW3 A;  5AIA A;  4DFJ A;  3QUB A;  2G06 A;  2LM1 A;  1LB2 B;  3E58 A;  4UBB A;  1D9F A;  2GWS A;  2A1J B;  1L3S A;  2ZXH A;  4JV1 A;  1ZQM A;  3FAH A;  3QU9 A;  3OGU A;  3GIK A;  2BCQ A;  2FMP A;  3WK8 A;  4UB6 U;  3J81 j;  2HHS A;  1VDV A;  2BZF A;  1L7M A;  7ICG A;  4F5N A;  4M04 A;  1Z00 B;  5DB8 A;  3IN5 A;  4ELT A;  4PL2 A;  3RJE A;  3DV9 A;  4C8N A;  4KLI A;  3D2S A;  9ICS A;  5A0L A;  5BOM A;  4Q45 A;  4JUZ A;  3S6J A;  5KFT A;  1Z4O A;  1H38 A;  5KAF U;  9ICF A;  1TAU A;  5BOL A;  3NRZ A;  5KG1 A;  3IV6 A;  3TAR A;  2NRT A;  3QX7 A;  1ZQ1 C;  5DQG A;  3HIL A;  5HR6 A;  3WKA A;  5EWF A;  1EXN A;  5AM1 A;  1NZP A;  4EBC A;  5DLG A;  3N28 A;  3WK7 A;  3KBB A;  4EEL A;  3SEN A;  2A1A A;  4PH5 A;  4F4K A;  2KIW A;  4I2B A;  3PX6 A;  4M47 A;  3ED5 A;  2LYA A;  2R8G A;  3IG5 A;  4KLD A;  1RQN A;  4M9N A;  1L3V A;  5J2K A;  3MR2 A;  5HR7 A;  5J0P A;  4ED0 A;  1XC9 A;  2XIC A;  3SQI A;  3RB6 A;  1S0N A;  3UPQ A;  5J2B A;  2AQ4 A;  4UB8 U;  3IG8 A;  1UHU A;  1B4F A;  4FBT A;  3JPN A;  3HT3 A;  9ICB A;  4Z6E A;  3ISD A;  4ICA A;  4PPX A;  1TK5 A;  3MC1 A;  4GLX A;  2W3S A;  3PW5 A;  1TFR A;  2Z7J A;  4ECZ A;  3G6V A;  2IOF K;  1VJ5 A;  4KLH A;  2LMR A;  4OCZ A;  1XSN A;  1X6I A;  2E8N A;  2DUY A;  4Q44 A;  1SZP A;  1JAL A;  1X9W A;  5HP4 A;  1WWU A;  2WB1 C;  1SKR A;  2W54 A;  2W9M A;  1TK0 A;  4ED2 A;  3KD3 A;  1ZJN A;  1RG6 A;  3SV4 A;  1Y88 A;  3MDC A;  5J8Y A;  4KLO A;  3HW8 A;  2F2A B;  3RR8 A;  4DL3 A;  9ICW A;  2NYV A;  2FPK A;  2HBM A;  3D2Q A;  4IC9 A;  2K8A A;  2UVR A;  2P6R A;  5B66 U;  5J0T A;  2GLE A;  3NVZ A;  4ECS A;  2IHN A;  4QWC A;  1Z19 A;  1HUZ A;  4C7Z A;  2Y9U A;  1ZD2 P;  5KFG A;  4OJP A;  1D9D A;  1A76 A;  3CNH A;  3RB4 A;  1SL2 A;  1WCL A;  4Q43 A;  2RQ5 A;  2OXO A;  2E5S A;  1NJZ A;  4QW8 A;  4NV0 A;  4DEZ A;  1Q8K A;  3ETR A;  2HOQ A;  1A77 A;  2YN4 A;  4OJ5 A;  4Y2Y A;  5HML A;  1ED1 A;  4C4S A;  1BPB A;  4O3M A;  3LWM A;  3RB0 A;  3T5K A;  5J0S A;  3H8W A;  3C1Z A;  1JRP A;  4P0P A;  5L1J A;  9ICX A;  2FLL A;  2W04 A;  2HHX A;  2W9B A;  2QAR B;  5CWR A;  5DKW A;  5HHI A;  3H4B A;  1BPZ A;  1L7P A;  9ICU A;  1QH9 A;  1MQ3 A;  4BJQ A;  2XCA A;  3F2B A;  2JMG A;  1X2I A;  1JX4 A;  1TV9 A;  2WTF A;  1QSS A;  4NXZ A;  3RR7 A;  4RPZ A;  2W7O A;  3JPT A;  1X9S A;  2R8K A;  2FMQ A;  1FFU A;  3Q8P B;  3E0F A;  1PVP A;  4QZB A;  2VJ5 A;  3SAH A;  5D49 A;  5KFE A;  4A8E A;  2WB1 F;  4PHE A;  2I1Q A;  2H5X A;  4F8R A;  5KFC A;  3GDX A;  4NLG A;  3ONN A;  3NRW A;  3BQ0 A;  7ICM A;  2QKQ A;  2AGQ A;  1ZQQ A;  1TAM A;  4YMN A;  3ZI4 A;  1T3N A;  2P35 A;  5KFY A;  5KG5 A;  4O5K A;  1KTQ A;  5G5H A;  2OH2 A;  1KFT A;  4DSI A;  4NJ8 A;  5EE1 A;  3WK6 A;  2KMD A;  5AK5 A;  4US8 A;  5KFV A;  3UQ0 A;  1U45 A;  4FZL A;  1JIH A;  1K5O A;  4GXI A;  4YMO A;  5KFN A;  8ICZ A;  4UW9 A;  2NV3 A;  3C23 A;  4J9S A;  4WJ3 B;  3TAD C;  4ECR A;  4IR1 A;  1L3U A;  3CW2 C;  2PFN A;  4P0Q A;  1RXW A;  2W8K A;  2PXI A;  9ICH A;  4TUQ A;  1N56 A;  5J2E A;  5GTH U;  5KG2 A;  1OXJ A;  5AKH A;  2HBL A;  4O3P A;  2KHQ A;  3C5G A;  3N4M B;  3BQ1 A;  3F2C A;  2JXJ A;  3JPP A;  1BVS A;  1TE2 A;  2IOH A;  5ALI A;  2PI4 A;  1PVR A;  2FDR A;  4PGQ A;  2WFA A;  4DQR A;  1RXV A;  4IQW A;  2W11 A;  3KOO A;  2L5Y A;  2IMW P;  4U6P A;  1U48 A;  3V7J A;  2HHQ A;  1HEK A;  4BUG A;  4LZG A;  3ALR A;  1K1Q A;  7ICK A;  1NKC A;  5J0W A;  4QWA A;  5IIJ A;  8ICS A;  3K1R B;  4KN4 A;  5KFW A;  1RQL A;  2BCR A;  4ELV A;  5J2I A;  3M7D A;  3RJI A;  1O08 A;  3QU7 A;  2HHV A;  1V38 A;  4JWN A;  4C8M A;  5E79 U;  1ZQH A;  4FS2 A;  3QUQ A;  2ASD A;  1SWV A;  2DKZ A;  5ALX A;  4Z6D A;  2I9G A;  3HKZ F;  4PGY A;  1L6N A;  5KG7 A;  4FO6 A;  2VA8 A;  4B9S A;  1J97 A;  2JH1 A;  3UMB A;  4U7C A;  3TAQ A;  1S8O A;  2FE9 A;  1ZQI A;  4EEN A;  3TAD A;  4DL6 A;  4NLZ A;  5AM5 A;  2ZJ8 A;  5ALP A;  5KAI U;  3OSN A;  3TAP A;  2HBJ A;  5TIS U;  5ALU A;  5KFO A;  4M9L A;  1V9P A;  4PHA A;  4ED6 A;  2XY7 A;  3C2K A;  2JZB B;  2R18 A;  4Y2S A;  1ZQR A;  2MUT A;  3PST A;  4EX6 A;  2NO5 A;  3LWL A;  1SXD A;  7ICP A;  2F8L A;  3LK9 A;  1BNO A;  4I2J A;  2VKQ A;  5EE0 A;  7ICQ A;  1KKX A;  5KG6 A;  2EZX A;  3C28 A;  2EAP A;  4ECY A;  1WWV A;  4EYI B;  1N2X A;  2R8I A;  1U4B A;  1ZXI A;  4UAS A;  1ZQF A;  1IV8 A;  5IIK A;  4O3Q A;  5J2A A;  2H3Z A;  1BGX T;  1JXE A;  4J9K A;  2HVH A;  1RYU A;  1SXE A;  4GIB A;  4DOC A;  7ICU A;  4NWI A;  1K1S A;  3GU3 A;  5J0Q A;  1KRP A;  1BPD A;  1SV4 A;  2O6K A;  5IIN A;  1WG8 A;  3N97 B;  1KFD A;  2OWO A;  4I2A A;  5C0Y A;  8ICU A;  3Q8R B;  3PW7 A;  3V7L A;  4NL9 C;  3ORY A;  3A0H U;  2JEJ A;  4KMO B;  3TAC B;  3FC4 A;  4OJL A;  9ICV A;  5JU5 A;  4KLF A;  4F92 B;  3PW2 A;  3ISC A;  5J0U A;  5D4B A;  5KFR A;  2ASJ A;  2ISO A;  4DCC A;  4DSK A;  8ICI A;  2K8C B;  1NK5 A;  1T8E A;  4DFD A;  3JPO A;  1NKB A;  4F71 A;  5KFS A;  4O5E A;  2E3T A;  2EDU A;  2EAN A;  1ZQC A;  4LJX A;  2EQY A;  4CF5 A;  2G5H B;  2JH7 A;  2KV2 A;  4QZD A;  4KTQ A;  1MC8 A;  2C2D A;  4CF3 A;  1ZOL A;  3HWT A;  1DK2 A;  1ZD3 A;  3Q8K A;  2E1F A;  3BS5 A;  5J0R A;  2JR5 A;  1NJW A;  2G0A A;  1RM6 C;  2YB4 A;  2HMX A;  4Y2R A;  2B6G A;  2BGW A;  4I29 A;  1C20 A;  4DFK A;  5H2F U;  4O0I A;  5KT7 A;  5ALM A;  4RUC A;  4YD2 A;  1UA1 A;  2ZTE A;  4DSJ A;  4P4P A;  1JN3 A;  5KFI A;  3HRD D;  2WF7 A;  2W43 A;  4O5C A;  3WKD A;  4UB5 A;  2KN7 A;  1RYR A;  4UB4 A;  5F9L A;  5AKE A;  4DL7 A;  3BQ7 A;  3EPI A;  4EYH B;  5DBB A;  4DF4 A;  3GV5 B;  4F4X A;  2YML A;  1QQ6 A;  4RQ6 A;  2KJ5 A;  5DQI A;  3MFI A;  4IQU A;  2LI6 A;  5L9X A;  4LVS A;  3SYZ A;  2WF5 A;  4RUA A;  5AI6 A;  1GO3 F;  1COO A;  4USA A;  4FE3 A;  2KK0 A;  4NLB A;  4B9U A;  5EWG A;  2CRX A;  2KE7 A;  1J2M A;  4QW9 A;  1NK6 A;  1HIW A;  3PO5 A;  4ED7 A;  2D6F C;  4ECU A;  4XRH A;  2YMM A;  2KFN A;  4YR3 A;  3RJK A;  1PZN A;  4IRD A;  2J6T A;  2I6X A;  3QE9 Y;  5AM0 A;  1T4G A;  5ALJ A;  3RF9 A;  4I2F A;  4UAT A;  1ZQA A;  4JMU A;  5AHX A;  2M0N A;  3FM9 A;  3ZD9 A;  1VLB A;  2WAQ F;  3PNC A;  3B0Y A;  4BXO A;  5DQH A;  1WUD A;  5AIC A;  4RQ8 A;  5J29 A;  4P0P B;  1TKD A;  8ICR A;  5AM3 A;  3D2N A;  3KKA A;  2W9B B;  1N60 A;  1S77 D;  2G09 A;  2FJ6 A;  4RQ1 A;  4TUS A;  8ICN A;  4YR2 A;  3HJE A;  1QQ7 A;  1MA7 A;  2AGO A;  1IG6 A;  5KG4 A;  4CF4 A;  5J2G A;  1T7P A;  5HNK A;  2NRW A;  4YG2 A;  3ZDA A; 
#chains in the Genus database with same CATH homology
 2ZG6 A;  4OJ6 A;  2LYA A;  3C28 A;  3PSP A;  3IG5 A;  4P0P A;  1PVR A;  3GZF A;  2DQN B;  4AYB F;  2XVT A;  2YX8 A;  3AQF A;  1UPH A;  2DF4 B;  2KEY A;  2W04 A;  2PMZ F;  3AQE A;  4OJO A;  1PVQ A;  2W03 A;  3IP4 B;  2H3Z A;  4AYB C;  5CRX A;  3H0M B;  5HR7 A;  3KZX A;  3PZP A;  2PMZ C;  4BJQ A;  2KJ5 A;  2OM6 A;  4U6P A;  2KVC A;  2KOB A;  2RRD A;  4NWI A;  2XIC A;  2ZIU B;  5T14 A;  3F2B A;  3SQI A;  3GU3 A;  4CDG A;  2E1E A;  2K89 A;  2JMG A;  1HEK A;  2HOF A;  2KKP A;  4BUG A;  3IG8 A;  2ZIV B;  3CYM A;  3ALR A;  2W7O A;  2RHF A;  3M6Z A;  1F44 A;  3C29 A;  3OPX A;  1GO3 F;  1SZH A;  4QJF B;  1NZB A;  4OO1 J;  4ICA A;  3SAG A;  5C0Y A;  3E0F A;  2ZIX B;  1DRG A;  4FE3 A;  2H3F A;  1XO0 A;  1A0P A;  4NLB A;  2JGA A;  4QNL A;  2Z7J A;  3N7S C;  4ACO A;  2CPR A;  3PSF A;  3NUQ A;  1KBU A;  2CRX A;  2RP5 A;  1PVP A;  2GH1 A;  2G06 A;  2K4I A;  4KMO B;  3F2D A;  1XNS A;  2BDU A;  2GOL A;  2VJ5 A;  4OJL A;  1Q3U A;  4CGZ A;  2JHD A;  3M7D A;  4FZM A;  3SAH A;  2KD1 A;  1HIW A;  2KJ9 A;  4A8E A;  2WB1 F;  3SAF A;  3CRX A;  4KX5 A;  1YT3 A;  2ZXH A;  2D6F C;  2KHV A;  3RFA A;  1T94 A;  3LVW A;  1ECW A;  3F5E A;  2WB1 C;  2K8C B;  1Q3V A;  3MGV A;  2ZIU A;  3ONN A;  2H3V A;  3NRW A;  3CP8 A;  2G5I B;  2HOI A;  2K8B B;  1CRX A;  4NLC A;  2ZIV A;  4GFJ A;  3HKZ F;  3ICX A;  1L6N A;  3T79 A;  2ZIW A;  3IN5 A;  1TAM A;  2KNJ A;  1A6S A;  3L3F X;  3O0F A;  4P0Q B;  2ZIX A;  4PL2 A;  2G5H B;  2DGZ A;  2F2A B;  2LBO A;  3RF9 A;  2OH2 A;  3H0L B;  4KX3 A;  3K1Z A;  2JH1 A;  2JH7 A;  2H3Q A;  2KV2 A;  2HBM A;  3D2Q A;  2M0N A;  4IC9 A;  4JMU A;  4U7C A;  2K8A A;  2WAQ F;  5KL8 B;  3D2S A;  2G08 A;  2XID A;  2KJ8 A;  2Y0S F;  2YB1 A;  4C0Z A;  3KFU F;  3H0R B;  2LHT A;  2Q4T A;  5A0L A;  3N7R C;  2HBJ A;  1WUD A;  2MA1 A;  3PSI A;  4FZL A;  2G07 A;  2E1F A;  2VIX A;  4QIW F;  2K4H A;  2Y0S C;  4P0P B;  2K4E A;  1Z19 A;  2KKV A;  4FZN A;  3D2N A;  2LYB A;  2H3I A;  1OUQ A;  2G0A A;  2YB4 A;  3AL0 B;  2HMX A;  4QIW C;  2R18 A;  3N7P D;  3LVV A;  3LYS A;  4OJP A;  2F77 X;  5KL1 B;  2G09 A;  2W7P A;  2NV3 A;  2ZXI A;  4CRX A;  3DEE A;  2KIC A;  2A3V A;  2OYY A;  3F5A A;  2OXO A;  1ZQ1 C;  2E5S A;  3HKZ C;  1URJ A;  2CN1 A;  3PST A;  3VCB A;  2LKY A;  2N1R A;  4WJ3 B;  4NV0 A;  2XI9 A;  1MA7 A;  4PL1 A;  5HR6 A;  2F8L A;  4P0Q A;  1P7D A;  2VKQ A;  2HOQ A;  2HBK A;  3VC8 A;  4OJ5 A;  1Z1B A;  1D8B A;  3F53 A;  2F76 X;  4BX9 C;  2WAQ C;  2HBL A;  2ZIW B;  1ED1 A;  3SMV A;  2MRL A;  1IIP A;  2KHQ A;  4O3M A;  3F2C A;  2KIW A;  2VJ4 A;  3M6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...