2KJ9A

Nmr structure of intb phage-integrase-like protein fragment 90-199 from erwinia carotova subsp. atroseptica: northeast structural genomics consortium target ewr217e
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
118
structure length
118
Chain Sequence
KSVQEKRNNTRAFKTVAKSWFATKTTWSEDYQRSVWTRLETYLFPDIGNKDIAELDTGDLLVPIKKIEKLGYLEIAMRVKQYATAIMRYAVQQKMIRFNPAYDLEGAVQKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of IntB phage-integrase-like protein fragment 90-199 from Erwinia carotova subsp. atroseptica
rcsb
source organism Pectobacterium atrosepticum
molecule tags Dna binding protein
molecule keywords Integrase
total genus 35
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kj9A00
3LYSA 1F44A 2OXOA 1Q3UA 3C28A 1Z1BA 3CRXA 3C29A 4A8EA 1NZBA 1KBUA 1MA7A 2KEYA 2HOIA 1PVQA 1PVPA 2KJ5A 2KIWA 1A0PA 1CRXA 2KJ8A 2KD1A 1PVRA 3MGVA 1Z19A 3NRWA 1P7DA 1XO0A 2KHVA 2A3VA 1OUQA 2KHQA 2KJ9A 4CRXA 5CRXA 4ACOA 2KKVA 1Q3VA 2KOBA 1DRGA 1XNSA 2HOFA 2KKPA 2CRXA
chains in the Genus database with same CATH superfamily
3RB6A 4YR3A 2XI9A 2MUTB 1SL2A 2FI1A 5JRTA 4Y2JA 4YFKA 7ICRA 3M8SA 5F9LA 3R9KA 3QXGA 4QWEA 1KN5A 5L9XA 1H38A 3QYPA 3NRWA 9ICRA 5KFGA 8ICTA 2HBLA 3S6JA 2CPRA 1LKYB 4Q45A 2HDOA 5KFZA 3JPOA 4CCHA 5IINA 3GIIA 5CEHA 2PFPA 3ORYA 5BPCA 8ICUA 1NJZA 4RQMA 3Q8MA 1WWVA 2YMLA 2ZTDA 1KQQA 2VJ5A 4GC6A 2RHFA 4CRXA 5AI8A 4RQ4A 2BCQA 3D2SA 3DEEA 3F53A 3MR2A 3AQFA 1ZOLA 2HBMA 5KNIA 2QB0A 3KHGA 3F2BA 5BOMA 4F72A 4FBUA 2XCAA 4IS7A 5DB8A 1WYGA 3EPGA 1QH9A 4O0IA 4YG2A 4UATA 1XSPA 5ALGA 4EYIB 3SZ2A 4F4YA 4C7YA 1F0MA 2IOFK 2HHTA 2YTUA 4QNLA 1TVAA 5CHGA 2BCSA 2HW3A 5IILA 4RPYA 2I5HA 5KT5A 3T3FA 1CEZA 3PX4A 4TUSA 3N7RC 2LBOA 4LVSA 7ICMA 4EZ9A 1SV0C 1NK7A 1MSWD 2R8HA 3GIMA 4GXKA 3NRZA 4F4XA 3KKAC 2FPLA 2QB1A 2WF5A 1JALA 4I2IA 4RU9A 3EPIA 4DFMA 4IRCA 4QZAA 4US9A 1S0OA 3RRGA 3PSTA 4KMUA 4KLTA 1NKCA 3V6HA 4UQGA 1L7OA 2H5XA 4PHEA 5J0SA 1Q46A 5L1JA 1L7PA 3UMGA 4ACOA 2JR5A 3I1YA 2UVVA 4P0QA 7ICLA 3JPTA 5EOZA 2ZJ5A 3V7JA 1TV9A 3RH6A 3J81j 2F1HA 5K4LA 2V4QA 5DG8A 2B6GA 1SKSA 3GQCA 4FS2A 2BDUA 4O3MA 2AGQA 4BXOA 2PI5A 1UQVA 4RT3A 4KLJA 4C8MA 4PGXA 4TUQA 3V7KA 5KFWA 1DRGA 4NL9C 1OW5A 5GTIU 4B9TA 5J0WA 4KX5A 2HMXA 9ICUA 1S0VA 2HHXA 4RPXA 1ZJNA 1B4FA 2JH7A 4PZNA 5DGBA 1RZTA 5KG6A 5JU5A 3RR8A 3SYZA 8ICCA 3MBYA 4TUPA 4OJOA 1QQ5A 5AKXA 3ETLA 8ICHA 4IC9A 3AUOA 4XUSA 3GV7B 8ICWA 5DLFA 2QLTA 5ALUA 2ISPA 5ALRA 1VLBA 5KFQA 5J2DA 4ECVA 9ICXA 1QSSA 4BWJA 2JEIA 5G5GA 3SR6A 4X5VA 2BCUA 1ZQYA 3ICXA 4J9LA 1L5UA 3QX7A 1UT5A 4FZLA 2XY7A 5J2AA 2W03A 4UAWA 2C2RA 1ZQQA 2RRDA 2E1FA 1K1SA 4B9NA 4BWMA 4QZEA 5ALDA 4Y2SA 4Z6FA 4ECYA 2AH5A 3M8RA 3C5FA 5KT4A 3QUTA 5DLGA 4MFFA 1RXWA 5AM2A 5KG5A 1DXSA 3QU9A 1S0MA 4MEYA 2KIWA 3OGUA 3LDAA 5ALKA 4O3SA 3G6YA 1SZHA 3PO4A 4UB1A 3G6VA 2A19A 1ECWA 4KLMA 3WK5A 5B66U 5G5HA 4DLEA 4M9NA 2FPMA 2W54A 2YMMA 5ALMA 2KG5A 4EEKA 2V4RA 5KFHA 4DSFA 1V38A 5HHIA 4ECZA 2FMSA 3Q8QB 3I28A 2QARB 4UB4A 3NASA 4YMNA 2LHTA 5KFNA 3C2MA 2BZFA 5J2CA 1KFDA 4G3IA 3H40A 2G07A 3PW5A 4JWNA 2KOBA 2QARA 3NGDA 1IG6A 2J6SA 4DQQA 5C0YA 3KZIU 4AP9A 2BHNA 3MDCA 3AU6A 3C1ZA 2JH1A 1CRXA 4RQ5A 2UVUA 5AKGA 3RJGA 5ALZA 5KFCA 4UB3A 3H8WA 3GZFA 1ZD5A 5J0XA 4J9MA 4DFDA 2ZXIA 3GV8B 2E1EA 3ZDDA 1UCVA 2KVSA 1D8YA 2LYAA 3KZXA 5KG3A 4F2RA 2K4IA 4U7CA 2DGZA 1NK9A 2ZIVB 5KG4A 4EX6A 3NVWA 3EUB2 1NNLA 3RTVA 2F2AB 3FDSA 1A77A 4DSKA 5IIKA 1T8EA 5J0TA 2PI4A 8ICRA 8ICOA 2KP7A 5HHHA 3IN5A 1RPLA 3IG5A 2ISOA 9ICIA 1WCLA 3BZKA 4I2BA 3ISBA 3A0HU 2R8JA 3Q8RB 4DL4A 5AI6A 1L8OA 4BUGA 4PHDA 5AI0A 3H4BA 5J8YA 1O03A 1MQ3A 2MU2A 5CWRA 3QNMA 3MGVA 4YR0A 4MFAA 2DFLA 4ECRA 2JZBA 3TADA 2DKZA 2HI0A 8ICKA 1U47A 2ZIXA 4DS5A 4RUCA 2W9CA 2NYVA 1D8LA 4B9VA 2HHSA 4F8RA 1ZQRA 2ZXHA 1Z4NA 2MSNA 2OXOA 4ICAA 5AK5A 3KHRA 5KFBA 4JV0A 5HMLA 2W43A 3TARA 4QZHA 3KHLA 3PY8A 3BS5B 1Z19A 3ZDCA 2WF7A 1ZQXA 3AU2A 2B21A 4OJ5A 4HYKA 4QW8A 2W04A 2JRZA 3KFUF 5AM4A 3CYMA 4MF2A 1O08A 4ELUA 7ICOA 1U9LA 4UAVA 2EDUA 8ICGA 4GFJA 4DQPA 2FE9A 4QW9A 5HP4A 2FMPA 2GO7A 4ELVA 1T7PA 4O3NA 1JI7A 5DQGA 3ED5A 4M04A 3GIJA 1YZ7A 3WK4A 2KHQA 4EYHB 5JTIA 4JUZA 4HAIA 2A1JB 2KN7A 4OJ6A 1F44A 1S10A 4J03A 7ICEA 9ICBA 3K4GA 4YMMA 5D46A 1J2NA 4Y2TA 1COOA 3PW2A 2ZJ8A 1KLNA 2AU0A 5KFIA 4CGZA 4P0PB 3QU2A 3L3FX 2XCPA 1NK0A 4LJXA 2XO7A 2M0NA 2ZUBA 3AM9A 1ZQEA 1ZQHA 3PR4A 4O5CA 2DPJA 4B9UA 2LM1A 2A1AA 5ALOA 2K8AA 3BDPA 2KSOA 2UVWA 4ED6A 5HNKA 2H3FA 3CW2C 2A1JA 5J2KA 2KICA 3PO5A 1L3UA 2E5SA 2W8LA 3C1YA 3FM9A 3TKAA 5KAIU 2CRXA 3C2KA 4DFKA 3GU3A 1HIWA 1X2IA 4C7ZA 9ICPA 3D2QA 5B5EU 4J9OA 3RBDA 4C8OA 4NLBA 1A0PA 1N60A 1Z3EB 2KD1A 4USAA 3PR5B 2KSOB 8ICJA 1N62A 4JV2A 1ZYQA 4UAUA 2G09A 3K1RB 4QWAA 4FO6A 3PW0A 1X9WA 4B6JA 3N28A 1Z00B 1LB2B 1BPZA 1CUKA 8ICZA 3NTUA 4XA5A 5KFFA 2Q4TA 1FEZA 1FFVA 3PV8A 3MC1A 1IIPA 3PMNA 2H3IA 1XS9D 2WB1F 2PXIA 5DBBA 3ISDA 4O5EA 1BVSA 5AM3A 2DWQA 3K1ZA 4QZIA 1TK8A 1SKRA 4Y2PA 5ALPA 1ZQNA 2K4HA 9ICMA 3RAXA 3BQ1A 2AQ0A 2IA6A 2R8KA 3RJEA 2ZUCA 3M7DA 4C4RA 5ALVA 5KFPA 5AICA 3M9NB 4M47A 4DS4A 3FYHA 9ICGA 4IRDA 5AM5A 1D9DA 4P4PA 2BGWA 3RH5A 3M9OB 4FFDA 2NRWA 5CR0A 4DSJA 1MA7A 1ZQWA 3WK6A 3UMBA 3NVYA 2F1IA 4ECUA 4PH5A 2DKXA 4I29A 2IOFA 1SZPA 4B9LA 3WK9A 5ALQA 4F5NA 2E8PA 2KKVA 5AIAA 1KL9A 1JROA 4KLOA 1X9XA 3N4MB 1D8BA 1NKBA 1Q3UA 2YY6A 2NRZA 2J6UA 9ICJA 9ICOA 1IV8A 1NJXA 3MFHA 3BQ7A 3Q8LA 1QQ7A 1RM6C 4YVZA 5IIJA 2C2EA 5TZVA 2KHVA 5ALEA 4QZBA 4DWIA 3DDHA 2F44A 2OH2A 5ALXA 1U4BA 1TK0A 1Y88A 3OHAA 5KFTA 1ZQBA 2K4PA 1TAMA 2DF4B 2NRTA 1D9FA 2UVRA 7ICKA 4YXJA 3HP6A 1DK2A 7ICTA 2W55A 1X42A 2WF8A 4DL3A 1XNSA 2Z7JA 5KFVA 2KKPA 2WFAA 5DBAA 2W7OA 1N61A 2IOHA 3SAHA 4O3QA 1ZXIA 4EEYA 2BQUA 1Z1VA 1KRPA 2EH9A 4UW9A 4CF3A 4EBCA 1ZETA 3IG8A 1PK1B 4Y2XA 5F9NA 4DFPA 4Y2RA 1PVRA 4IRKA 1SXDA 2IHNA 2EZYA 5KT3A 4IQTA 1WWUA 2ZG6A 5KFRA 2KV2A 5DB7A 5KTQA 2D6FC 3QZ7A 2C22A 4F5RA 2Y9TA 4C80A 4J9RA 2V9WA 1QLNA 1SIJA 1FFUA 3QE9Y 2BQRA 1M6YA 3LK9A 3N7SC 1FIQA 4RNNA 1FO4A 3UXPA 2DQNB 1ZQZA 2AXTU 1TKDA 1JRPA 1ZD3A 2HOFA 4G9BA 4FZMA 2M9NA 2RDJA 1RYRA 7ICSA 1U45A 5DDYA 1RQNA 2MRLA 4MHVA 2ASDA 4CF4A 4UBBA 3ZDEA 3OHBA 3WK8A 4I2AA 4CF5A 5KFDA 2Y0SC 3MR5A 4J9NA 4ECXA 4C4TA 3D6JA 5KFMA 4DSLA 4WJ3B 2F76X 5J0RA 7ICVA 1TK5A 1SV0A 4DSEA 1T3QA 2JEGA 2ZUDA 5EE9A 3WKAA 3KD3A 2K60A 4QZFA 1TFRA 5DBCA 4RZRA 3U26A 5J2HA 4YMOA 3TFRA 4KLHA 2FMQA 3SQIA 7ICFA 4M9JA 1N5WA 4PL1A 5AI4A 5DQIA 3QEBZ 3PSPA 3SAFA 5DKWA 4PGQA 9ICSA 1PK3A 7ICQA 4UB6U 1S9FA 2KFZA 1N2XA 2FJ6A 3NUQA 3C2LA 2ASJA 3OJSA 4M0AA 2LYBA 3C23A 3IV6A 4Y2UA 1UPHA 4B9SA 1SWVA 2AGPA 8ICAA 4Z6CA 4JB3A 3VC8A 1HUZA 5AK4A 4B9MA 4DL7A 2AGOA 5AK3A 4ED0A 4PZOA 4RNOA 1J97A 1JIHA 4KLEA 1OUQA 4AYBF 3BQ2A 3KOOA 1ZQVA 4KX3A 1XC9A 5IIMA 3M9MB 4PHPA 3WU2U 5DG9A 2VANA 2XC9A 4F92B 1KW4A 1DOQA 3PW7A 5IIIA 3L5KA 2ZIUA 1S5LU 4DOBA 4NLNA 4OJPA 2RQ5A 4R8UB 2BPCA 3CRXA 1LVHA 1TAQA 2JGAA 5J8YC 2F77X 2YN4A 3F2CA 3MDAA 3FAHA 3PX6A 4M6WA 2DBYA 2BCRA 2YX8A 1DGJA 3M6KA 1NI3A 5AI5A 1U49A 1MN8A 4QZDA 4EBDA 1HUOA 3MFIA 1XO1A 4ZH4A 1J2MA 1KKXA 3F5EA 3ZI4A 1CI4A 1L6NA 4DF4A 3RJJA 1X6JA 2DUYA 2W9AA 4IL6U 2OWOA 2XGPA 1SL1A 2E8MA 2XIDA 4OJLA 4LZDA 3LYSA 3KHHA 4R65A 3JPQA 2BPGA 1ZD4A 8ICVA 1PK1A 3PVXA 1T4GA 4JK1A 2WTFA 3AN1A 4RQ8A 4R8UA 4DQSA 2PMZC 2F8KA 4C4SA 4P4MA 1X9SA 4J9PA 1B22A 4QIWC 4QWCA 1PUZA 3V6JA 2WHEA 4DLGA 4QZCA 2N1RA 3JPRA 2K4EA 5BOLA 5KT6A 1X9MA 1SL0A 3QU7A 3LVVA 4C8KA 4Q8FA 4TQRA 1IXRA 4DL5A 5EE1A 4F50A 1S76D 2B0CA 4UARA 4M2YA 4BJQA 3RF9A 3L4PA 3PZPA 1ZJMA 1BPDA 3HILA 1PZNA 2Y0SF 2ZJAA 4US8A 4LZGA 4DOAA 7ICHA 4YCXA 4BX9C 2EZXA 1MQ2A 1ZQJA 4KN4A 1Z1BA 5DGAA 2WF9A 2HHQA 3BQ0A 2HBKA 2ODGA 4I2EA 4QIWF 1JUDA 2W9BB 1XO0A 2K8BB 9ICNA 3TANA 2ZTEA 2NRXA 2H3ZA 3FC4A 3KKAA 2H3QA 3C28A 1L8LA 4ZOHC 3C29A 1V85A 5DQHA 1ZRMA 3THVA 2Y9UA 4F3OA 1S0NA 4P0QB 4BGDA 2OYYA 2KZ3A 3RB3A 3MGIA 2EQYA 3AMZA 5EWFA 5AK6A 5IIOA 3ZDAA 4OCZA 4NV0A 4EBEA 5KFOA 1X40A 3I76A 2K89A 5KT2A 3RB0A 3HW8A 3PSFA 4DQIA 8ICLA 3TADC 9ICEA 4NLGA 3T5HA 5KFSA 2G5IB 8ICIA 1SGGA 2EANA 3UXOA 3G6XA 4RUAA 1JN3A 3BS5A 4TURA 2OM6A 2IMWP 5DB9A 2W9BA 4RT2A 4JV1A 5KAFU 5AM0A 5HMMA 3OJUA 3KTQA 1AQ6A 9ICWA 4Z6DA 2YB4A 1S77D 5AKIA 4RQNA 2HBJA 1A76A 3HX0A 1L3VA 3PNCA 3IHQB 3H0RB 4JWMA 2CXYA 4J9KA 3EZ5A 1U48A 2YMQA 2W9MA 3CP8A 2GLEA 3N7PD 4E0DA 3Q8KA 2ZIUB 2DL0A 4Y2VA 4NM2A 3B9JA 2W7PA 3RJHA 1SB3C 5KFKA 4GC7A 2EAPA 4AYBC 5J0QA 8ICXA 3QZ8A 1RXVA 2O6KA 3E58A 2VIXA 5CP2A 1URJA 3MABA 1XWLA 1A6SA 2OEHA 5ALFA 1NJWA 1ZD2P 3BJYA 1BNOA 3RJIA 3IM1A 2BR0A 5AI9A 4O3OA 1S97A 5AM1A 4F93B 4FE3A 2MAXA 2NO5A 3TAQA 8ICQA 4IQWA 1X66A 5KFAA 4DL6A 3ISCA 2D8CA 4MEXA 3H8MA 2G06A 5DDMA 2C28A 2JHDA 1HJPA 3SV4A 3AQEA 4GXJA 4EZ6A 3GDXA 3Q8PB 4UB8U 4F71A 3PSIA 5KG2A 3HWTA 1V9PA 4Q8EA 1ZQKA 1LV5A 4M9LA 3JPNA 2RP5A 5KG1A 2ES6A 4F4ZA 5F3XB 1L7MA 5J0YA 4NLZA 4M9HA 4U6PA 3HKZF 2W11A 5KFLA 4NM1A 1NOMA 9ICTA 4I2CA 4R63A 2XVTA 4Z6EA 5D4BA 8ICYA 8ICPA 3OSNA 4ECQA 3PX0A 4Q44A 4BDPA 1N63A 4UB5A 2GOLA 2KZMA 4IQUA 2E3TA 3LWMA 2I6XA 2AQ4A 3V6KA 5J2IA 1AROP 4I2DA 4I28A 2G5HB 4Y2QA 4GXIA 5ALNA 4QJFB 4ECSA 1NZPA 1Z4OA 4IR9A 3SEIA 4KLUA 1C7YA 5KFYA 2IHMA 2VJ4A 5J0PA 3ZD9A 1BPEA 3B0YA 1SXEA 5ALSA 1WCNA 4YXMA 1UA0A 4QWDA 4NXZA 3T5JA 1UA1A 4PL2A 2BCVA 5AHXA 2AJQA 2PFOA 3E2EA 1SKWA 4DSIA 1MC8A 1ZQUA 1C20A 3UQ2A 1BNPA 3C21A 3QU4A 2ZTCA 4ED2A 4F4KA 1HEKA 3RRHA 5CRXA 2LYHA 4OD0A 5L1IA 7ICJA 5KT7A 2EAOA 1BPYA 5D49A 2ESEA 4KLSA 2EAMA 1ZQGA 4F91B 4KITB 5HR7A 5TISU 1NK6A 9ICAA 2KEYA 2EZZA 2XICA 1N5XA 4RQ0A 1TE2A 2Q0ZX 5C5JA 5ALIA 3E0FA 1BPXA 2ZIWA 2J6TA 2KVCA 3H0LB 4XRHA 1WG8A 4IQVA 3EYZA 1ZQ1C 8ICEA 5ALLA 4ELTA 1KFSA 2LPEA 4RQ6A 5L1LA 7ICUA 4F5PA 2QKQA 3MR3A 2GWSA 2R8GA 1NZBA 2W3RA 3Q8SB 2HHUA 4F5QA 4GIBA 4UBCA 4KLLA 2VKQA 2CN1A 4C8NA 4RPZA 1UHUA 1RG6A 4EENA 4M6WB 1ZQFA 2VA3A 4C8LA 5EWGA 3WKBA 2GH1A 5J2EA 4DEZA 3PMLA 4QZ9A 3QUBA 4KLGA 2FLNA 3OSPA 3LWLA 4J9SA 1N48A 5CJ7A 5AKKA 1KDHA 4DCCA 4O3PA 4YD1A 5KL1B 3JPSA 1ED1A 3UXNA 1V97A 5KFUA 5ALYA 2KK0A 1ZQIA 3MGHA 3RB4A 2R8IA 3EW9A 4XQ8A 4OO1J 4EX7A 2FLLA 1JX4A 3ZD8A 2PFNA 3GILA 9ICHA 1NK4A 4O9MA 1P7DA 2WB1C 1L3SA 3WKCA 1KEJA 7ICPA 2NO4A 4YP3A 3WKDA 5JUMA 2G0AA 4I27A 4KLDA 4O5KA 3UQ0A 4NLCA 1IM4A 3WK7A 3RH4A 2PMZF 1ZQAA 4DL2A 1ZQLA 3IP4B 4UAYA 4ED3A 3HT3A 4RQ2A 1K1QA 5AKEA 1F5SA 1VDVA 3N97B 1N56A 4RQ3A 2JXJA 5KFJA 4UB2A 3CNHA 8ICMA 3GFKB 4KMOB 2PFQA 9ICKA 3OTQA 3SMVA 2WF6A 3OPXA 1XSLA 5ALJA 5KG7A 7ICNA 2DPIA 4CNQA 1RQLA 8ICNA 1GO3F 5KFXA 1SWWA 3LVWA 2NV3A 4UAZA 4ECWA 5ALTA 3AL0B 1OXJA 1ZQPA 1K5OA 2BPFA 1NK8A 1L3TA 3TFSA 1XU4A 2HSZA 3SENA 2XY6A 2ATLA 4ED8A 2ZIXB 2KJ5A 2C2DA 1PVPA 4K4GA 4MFCA 2KJ8A 8ICBA 5CA7A 1KFTA 5A0LA 1S8OA 3RJKA 3F2DA 7ICIA 3ONNA 4PHAA 1JMSA 9ICCA 4NL9A 3ALRA 4CE6A 4TQSA 5EE0A 2D3DA 2YMPA 2AHOB 2BQ3A 4FZNA 1QCKA 2F8LA 3UPQA 5AKLA 4MF8A 4ED1A 4I2JA 5L1KA 2FLPA 1T3NA 2A3VA 4KTQA 1Z00A 1EXNA 2FDRA 1QSLA 2JEFA 1B0XA 3H8JA 3TI0A 5J2BA 1QTMA 1L7NA 3HPOA 2JV3A 2MUTA 4F2SA 5J2JA 4Y2YA 2W8KA 5J2GA 4QWBA 4I2FA 9ICQA 3ETRA 3T5LA 4ECTA 2HVHA 4DO9A 1RDFA 2LKYA 1X6IA 3V72A 3SD7A 3V7LA 2Y1IA 1RYUA 2HHVA 2W9CB 2JEJA 2I1QA 2P6RA 3SAGA 2Y1JA 3HKZC 4YR2A 3K75D 4KLQA 3BZCA 4PGYA 4PPXA 1ZQMA 4NY8A 2E8NA 2K8CB 2YB1A 3H4DA 4A8EA 4P4OA 5CB1A 3RAQA 3UMCA 4BXOB 4YQWA 3QEAZ 4P2HA 2HVIA 4UASA 2KE7A 2LM4A 2KNJA 2KMDA 5DB6A 3IDWA 4DOCA 2ALZA 2I9GA 3UM9A 3WKEA 4PJ0U 3M6ZA 1KTQA 2NRVA 3TAPA 3EWAA 3B0XA 2QB0B 3RJFA 4KLIA 1QSYA 4K4IA 4JMUA 1BGXT 4RNMA 4K4HA 2W3SA 1NJYA 8ICFA 5KG0A 5AKZA 2YQEA 5DG7A 4YD2A 4NWIA 3RFAA 4DFJA 3BQTA 2H3VA 4Q43A 1DGSA 4J9QA 4RQ7A 5T14A 5EWEA 2G08A 1QQ6A 1ZQOA 3DV9A 3GV5B 4CDGA 2MA1A 2R18A 1RYSA 1PVQA 3D2NA 2KZZA 2VA2A 2BKEA 3QU5A 1Q8KA 3NVZA 4O3RA 3TQ1A 2HHWA 5J0UA 2KFNA 3HJEA 4F5OA 3NS1A 4DF8A 1B43A 1BPBA 3C5GA 5J29A 4ED7A 3GIKA 3T79A 1T94A 4KLFA 4R64A 3BS7A 2HOQA 2E8OA 4NJ8A 2FPKA 5AKHA 1LKYA 2OCEA 5KL8B 3ZDBA 2ZIWB 1ZRNA 5GTHU 3QUCA 3AEVA 3SV3A 2KJ9A 5ALWA 2P35A 5AKYA 4M9GA 1COKA 4YN4A 2RLTA 2IBKA 3RR7A 5E79U 5ALHA 2BDPA 4QZ8A 4DQRA 2LI6A 1ZQTA 2ZIVA 2HCFA 1ZQCA 3H7IA 7ICGA 9ICVA 1Q3VA 1KSPA 2LMRA 2P66A 2KTQA 3RBEA 8ICSA 4I2HA 1WUDA 5KFEA 3H0MB 2XGQA 3PW4A 2P6UA 4EELA 2VA8A 3JPPA 2XY5A 2JZBB 4R66A 1JXEA 4F4WA 1NK5A 1YZ6A 5EE3A 2OHFA 4FS1A 4NLKA 1JXLA 2F3NA 1ZQDA 5HR6A 3HRDD 4GLXA 2RDIA 2F1JA 1UT8A 3VCBA 2ASLA 5AIBA 4I2GA 1YT3A 4QZGA 2JMGA 2HOIA 1NKEA 3M1YA 3TACB 4P0PA 3T5KA 3NVVA 2KIVA 5J0OA 4RQ1A 1SV4A 3A0BU 2L5YA 3O0FA 1KBUA 4KN7A 1XSNA 1TAUA 3QUQA 3MR6A 3F5AA 3SI8A 4C0ZA 5J2FA 5H2FU 3IRUA 1VJ5A 1ZQSA 4FBTA 5FP0A 3H8SA 5AKJA 2WAQC 9ICFA 3KBBA 1DK3A 5L1MA 2PKEA 2WAQF 4IR1A 9ICLA
chains in the Genus database with same CATH topology
3N7PD 3ICXA 2XI9A 4BX9C 4GFJA 4QJFB 2ZIUB 1Z1BA 3CRXA 4FZLA 2K8CB 2YB1A 2JGAA 4A8EA 2W7PA 2F77X 2ZXIA 2E1EA 1TAMA 2DF4B 2HBKA 3PSTA 3F2CA 4AYBC 2ZIXB 2KJ5A 1PVPA 2W03A 4QIWF 2RRDA 2KJ8A 2Q4TA 2VJ4A 2LYAA 3KZXA 5KL1B 2E1FA 1ED1A 3NRWA 2K4IA 4U7CA 2ZIVA 5A0LA 2DGZA 2VIXA 1URJA 2YX8A 1IIPA 2KNJA 1XO0A 3SQIA 3F2DA 1A6SA 2K8BB 2ZIVB 2H3IA 2KHQA 4PL1A 3ONNA 4ACOA 3M6KA 1Q3VA 2HBLA 1XNSA 2Z7JA 4P0QA 2KKPA 2WB1F 3ALRA 2CPRA 2H3ZA 3PSPA 2W7OA 4OJ6A 2F2AB 3SAHA 3SAFA 1F44A 1WUDA 2H3QA 3H0MB 4PL2A 3C28A 3C29A 3M6ZA 3K1ZA 4FE3A 4FZNA 4OO1J 3IN5A 3IG8A 4P0QB 2BDUA 2K4HA 2OYYA 2F8LA 3IG5A 4O3MA 3F5EA 2KIWA 4JMUA 4CGZA 4P0PB 3M7DA 1PVRA 1L6NA 3NUQA 3L3FX 2LYBA 1SZHA 1UPHA 2G06A 2VJ5A 1P7DA 1ECWA 2RHFA 2WB1C 2A3VA 2M0NA 1HEKA 4NV0A 4CRXA 2XIDA 5CRXA 1DRGA 4NWIA 4OJLA 3RFAA 2JHDA 2ZG6A 3D2SA 2KV2A 3AQEA 3DEEA 4KX5A 2HMXA 3VC8A 2H3VA 2G0AA 2D6FC 5HR6A 2K89A 3F53A 3LYSA 3AQFA 4BUGA 5T14A 4NLCA 2HBMA 2G08A 3PSFA 5HR7A 2K8AA 3VCBA 4CDGA 2MA1A 2R18A 1MA7A 3F2BA 2PMZF 3PSIA 1YT3A 2KEYA 2JMGA 1PVQA 2HOIA 2JH7A 3IP4B 3D2NA 2PMZC 2H3FA 2XICA 3MGVA 2G5IB 3N7SC 2LHTA 4P0PA 2KICA 3E0FA 2ZIWA 2RP5A 4QIWC 2E5SA 2KVCA 3H0LB 1OUQA 4AYBF 4OJOA 2ZIXA 1ZQ1C 2DQNB 2G07A 2KKVA 2LKYA 2OM6A 2KOBA 4U6PA 2HOFA 3HKZF 2CRXA 4FZMA 4KMOB 1D8BA 2N1RA 4KX3A 3T79A 1T94A 2ZXHA 1HIWA 3GU3A 2K4EA 2OXOA 4IC9A 4ICAA 1Q3UA 2XVTA 3SMVA 5C0YA 3D2QA 2HOQA 4QNLA 1NZBA 3O0FA 1KBUA 3LVVA 2YB4A 3OPXA 3F5AA 4C0ZA 2VKQA 2MRLA 2CN1A 2GOLA 4NLBA 2JH1A 1A0PA 2ZIUA 1CRXA 2KD1A 2HBJA 5KL8B 4BJQA 3RF9A 1Z19A 2ZIWB 1GO3F 3PZPA 2WAQC 3N7RC 3LVWA 2NV3A 3SAGA 2Y0SC 2LBOA 3H0RB 2KHVA 3HKZC 4OJ5A 2GH1A 2KJ9A 4OJPA 2G09A 2W04A 2Y0SF 3AL0B 2OH2A 3GZFA 2WAQF 3KFUF 3CYMA 4WJ3B 2F76X 2G5HB 3CP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LYS A;  1F44 A;  2OXO A;  1Q3U A;  3C28 A;  1Z1B A;  3CRX A;  3C29 A;  4A8E A;  1NZB A;  1KBU A;  1MA7 A;  2KEY A;  2HOI A;  1PVQ A;  1PVP A;  2KJ5 A;  2KIW A;  1A0P A;  1CRX A;  2KJ8 A;  2KD1 A;  1PVR A;  3MGV A;  1Z19 A;  3NRW A;  1P7D A;  1XO0 A;  2KHV A;  2A3V A;  1OUQ A;  2KHQ A;  2KJ9 A;  4CRX A;  5CRX A;  4ACO A;  2KKV A;  1Q3V A;  2KOB A;  1DRG A;  1XNS A;  2HOF A;  2KKP A;  2CRX A; 
#chains in the Genus database with same CATH topology
 3RB6 A;  4YR3 A;  2XI9 A;  2MUT B;  1SL2 A;  2FI1 A;  5JRT A;  4Y2J A;  4YFK A;  7ICR A;  3M8S A;  5F9L A;  3R9K A;  3QXG A;  4QWE A;  1KN5 A;  5L9X A;  1H38 A;  3QYP A;  3NRW A;  9ICR A;  5KFG A;  8ICT A;  2HBL A;  3S6J A;  2CPR A;  1LKY B;  4Q45 A;  2HDO A;  5KFZ A;  3JPO A;  4CCH A;  5IIN A;  3GII A;  5CEH A;  2PFP A;  3ORY A;  5BPC A;  8ICU A;  1NJZ A;  4RQM A;  3Q8M A;  1WWV A;  2YML A;  2ZTD A;  1KQQ A;  2VJ5 A;  4GC6 A;  2RHF A;  4CRX A;  5AI8 A;  4RQ4 A;  2BCQ A;  3D2S A;  3DEE A;  3F53 A;  3MR2 A;  3AQF A;  1ZOL A;  2HBM A;  5KNI A;  2QB0 A;  3KHG A;  3F2B A;  5BOM A;  4F72 A;  4FBU A;  2XCA A;  4IS7 A;  5DB8 A;  1WYG A;  3EPG A;  1QH9 A;  4O0I A;  4YG2 A;  4UAT A;  1XSP A;  5ALG A;  4EYI B;  3SZ2 A;  4F4Y A;  4C7Y A;  1F0M A;  2IOF K;  2HHT A;  2YTU A;  4QNL A;  1TVA A;  5CHG A;  2BCS A;  2HW3 A;  5IIL A;  4RPY A;  2I5H A;  5KT5 A;  3T3F A;  1CEZ A;  3PX4 A;  4TUS A;  3N7R C;  2LBO A;  4LVS A;  7ICM A;  4EZ9 A;  1SV0 C;  1NK7 A;  1MSW D;  2R8H A;  3GIM A;  4GXK A;  3NRZ A;  4F4X A;  3KKA C;  2FPL A;  2QB1 A;  2WF5 A;  1JAL A;  4I2I A;  4RU9 A;  3EPI A;  4DFM A;  4IRC A;  4QZA A;  4US9 A;  1S0O A;  3RRG A;  3PST A;  4KMU A;  4KLT A;  1NKC A;  3V6H A;  4UQG A;  1L7O A;  2H5X A;  4PHE A;  5J0S A;  1Q46 A;  5L1J A;  1L7P A;  3UMG A;  4ACO A;  2JR5 A;  3I1Y A;  2UVV A;  4P0Q A;  7ICL A;  3JPT A;  5EOZ A;  2ZJ5 A;  3V7J A;  1TV9 A;  3RH6 A;  3J81 j;  2F1H A;  5K4L A;  2V4Q A;  5DG8 A;  2B6G A;  1SKS A;  3GQC A;  4FS2 A;  2BDU A;  4O3M A;  2AGQ A;  4BXO A;  2PI5 A;  1UQV A;  4RT3 A;  4KLJ A;  4C8M A;  4PGX A;  4TUQ A;  3V7K A;  5KFW A;  1DRG A;  4NL9 C;  1OW5 A;  5GTI U;  4B9T A;  5J0W A;  4KX5 A;  2HMX A;  9ICU A;  1S0V A;  2HHX A;  4RPX A;  1ZJN A;  1B4F A;  2JH7 A;  4PZN A;  5DGB A;  1RZT A;  5KG6 A;  5JU5 A;  3RR8 A;  3SYZ A;  8ICC A;  3MBY A;  4TUP A;  4OJO A;  1QQ5 A;  5AKX A;  3ETL A;  8ICH A;  4IC9 A;  3AUO A;  4XUS A;  3GV7 B;  8ICW A;  5DLF A;  2QLT A;  5ALU A;  2ISP A;  5ALR A;  1VLB A;  5KFQ A;  5J2D A;  4ECV A;  9ICX A;  1QSS A;  4BWJ A;  2JEI A;  5G5G A;  3SR6 A;  4X5V A;  2BCU A;  1ZQY A;  3ICX A;  4J9L A;  1L5U A;  3QX7 A;  1UT5 A;  4FZL A;  2XY7 A;  5J2A A;  2W03 A;  4UAW A;  2C2R A;  1ZQQ A;  2RRD A;  2E1F A;  1K1S A;  4B9N A;  4BWM A;  4QZE A;  5ALD A;  4Y2S A;  4Z6F A;  4ECY A;  2AH5 A;  3M8R A;  3C5F A;  5KT4 A;  3QUT A;  5DLG A;  4MFF A;  1RXW A;  5AM2 A;  5KG5 A;  1DXS A;  3QU9 A;  1S0M A;  4MEY A;  2KIW A;  3OGU A;  3LDA A;  5ALK A;  4O3S A;  3G6Y A;  1SZH A;  3PO4 A;  4UB1 A;  3G6V A;  2A19 A;  1ECW A;  4KLM A;  3WK5 A;  5B66 U;  5G5H A;  4DLE A;  4M9N A;  2FPM A;  2W54 A;  2YMM A;  5ALM A;  2KG5 A;  4EEK A;  2V4R A;  5KFH A;  4DSF A;  1V38 A;  5HHI A;  4ECZ A;  2FMS A;  3Q8Q B;  3I28 A;  2QAR B;  4UB4 A;  3NAS A;  4YMN A;  2LHT A;  5KFN A;  3C2M A;  2BZF A;  5J2C A;  1KFD A;  4G3I A;  3H40 A;  2G07 A;  3PW5 A;  4JWN A;  2KOB A;  2QAR A;  3NGD A;  1IG6 A;  2J6S A;  4DQQ A;  5C0Y A;  3KZI U;  4AP9 A;  2BHN A;  3MDC A;  3AU6 A;  3C1Z A;  2JH1 A;  1CRX A;  4RQ5 A;  2UVU A;  5AKG A;  3RJG A;  5ALZ A;  5KFC A;  4UB3 A;  3H8W A;  3GZF A;  1ZD5 A;  5J0X A;  4J9M A;  4DFD A;  2ZXI A;  3GV8 B;  2E1E A;  3ZDD A;  1UCV A;  2KVS A;  1D8Y A;  2LYA A;  3KZX A;  5KG3 A;  4F2R A;  2K4I A;  4U7C A;  2DGZ A;  1NK9 A;  2ZIV B;  5KG4 A;  4EX6 A;  3NVW A;  3EUB 2;  1NNL A;  3RTV A;  2F2A B;  3FDS A;  1A77 A;  4DSK A;  5IIK A;  1T8E A;  5J0T A;  2PI4 A;  8ICR A;  8ICO A;  2KP7 A;  5HHH A;  3IN5 A;  1RPL A;  3IG5 A;  2ISO A;  9ICI A;  1WCL A;  3BZK A;  4I2B A;  3ISB A;  3A0H U;  2R8J A;  3Q8R B;  4DL4 A;  5AI6 A;  1L8O A;  4BUG A;  4PHD A;  5AI0 A;  3H4B A;  5J8Y A;  1O03 A;  1MQ3 A;  2MU2 A;  5CWR A;  3QNM A;  3MGV A;  4YR0 A;  4MFA A;  2DFL A;  4ECR A;  2JZB A;  3TAD A;  2DKZ A;  2HI0 A;  8ICK A;  1U47 A;  2ZIX A;  4DS5 A;  4RUC A;  2W9C A;  2NYV A;  1D8L A;  4B9V A;  2HHS A;  4F8R A;  1ZQR A;  2ZXH A;  1Z4N A;  2MSN A;  2OXO A;  4ICA A;  5AK5 A;  3KHR A;  5KFB A;  4JV0 A;  5HML A;  2W43 A;  3TAR A;  4QZH A;  3KHL A;  3PY8 A;  3BS5 B;  1Z19 A;  3ZDC A;  2WF7 A;  1ZQX A;  3AU2 A;  2B21 A;  4OJ5 A;  4HYK A;  4QW8 A;  2W04 A;  2JRZ A;  3KFU F;  5AM4 A;  3CYM A;  4MF2 A;  1O08 A;  4ELU A;  7ICO A;  1U9L A;  4UAV A;  2EDU A;  8ICG A;  4GFJ A;  4DQP A;  2FE9 A;  4QW9 A;  5HP4 A;  2FMP A;  2GO7 A;  4ELV A;  1T7P A;  4O3N A;  1JI7 A;  5DQG A;  3ED5 A;  4M04 A;  3GIJ A;  1YZ7 A;  3WK4 A;  2KHQ A;  4EYH B;  5JTI A;  4JUZ A;  4HAI A;  2A1J B;  2KN7 A;  4OJ6 A;  1F44 A;  1S10 A;  4J03 A;  7ICE A;  9ICB A;  3K4G A;  4YMM A;  5D46 A;  1J2N A;  4Y2T A;  1COO A;  3PW2 A;  2ZJ8 A;  1KLN A;  2AU0 A;  5KFI A;  4CGZ A;  4P0P B;  3QU2 A;  3L3F X;  2XCP A;  1NK0 A;  4LJX A;  2XO7 A;  2M0N A;  2ZUB A;  3AM9 A;  1ZQE A;  1ZQH A;  3PR4 A;  4O5C A;  2DPJ A;  4B9U A;  2LM1 A;  2A1A A;  5ALO A;  2K8A A;  3BDP A;  2KSO A;  2UVW A;  4ED6 A;  5HNK A;  2H3F A;  3CW2 C;  2A1J A;  5J2K A;  2KIC A;  3PO5 A;  1L3U A;  2E5S A;  2W8L A;  3C1Y A;  3FM9 A;  3TKA A;  5KAI U;  2CRX A;  3C2K A;  4DFK A;  3GU3 A;  1HIW A;  1X2I A;  4C7Z A;  9ICP A;  3D2Q A;  5B5E U;  4J9O A;  3RBD A;  4C8O A;  4NLB A;  1A0P A;  1N60 A;  1Z3E B;  2KD1 A;  4USA A;  3PR5 B;  2KSO B;  8ICJ A;  1N62 A;  4JV2 A;  1ZYQ A;  4UAU A;  2G09 A;  3K1R B;  4QWA A;  4FO6 A;  3PW0 A;  1X9W A;  4B6J A;  3N28 A;  1Z00 B;  1LB2 B;  1BPZ A;  1CUK A;  8ICZ A;  3NTU A;  4XA5 A;  5KFF A;  2Q4T A;  1FEZ A;  1FFV A;  3PV8 A;  3MC1 A;  1IIP A;  3PMN A;  2H3I A;  1XS9 D;  2WB1 F;  2PXI A;  5DBB A;  3ISD A;  4O5E A;  1BVS A;  5AM3 A;  2DWQ A;  3K1Z A;  4QZI A;  1TK8 A;  1SKR A;  4Y2P A;  5ALP A;  1ZQN A;  2K4H A;  9ICM A;  3RAX A;  3BQ1 A;  2AQ0 A;  2IA6 A;  2R8K A;  3RJE A;  2ZUC A;  3M7D A;  4C4R A;  5ALV A;  5KFP A;  5AIC A;  3M9N B;  4M47 A;  4DS4 A;  3FYH A;  9ICG A;  4IRD A;  5AM5 A;  1D9D A;  4P4P A;  2BGW A;  3RH5 A;  3M9O B;  4FFD A;  2NRW A;  5CR0 A;  4DSJ A;  1MA7 A;  1ZQW A;  3WK6 A;  3UMB A;  3NVY A;  2F1I A;  4ECU A;  4PH5 A;  2DKX A;  4I29 A;  2IOF A;  1SZP A;  4B9L A;  3WK9 A;  5ALQ A;  4F5N A;  2E8P A;  2KKV A;  5AIA A;  1KL9 A;  1JRO A;  4KLO A;  1X9X A;  3N4M B;  1D8B A;  1NKB A;  1Q3U A;  2YY6 A;  2NRZ A;  2J6U A;  9ICJ A;  9ICO A;  1IV8 A;  1NJX A;  3MFH A;  3BQ7 A;  3Q8L A;  1QQ7 A;  1RM6 C;  4YVZ A;  5IIJ A;  2C2E A;  5TZV A;  2KHV A;  5ALE A;  4QZB A;  4DWI A;  3DDH A;  2F44 A;  2OH2 A;  5ALX A;  1U4B A;  1TK0 A;  1Y88 A;  3OHA A;  5KFT A;  1ZQB A;  2K4P A;  1TAM A;  2DF4 B;  2NRT A;  1D9F A;  2UVR A;  7ICK A;  4YXJ A;  3HP6 A;  1DK2 A;  7ICT A;  2W55 A;  1X42 A;  2WF8 A;  4DL3 A;  1XNS A;  2Z7J A;  5KFV A;  2KKP A;  2WFA A;  5DBA A;  2W7O A;  1N61 A;  2IOH A;  3SAH A;  4O3Q A;  1ZXI A;  4EEY A;  2BQU A;  1Z1V A;  1KRP A;  2EH9 A;  4UW9 A;  4CF3 A;  4EBC A;  1ZET A;  3IG8 A;  1PK1 B;  4Y2X A;  5F9N A;  4DFP A;  4Y2R A;  1PVR A;  4IRK A;  1SXD A;  2IHN A;  2EZY A;  5KT3 A;  4IQT A;  1WWU A;  2ZG6 A;  5KFR A;  2KV2 A;  5DB7 A;  5KTQ A;  2D6F C;  3QZ7 A;  2C22 A;  4F5R A;  2Y9T A;  4C80 A;  4J9R A;  2V9W A;  1QLN A;  1SIJ A;  1FFU A;  3QE9 Y;  2BQR A;  1M6Y A;  3LK9 A;  3N7S C;  1FIQ A;  4RNN A;  1FO4 A;  3UXP A;  2DQN B;  1ZQZ A;  2AXT U;  1TKD A;  1JRP A;  1ZD3 A;  2HOF A;  4G9B A;  4FZM A;  2M9N A;  2RDJ A;  1RYR A;  7ICS A;  1U45 A;  5DDY A;  1RQN A;  2MRL A;  4MHV A;  2ASD A;  4CF4 A;  4UBB A;  3ZDE A;  3OHB A;  3WK8 A;  4I2A A;  4CF5 A;  5KFD A;  2Y0S C;  3MR5 A;  4J9N A;  4ECX A;  4C4T A;  3D6J A;  5KFM A;  4DSL A;  4WJ3 B;  2F76 X;  5J0R A;  7ICV A;  1TK5 A;  1SV0 A;  4DSE A;  1T3Q A;  2JEG A;  2ZUD A;  5EE9 A;  3WKA A;  3KD3 A;  2K60 A;  4QZF A;  1TFR A;  5DBC A;  4RZR A;  3U26 A;  5J2H A;  4YMO A;  3TFR A;  4KLH A;  2FMQ A;  3SQI A;  7ICF A;  4M9J A;  1N5W A;  4PL1 A;  5AI4 A;  5DQI A;  3QEB Z;  3PSP A;  3SAF A;  5DKW A;  4PGQ A;  9ICS A;  1PK3 A;  7ICQ A;  4UB6 U;  1S9F A;  2KFZ A;  1N2X A;  2FJ6 A;  3NUQ A;  3C2L A;  2ASJ A;  3OJS A;  4M0A A;  2LYB A;  3C23 A;  3IV6 A;  4Y2U A;  1UPH A;  4B9S A;  1SWV A;  2AGP A;  8ICA A;  4Z6C A;  4JB3 A;  3VC8 A;  1HUZ A;  5AK4 A;  4B9M A;  4DL7 A;  2AGO A;  5AK3 A;  4ED0 A;  4PZO A;  4RNO A;  1J97 A;  1JIH A;  4KLE A;  1OUQ A;  4AYB F;  3BQ2 A;  3KOO A;  1ZQV A;  4KX3 A;  1XC9 A;  5IIM A;  3M9M B;  4PHP A;  3WU2 U;  5DG9 A;  2VAN A;  2XC9 A;  4F92 B;  1KW4 A;  1DOQ A;  3PW7 A;  5III A;  3L5K A;  2ZIU A;  1S5L U;  4DOB A;  4NLN A;  4OJP A;  2RQ5 A;  4R8U B;  2BPC A;  3CRX A;  1LVH A;  1TAQ A;  2JGA A;  5J8Y C;  2F77 X;  2YN4 A;  3F2C A;  3MDA A;  3FAH A;  3PX6 A;  4M6W A;  2DBY A;  2BCR A;  2YX8 A;  1DGJ A;  3M6K A;  1NI3 A;  5AI5 A;  1U49 A;  1MN8 A;  4QZD A;  4EBD A;  1HUO A;  3MFI A;  1XO1 A;  4ZH4 A;  1J2M A;  1KKX A;  3F5E A;  3ZI4 A;  1CI4 A;  1L6N A;  4DF4 A;  3RJJ A;  1X6J A;  2DUY A;  2W9A A;  4IL6 U;  2OWO A;  2XGP A;  1SL1 A;  2E8M A;  2XID A;  4OJL A;  4LZD A;  3LYS A;  3KHH A;  4R65 A;  3JPQ A;  2BPG A;  1ZD4 A;  8ICV A;  1PK1 A;  3PVX A;  1T4G A;  4JK1 A;  2WTF A;  3AN1 A;  4RQ8 A;  4R8U A;  4DQS A;  2PMZ C;  2F8K A;  4C4S A;  4P4M A;  1X9S A;  4J9P A;  1B22 A;  4QIW C;  4QWC A;  1PUZ A;  3V6J A;  2WHE A;  4DLG A;  4QZC A;  2N1R A;  3JPR A;  2K4E A;  5BOL A;  5KT6 A;  1X9M A;  1SL0 A;  3QU7 A;  3LVV A;  4C8K A;  4Q8F A;  4TQR A;  1IXR A;  4DL5 A;  5EE1 A;  4F50 A;  1S76 D;  2B0C A;  4UAR A;  4M2Y A;  4BJQ A;  3RF9 A;  3L4P A;  3PZP A;  1ZJM A;  1BPD A;  3HIL A;  1PZN A;  2Y0S F;  2ZJA A;  4US8 A;  4LZG A;  4DOA A;  7ICH A;  4YCX A;  4BX9 C;  2EZX A;  1MQ2 A;  1ZQJ A;  4KN4 A;  1Z1B A;  5DGA A;  2WF9 A;  2HHQ A;  3BQ0 A;  2HBK A;  2ODG A;  4I2E A;  4QIW F;  1JUD A;  2W9B B;  1XO0 A;  2K8B B;  9ICN A;  3TAN A;  2ZTE A;  2NRX A;  2H3Z A;  3FC4 A;  3KKA A;  2H3Q A;  3C28 A;  1L8L A;  4ZOH C;  3C29 A;  1V85 A;  5DQH A;  1ZRM A;  3THV A;  2Y9U A;  4F3O A;  1S0N A;  4P0Q B;  4BGD A;  2OYY A;  2KZ3 A;  3RB3 A;  3MGI A;  2EQY A;  3AMZ A;  5EWF A;  5AK6 A;  5IIO A;  3ZDA A;  4OCZ A;  4NV0 A;  4EBE A;  5KFO A;  1X40 A;  3I76 A;  2K89 A;  5KT2 A;  3RB0 A;  3HW8 A;  3PSF A;  4DQI A;  8ICL A;  3TAD C;  9ICE A;  4NLG A;  3T5H A;  5KFS A;  2G5I B;  8ICI A;  1SGG A;  2EAN A;  3UXO A;  3G6X A;  4RUA A;  1JN3 A;  3BS5 A;  4TUR A;  2OM6 A;  2IMW P;  5DB9 A;  2W9B A;  4RT2 A;  4JV1 A;  5KAF U;  5AM0 A;  5HMM A;  3OJU A;  3KTQ A;  1AQ6 A;  9ICW A;  4Z6D A;  2YB4 A;  1S77 D;  5AKI A;  4RQN A;  2HBJ A;  1A76 A;  3HX0 A;  1L3V A;  3PNC A;  3IHQ B;  3H0R B;  4JWM A;  2CXY A;  4J9K A;  3EZ5 A;  1U48 A;  2YMQ A;  2W9M A;  3CP8 A;  2GLE A;  3N7P D;  4E0D A;  3Q8K A;  2ZIU B;  2DL0 A;  4Y2V A;  4NM2 A;  3B9J A;  2W7P A;  3RJH A;  1SB3 C;  5KFK A;  4GC7 A;  2EAP A;  4AYB C;  5J0Q A;  8ICX A;  3QZ8 A;  1RXV A;  2O6K A;  3E58 A;  2VIX A;  5CP2 A;  1URJ A;  3MAB A;  1XWL A;  1A6S A;  2OEH A;  5ALF A;  1NJW A;  1ZD2 P;  3BJY A;  1BNO A;  3RJI A;  3IM1 A;  2BR0 A;  5AI9 A;  4O3O A;  1S97 A;  5AM1 A;  4F93 B;  4FE3 A;  2MAX A;  2NO5 A;  3TAQ A;  8ICQ A;  4IQW A;  1X66 A;  5KFA A;  4DL6 A;  3ISC A;  2D8C A;  4MEX A;  3H8M A;  2G06 A;  5DDM A;  2C28 A;  2JHD A;  1HJP A;  3SV4 A;  3AQE A;  4GXJ A;  4EZ6 A;  3GDX A;  3Q8P B;  4UB8 U;  4F71 A;  3PSI A;  5KG2 A;  3HWT A;  1V9P A;  4Q8E A;  1ZQK A;  1LV5 A;  4M9L A;  3JPN A;  2RP5 A;  5KG1 A;  2ES6 A;  4F4Z A;  5F3X B;  1L7M A;  5J0Y A;  4NLZ A;  4M9H A;  4U6P A;  3HKZ F;  2W11 A;  5KFL A;  4NM1 A;  1NOM A;  9ICT A;  4I2C A;  4R63 A;  2XVT A;  4Z6E A;  5D4B A;  8ICY A;  8ICP A;  3OSN A;  4ECQ A;  3PX0 A;  4Q44 A;  4BDP A;  1N63 A;  4UB5 A;  2GOL A;  2KZM A;  4IQU A;  2E3T A;  3LWM A;  2I6X A;  2AQ4 A;  3V6K A;  5J2I A;  1ARO P;  4I2D A;  4I28 A;  2G5H B;  4Y2Q A;  4GXI A;  5ALN A;  4QJF B;  4ECS A;  1NZP A;  1Z4O A;  4IR9 A;  3SEI A;  4KLU A;  1C7Y A;  5KFY A;  2IHM A;  2VJ4 A;  5J0P A;  3ZD9 A;  1BPE A;  3B0Y A;  1SXE A;  5ALS A;  1WCN A;  4YXM A;  1UA0 A;  4QWD A;  4NXZ A;  3T5J A;  1UA1 A;  4PL2 A;  2BCV A;  5AHX A;  2AJQ A;  2PFO A;  3E2E A;  1SKW A;  4DSI A;  1MC8 A;  1ZQU A;  1C20 A;  3UQ2 A;  1BNP A;  3C21 A;  3QU4 A;  2ZTC A;  4ED2 A;  4F4K A;  1HEK A;  3RRH A;  5CRX A;  2LYH A;  4OD0 A;  5L1I A;  7ICJ A;  5KT7 A;  2EAO A;  1BPY A;  5D49 A;  2ESE A;  4KLS A;  2EAM A;  1ZQG A;  4F91 B;  4KIT B;  5HR7 A;  5TIS U;  1NK6 A;  9ICA A;  2KEY A;  2EZZ A;  2XIC A;  1N5X A;  4RQ0 A;  1TE2 A;  2Q0Z X;  5C5J A;  5ALI A;  3E0F A;  1BPX A;  2ZIW A;  2J6T A;  2KVC A;  3H0L B;  4XRH A;  1WG8 A;  4IQV A;  3EYZ A;  1ZQ1 C;  8ICE A;  5ALL A;  4ELT A;  1KFS A;  2LPE A;  4RQ6 A;  5L1L A;  7ICU A;  4F5P A;  2QKQ A;  3MR3 A;  2GWS A;  2R8G A;  1NZB A;  2W3R A;  3Q8S B;  2HHU A;  4F5Q A;  4GIB A;  4UBC A;  4KLL A;  2VKQ A;  2CN1 A;  4C8N A;  4RPZ A;  1UHU A;  1RG6 A;  4EEN A;  4M6W B;  1ZQF A;  2VA3 A;  4C8L A;  5EWG A;  3WKB A;  2GH1 A;  5J2E A;  4DEZ A;  3PML A;  4QZ9 A;  3QUB A;  4KLG A;  2FLN A;  3OSP A;  3LWL A;  4J9S A;  1N48 A;  5CJ7 A;  5AKK A;  1KDH A;  4DCC A;  4O3P A;  4YD1 A;  5KL1 B;  3JPS A;  1ED1 A;  3UXN A;  1V97 A;  5KFU A;  5ALY A;  2KK0 A;  1ZQI A;  3MGH A;  3RB4 A;  2R8I A;  3EW9 A;  4XQ8 A;  4OO1 J;  4EX7 A;  2FLL A;  1JX4 A;  3ZD8 A;  2PFN A;  3GIL A;  9ICH A;  1NK4 A;  4O9M A;  1P7D A;  2WB1 C;  1L3S A;  3WKC A;  1KEJ A;  7ICP A;  2NO4 A;  4YP3 A;  3WKD A;  5JUM A;  2G0A A;  4I27 A;  4KLD A;  4O5K A;  3UQ0 A;  4NLC A;  1IM4 A;  3WK7 A;  3RH4 A;  2PMZ F;  1ZQA A;  4DL2 A;  1ZQL A;  3IP4 B;  4UAY A;  4ED3 A;  3HT3 A;  4RQ2 A;  1K1Q A;  5AKE A;  1F5S A;  1VDV A;  3N97 B;  1N56 A;  4RQ3 A;  2JXJ A;  5KFJ A;  4UB2 A;  3CNH A;  8ICM A;  3GFK B;  4KMO B;  2PFQ A;  9ICK A;  3OTQ A;  3SMV A;  2WF6 A;  3OPX A;  1XSL A;  5ALJ A;  5KG7 A;  7ICN A;  2DPI A;  4CNQ A;  1RQL A;  8ICN A;  1GO3 F;  5KFX A;  1SWW A;  3LVW A;  2NV3 A;  4UAZ A;  4ECW A;  5ALT A;  3AL0 B;  1OXJ A;  1ZQP A;  1K5O A;  2BPF A;  1NK8 A;  1L3T A;  3TFS A;  1XU4 A;  2HSZ A;  3SEN A;  2XY6 A;  2ATL A;  4ED8 A;  2ZIX B;  2KJ5 A;  2C2D A;  1PVP A;  4K4G A;  4MFC A;  2KJ8 A;  8ICB A;  5CA7 A;  1KFT A;  5A0L A;  1S8O A;  3RJK A;  3F2D A;  7ICI A;  3ONN A;  4PHA A;  1JMS A;  9ICC A;  4NL9 A;  3ALR A;  4CE6 A;  4TQS A;  5EE0 A;  2D3D A;  2YMP A;  2AHO B;  2BQ3 A;  4FZN A;  1QCK A;  2F8L A;  3UPQ A;  5AKL A;  4MF8 A;  4ED1 A;  4I2J A;  5L1K A;  2FLP A;  1T3N A;  2A3V A;  4KTQ A;  1Z00 A;  1EXN A;  2FDR A;  1QSL A;  2JEF A;  1B0X A;  3H8J A;  3TI0 A;  5J2B A;  1QTM A;  1L7N A;  3HPO A;  2JV3 A;  2MUT A;  4F2S A;  5J2J A;  4Y2Y A;  2W8K A;  5J2G A;  4QWB A;  4I2F A;  9ICQ A;  3ETR A;  3T5L A;  4ECT A;  2HVH A;  4DO9 A;  1RDF A;  2LKY A;  1X6I A;  3V72 A;  3SD7 A;  3V7L A;  2Y1I A;  1RYU A;  2HHV A;  2W9C B;  2JEJ A;  2I1Q A;  2P6R A;  3SAG A;  2Y1J A;  3HKZ C;  4YR2 A;  3K75 D;  4KLQ A;  3BZC A;  4PGY A;  4PPX A;  1ZQM A;  4NY8 A;  2E8N A;  2K8C B;  2YB1 A;  3H4D A;  4A8E A;  4P4O A;  5CB1 A;  3RAQ A;  3UMC A;  4BXO B;  4YQW A;  3QEA Z;  4P2H A;  2HVI A;  4UAS A;  2KE7 A;  2LM4 A;  2KNJ A;  2KMD A;  5DB6 A;  3IDW A;  4DOC A;  2ALZ A;  2I9G A;  3UM9 A;  3WKE A;  4PJ0 U;  3M6Z A;  1KTQ A;  2NRV A;  3TAP A;  3EWA A;  3B0X A;  2QB0 B;  3RJF A;  4KLI A;  1QSY A;  4K4I A;  4JMU A;  1BGX T;  4RNM A;  4K4H A;  2W3S A;  1NJY A;  8ICF A;  5KG0 A;  5AKZ A;  2YQE A;  5DG7 A;  4YD2 A;  4NWI A;  3RFA A;  4DFJ A;  3BQT A;  2H3V A;  4Q43 A;  1DGS A;  4J9Q A;  4RQ7 A;  5T14 A;  5EWE A;  2G08 A;  1QQ6 A;  1ZQO A;  3DV9 A;  3GV5 B;  4CDG A;  2MA1 A;  2R18 A;  1RYS A;  1PVQ A;  3D2N A;  2KZZ A;  2VA2 A;  2BKE A;  3QU5 A;  1Q8K A;  3NVZ A;  4O3R A;  3TQ1 A;  2HHW A;  5J0U A;  2KFN A;  3HJE A;  4F5O A;  3NS1 A;  4DF8 A;  1B43 A;  1BPB A;  3C5G A;  5J29 A;  4ED7 A;  3GIK A;  3T79 A;  1T94 A;  4KLF A;  4R64 A;  3BS7 A;  2HOQ A;  2E8O A;  4NJ8 A;  2FPK A;  5AKH A;  1LKY A;  2OCE A;  5KL8 B;  3ZDB A;  2ZIW B;  1ZRN A;  5GTH U;  3QUC A;  3AEV A;  3SV3 A;  2KJ9 A;  5ALW A;  2P35 A;  5AKY A;  4M9G A;  1COK A;  4YN4 A;  2RLT A;  2IBK A;  3RR7 A;  5E79 U;  5ALH A;  2BDP A;  4QZ8 A;  4DQR A;  2LI6 A;  1ZQT A;  2ZIV A;  2HCF A;  1ZQC A;  3H7I A;  7ICG A;  9ICV A;  1Q3V A;  1KSP A;  2LMR A;  2P66 A;  2KTQ A;  3RBE A;  8ICS A;  4I2H A;  1WUD A;  5KFE A;  3H0M B;  2XGQ A;  3PW4 A;  2P6U A;  4EEL A;  2VA8 A;  3JPP A;  2XY5 A;  2JZB B;  4R66 A;  1JXE A;  4F4W A;  1NK5 A;  1YZ6 A;  5EE3 A;  2OHF A;  4FS1 A;  4NLK A;  1JXL A;  2F3N A;  1ZQD A;  5HR6 A;  3HRD D;  4GLX A;  2RDI A;  2F1J A;  1UT8 A;  3VCB A;  2ASL A;  5AIB A;  4I2G A;  1YT3 A;  4QZG A;  2JMG A;  2HOI A;  1NKE A;  3M1Y A;  3TAC B;  4P0P A;  3T5K A;  3NVV A;  2KIV A;  5J0O A;  4RQ1 A;  1SV4 A;  3A0B U;  2L5Y A;  3O0F A;  1KBU A;  4KN7 A;  1XSN A;  1TAU A;  3QUQ A;  3MR6 A;  3F5A A;  3SI8 A;  4C0Z A;  5J2F A;  5H2F U;  3IRU A;  1VJ5 A;  1ZQS A;  4FBT A;  5FP0 A;  3H8S A;  5AKJ A;  2WAQ C;  9ICF A;  3KBB A;  1DK3 A;  5L1M A;  2PKE A;  2WAQ F;  4IR1 A;  9ICL A; 
#chains in the Genus database with same CATH homology
 3N7P D;  3ICX A;  2XI9 A;  4BX9 C;  4GFJ A;  4QJF B;  2ZIU B;  1Z1B A;  3CRX A;  4FZL A;  2K8C B;  2YB1 A;  2JGA A;  4A8E A;  2W7P A;  2F77 X;  2ZXI A;  2E1E A;  1TAM A;  2DF4 B;  2HBK A;  3PST A;  3F2C A;  4AYB C;  2ZIX B;  2KJ5 A;  1PVP A;  2W03 A;  4QIW F;  2RRD A;  2KJ8 A;  2Q4T A;  2VJ4 A;  2LYA A;  3KZX A;  5KL1 B;  2E1F A;  1ED1 A;  3NRW A;  2K4I A;  4U7C A;  2ZIV A;  5A0L A;  2DGZ A;  2VIX A;  1URJ A;  2YX8 A;  1IIP A;  2KNJ A;  1XO0 A;  3SQI A;  3F2D A;  1A6S A;  2K8B B;  2ZIV B;  2H3I A;  2KHQ A;  4PL1 A;  3ONN A;  4ACO A;  3M6K A;  1Q3V A;  2HBL A;  1XNS A;  2Z7J A;  4P0Q A;  2KKP A;  2WB1 F;  3ALR A;  2CPR A;  2H3Z A;  3PSP A;  2W7O A;  4OJ6 A;  2F2A B;  3SAH A;  3SAF A;  1F44 A;  1WUD A;  2H3Q A;  3H0M B;  4PL2 A;  3C28 A;  3C29 A;  3M6Z A;  3K1Z A;  4FE3 A;  4FZN A;  4OO1 J;  3IN5 A;  3IG8 A;  4P0Q B;  2BDU A;  2K4H A;  2OYY A;  2F8L A;  3IG5 A;  4O3M A;  3F5E A;  2KIW A;  4JMU A;  4CGZ A;  4P0P B;  3M7D A;  1PVR A;  1L6N A;  3NUQ A;  3L3F X;  2LYB A;  1SZH A;  1UPH A;  2G06 A;  2VJ5 A;  1P7D A;  1ECW A;  2RHF A;  2WB1 C;  2A3V A;  2M0N A;  1HEK A;  4NV0 A;  4CRX A;  2XID A;  5CRX A;  1DRG A;  4NWI A;  4OJL A;  3RFA A;  2JHD A;  2ZG6 A;  3D2S A;  2KV2 A;  3AQE A;  3DEE A;  4KX5 A;  2HMX A;  3VC8 A;  2H3V A;  2G0A A;  2D6F C;  5HR6 A;  2K89 A;  3F53 A;  3LYS A;  3AQF A;  4BUG A;  5T14 A;  4NLC A;  2HBM A;  2G08 A;  3PSF A;  5HR7 A;  2K8A A;  3VCB A;  4CDG A;  2MA1 A;  2R18 A;  1MA7 A;  3F2B A;  2PMZ F;  3PSI A;  1YT3 A;  2KEY A;  2JMG A;  1PVQ A;  2HOI A;  2JH7 A;  3IP4 B;  3D2N A;  2PMZ C;  2H3F A;  2XIC A;  3MGV A;  2G5I B;  3N7S C;  2LHT A;  4P0P A;  2KIC A;  3E0F A;  2ZIW A;  2RP5 A;  4QIW C;  2E5S A;  2KVC A;  3H0L B;  1OUQ A;  4AYB F;  4OJO A;  2ZIX A;  1ZQ1 C;  2DQN B;  2G07 A;  2KKV A;  2LKY A;  2OM6 A;  2KOB A;  4U6P A;  2HOF A;  3HKZ F;  2CRX A;  4FZM A;  4KMO B;  1D8B A;  2N1R A;  4KX3 A;  3T79 A;  1T94 A;  2ZXH A;  1HIW A;  3GU3 A;  2K4E A;  2OXO A;  4IC9 A;  4ICA A;  1Q3U A;  2XVT A;  3SMV A;  5C0Y A;  3D2Q A;  2HOQ A;  4QNL A;  1NZB A;  3O0F A;  1KBU A;  3LVV A;  2YB4 A;  3OPX A;  3F5A A;  4C0Z A;  2VKQ A;  2MRL A;  2CN1 A;  2GOL A;  4NLB A;  2JH1 A;  1A0P A;  2ZIU A;  1CRX A;  2KD1 A;  2HBJ A;  5KL8 B;  4BJQ A;  3RF9 A;  1Z19 A;  2ZIW B;  1GO3 F;  3PZP A;  2WAQ C;  3N7R C;  3LVW A;  2NV3 A;  3SAG A;  2Y0S C;  2LBO A;  3H0R B;  2KHV A;  3HKZ C;  4OJ5 A;  2GH1 A;  2KJ9 A;  4OJP A;  2G09 A;  2W04 A;  2Y0S F;  3AL0 B;  2OH2 A;  3GZF A;  2WAQ F;  3KFU F;  3CYM A;  4WJ3 B;  2F76 X;  2G5H B;  3CP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...