2KJ9A

Nmr structure of intb phage-integrase-like protein fragment 90-199 from erwinia carotova subsp. atroseptica: northeast structural genomics consortium target ewr217e
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
118
structure length
118
Chain Sequence
b'KSVQEKRNNTRAFKTVAKSWFATKTTWSEDYQRSVWTRLETYLFPDIGNKDIAELDTGDLLVPIKKIEKLGYLEIAMRVKQYATAIMRYAVQQKMIRFNPAYDLEGAVQKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title NMR structure of IntB phage-integrase-like protein fragment 90-199 from Erwinia carotova subsp. atroseptica
rcsb
source organism Pectobacterium atrosepticum
molecule tags Dna binding protein
total genus 35
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kj9A00
1CRXA 2KJ5A 1P7DA 3MGVA 1XNSA 1PVPA 3NRWA 4ACOA 1PVQA 1KBUA 1F44A 2HOFA 3C28A 2A3VA 4A8EA 2KIWA 5CRXA 2KHQA 2HOIA 1XO0A 1Q3UA 3C29A 2KOBA 1NZBA 2KD1A 1Z1BA 1DRGA 4CRXA 1PVRA 1Q3VA 1OUQA 2KJ8A 2KKVA 2OXOA 1MA7A 2KEYA 1Z19A 3CRXA 3LYSA 2KHVA 2KKPA 1A0PA 2CRXA 2KJ9A
chains in the Genus database with same CATH superfamily
3EPGA 4K4GA 1JI7A 3WK5A 3RB3A 3RTVA 2Q4TA 3RB6A 2BR0A 3QE9Y 3V6HA 2ZIWB 4P4PA 2MA1A 4FFDA 5KFJA 5E79U 1L7MA 3BS7A 7ICMA 3K1RB 1JRPA 1J2MA 3RBDA 1FFVA 5KFDA 4YR0A 4RQ5A 5CHGA 5KFHA 1RYSA 2WAQC 4CNQA 1Q46A 4XUSA 2MUTB 1V38A 1Q3UA 2IHNA 2WHEA 4RT2A 4US8A 2RDIA 4KLDA 4DQQA 3PW0A 1L3TA 2F3NA 8ICNA 5ALVA 2A1JA 4RQ7A 1LV5A 3HX0A 3C2MA 4RUCA 4PL1A 3AU6A 4FS1A 5HP4A 4WJ3B 5AKHA 3QXGA 2KZZA 5KFFA 3ONNA 2W9MA 3GDXA 3MR5A 4DSKA 5DG8A 3RB0A 3ED5A 1XO1A 2PFPA 1U48A 5ALEA 1N63A 3G6VA 4EYIB 2KP7A 2F2AB 4NLCA 4PGXA 3RH4A 5KT6A 4ECYA 4DL7A 3OSPA 3MR6A 1VLBA 1SKSA 2V4RA 2B6GA 4R64A 1TVAA 3TADC 2ODGA 1PVRA 2IMWP 3OSNA 5KNIA 1MQ3A 1TE2A 2E8NA 2QARB 3QEBZ 1XSPA 4KLOA 5C0YA 1MN8A 1VJ5A 3H8JA 1T3NA 2WB1C 1KEJA 1KW4A 2E8MA 3AL0B 4I27A 2W43A 3F5AA 8ICAA 3RJEA 2EZZA 4MHVA 3Q8LA 3IG8A 4P0PA 9ICXA 3DDHA 2MAXA 4IR9A 1SV4A 8ICHA 3KZXA 3G6YA 1BGXT 8ICEA 5L9XA 4EELA 2P66A 1S0VA 4Y2QA 4J9QA 4QZCA 4C8LA 2ZXIA 4ZOHC 1PK1A 3VC8A 2RDJA 3C23A 7ICOA 2CN1A 5ALHA 3OHAA 4KITB 4FZNA 5HMMA 5J0XA 1D8YA 4ZH4A 2AGPA 4RQ2A 5H2FU 2CPRA 2EQYA 1NKBA 2W3SA 1ZD2P 3RJIA 1QSYA 3UMGA 5B5EU 1L6NA 3I1YA 3QNMA 2JEGA 5AM4A 4LZGA 4MF8A 8ICPA 2HCFA 3QU5A 3MGIA 4C8MA 3RAQA 4DL2A 4KLFA 9ICFA 1IG6A 4UBBA 5CR0A 1SGGA 1ZQHA 1Z00A 2FI1A 5IINA 4C4SA 3UQ0A 2CXYA 5DQHA 5KG1A 2R8HA 2R8GA 4YQWA 4O5CA 9ICBA 5IIMA 7ICHA 2OXOA 4BDPA 2JV3A 5KT3A 3T3FA 1D8LA 1ZQWA 2J6TA 3JPOA 4B9NA 2BCRA 3OGUA 2Z7JA 2FPKA 7ICUA 2W7OA 2PMZF 2KOBA 3GFKB 4G9BA 1ZQTA 2IOFK 4O3SA 3TQ1A 2J6UA 3MFHA 4IRDA 3KHHA 2WF7A 1L8LA 1L5UA 2BDUA 2W04A 4FZLA 3Q8KA 5AK5A 1ECWA 3N7RC 4NLBA 4UATA 4P0QA 2IBKA 3M9OB 1DGSA 4KX5A 3PR5B 2K8CB 3GIMA 5HHIA 2AU0A 2MSNA 3KHRA 2F76X 2AQ0A 5IIJA 5KFXA 5KFOA 3NTUA 1RQLA 1WUDA 1NK7A 3D6JA 5KFPA 5AICA 2Y1IA 2XC9A 3PSFA 1ZQVA 3AMZA 1KLNA 4R66A 4M9NA 1JROA 4LZDA 1C7YA 4B9LA 1IM4A 2H3FA 3BZCA 4CCHA 5KFRA 3M7DA 2R8IA 4O9MA 1Y88A 8ICKA 4F5NA 2HHWA 3WK8A 4QIWF 5KT7A 5KG4A 4R8UA 1ZQQA 3NRWA 1X9MA 5KT5A 5IILA 1XU4A 2BCVA 4I2CA 1KTQA 4I2IA 4QZ9A 4JWMA 4KX3A 3OJSA 4OJ5A 3TAQA 4YMMA 2EDUA 5ALDA 4KLEA 2KK0A 2WF9A 9ICSA 1O03A 5G5HA 1WWVA 4IQVA 4ECXA 1CEZA 3TI0A 2KSOB 4ECZA 9ICJA 3ZDAA 4KLUA 3TFSA 2W11A 5JUMA 2BCQA 1TK8A 3UXNA 4J9MA 4KMUA 2W9BA 4M9LA 1L3UA 7ICKA 1N5XA 2W3RA 4TURA 2KTQA 3IG5A 2ZIXB 5DQGA 1O08A 3QU4A 4DSJA 4EYHB 5B66U 1SL1A 4P4MA 1S5LU 2EAMA 2GOLA 1RDFA 3K75D 3ISDA 4F5PA 2HOIA 2YMQA 2DFLA 9ICTA 2M0NA 2NRZA 3UPQA 4RQNA 7ICNA 1TAUA 3AEVA 1X42A 4RT3A 2FLNA 1XNSA 5J2BA 4AP9A 3GIKA 3NVWA 4CGZA 4F4XA 1MQ2A 4ED7A 4O5KA 2G5HB 3ISBA 3TADA 4F5RA 4U6PA 2E3TA 4I2AA 2C2RA 9ICNA 5L1JA 2L5YA 4I2BA 5BOMA 2B21A 4TQSA 1MA7A 3LVWA 2LYBA 2W9CA 4DFJA 4BJQA 1EXNA 1CRXA 9ICQA 4USAA 3TAPA 1KRPA 2GH1A 4I29A 3ICXA 4MFFA 5J2CA 5EE3A 5HMLA 1ZD4A 2I1QA 4DSLA 1RM6C 7ICEA 2P6UA 4Q8FA 3H40A 3U26A 3BQ1A 1SKRA 3IM1A 2NRXA 9ICMA 4NL9A 2GO7A 3K4GA 4YFKA 3IDWA 3NGDA 4QZGA 5K4LA 1JALA 1ZQSA 5ALXA 4YD1A 2ZJ5A 1S9FA 4M9JA 4GLXA 4DQIA 5EWGA 4J9LA 5KFNA 4JK1A 2YTUA 1JX4A 2LYHA 2WTFA 2ZIVB 2XY6A 3MC1A 1JXLA 1OW5A 1U47A 5J0WA 2YQEA 1NJXA 3TANA 1ZQOA 2GWSA 4U7CA 2KG5A 2K8AA 1AQ6A 1SB3C 2F8LA 2DF4B 3Q8SB 1HEKA 4F8RA 3C28A 1NKCA 1L7OA 3HKZC 1COKA 5FP0A 3DEEA 1N61A 3N7SC 2BQ3A 3RF9A 3SQIA 3PO4A 3PMLA 3E0FA 1J2NA 9ICGA 4NWIA 2KHVA 2WF5A 4UAYA 3A0BU 2AXTU 2ASDA 1WYGA 3L3FX 4RPXA 1PVQA 2HVIA 3BS5A 3A0HU 1SZPA 4J9OA 3T5LA 3RJKA 5DG9A 1ZQMA 1QQ6A 3WK4A 4B9MA 3ZD9A 5ALQA 2W9AA 4YXMA 4YXJA 4DEZA 2KEYA 2XCPA 5TISU 2DPJA 9ICEA 4DF8A 5KFAA 5KG6A 2QB0B 3H8WA 4BUGA 4DOCA 2AQ4A 2ZUDA 2XI9A 2AGQA 3WKDA 3IP4B 1NZBA 3BQ0A 5KFGA 3AUOA 1N48A 3BQTA 2J6SA 3ALRA 5KFBA 2JH7A 2MU2A 4I2HA 2ES6A 4DS5A 2KE7A 2ZUCA 2XIDA 4I2DA 3SEIA 1TK0A 4Y2VA 3V7KA 3MGHA 7ICIA 5HHHA 3RBEA 4EZ9A 3VCBA 3PW5A 2C2DA 2F1HA 4I2JA 1UA1A 4EBEA 4ED6A 1RQNA 2BKEA 3KFUF 4DFKA 9ICPA 8ICBA 2JZBA 2C22A 3PZPA 3WU2U 5KFSA 3GILA 2ZJ8A 4RNMA 4GXKA 5HNKA 1ZXIA 4UB6U 2IA6A 5J29A 3PSPA 5D4BA 4DLEA 3M6ZA 4PZOA 5EWFA 4RPYA 2XICA 2A1JB 4JB3A 8ICSA 4ECSA 3SAHA 2C28A 8ICMA 2DPIA 1RXVA 4US9A 4ELUA 5L1MA 2JMGA 1BPDA 3FC4A 4DL3A 5BPCA 3MR3A 2KJ5A 1F5SA 4TUPA 3SI8A 2OEHA 2Q0ZX 3GZFA 1K1QA 4ED1A 3KZIU 3EYZA 5AK4A 3GV7B 2VA3A 2ZJAA 5EE9A 1V85A 3ZD8A 4G3IA 4O0IA 4NM2A 5AK3A 3HT3A 4DQRA 1NKEA 9ICIA 3RR8A 5J2HA 4DL5A 2EAOA 1KFDA 1BNPA 2AGOA 4BXOB 3F2BA 3DV9A 4TUQA 1SXEA 2HSZA 1WCNA 1V9PA 4DFPA 1QTMA 4NLNA 3EZ5A 1S10A 3UM9A 3SMVA 4OD0A 3PX0A 1KDHA 5DBCA 3RRHA 4QZAA 4EX6A 4PHDA 1ZD3A 2DKXA 4GIBA 3H0MB 2FLLA 4K4HA 1UT5A 1DRGA 4X5VA 2NRWA 4RUAA 2BZFA 1Z19A 1ZRMA 4E0DA 2E8OA 4Y2YA 4XA5A 2A19A 2RRDA 5DG7A 5ALSA 4GC6A 2PKEA 3RH6A 3ZDBA 4QWBA 4ELTA 3RR7A 2ZG6A 4LJXA 4UAWA 2VJ4A 3QUCA 1NJWA 4F93B 4NXZA 4DL6A 4P0PB 5J2KA 9ICCA 4YVZA 1LKYA 2HHXA 5AM0A 1RYRA 3SR6A 3MR2A 5AIBA 4FZMA 4UW9A 4QWAA 4KLTA 4J9NA 3TACB 2C2EA 3GIIA 3BZKA 4AYBF 2HHQA 4C8KA 2KD1A 3C1YA 9ICOA 1V97A 3J81j 3N28A 2V4QA 3QU9A 1TAQA 1PK1B 3N7PD 4C4RA 4UB1A 4ECVA 1T7PA 1ZQPA 3PX6A 2W03A 4NL9C 3Q8MA 3PMNA 5TZVA 1VDVA 2D8CA 3QX7A 1COOA 1T8EA 3WK6A 1RYUA 4ECQA 5CRXA 4HYKA 3RB4A 2JH1A 3PNCA 2Y0SC 2BQRA 2YY6A 4DFDA 7ICGA 5L1KA 2IOHA 1TKDA 4DWIA 4QZFA 1SL0A 4Y2UA 1ZQNA 4Y2TA 7ICLA 3BQ2A 1YZ6A 1ED1A 3CNHA 1ZQAA 4ED3A 5KG3A 2Y1JA 4IRCA 4HAIA 7ICRA 4UAZA 2XY5A 3NS1A 2D3DA 2M9NA 4ED0A 4I2FA 2B0CA 2XGQA 3V7JA 3AM9A 3E58A 9ICUA 2VA8A 5CA7A 2WF6A 3GQCA 4UBCA 5J8YA 2AJQA 5CB1A 5DB7A 1XC9A 3SV3A 1PVPA 4RNNA 3H4DA 4O3OA 5AM1A 7ICSA 2A3VA 4Y2PA 2ISOA 3T5HA 3D2QA 5AM2A 1TK5A 5F9NA 2EANA 3OJUA 3UXPA 4IQUA 1JN3A 3I28A 2JGAA 1CUKA 2H3ZA 4J9KA 4DSEA 2KJ9A 3KOOA 3SYZA 2YX8A 4KLHA 4QW9A 1SV0C 4R65A 2BGWA 1X6IA 4ELVA 2H3IA 3FM9A 4UAVA 4P0QB 1S76D 5J0YA 5J0SA 3B0YA 5J0TA 7ICFA 3TARA 2YN4A 5L1IA 4DLGA 2E8PA 2LM1A 4UARA 4RU9A 3HP6A 4ICAA 1B22A 1JUDA 4KLIA 1YZ7A 3MFIA 4C0ZA 5KFIA 3CW2C 4YMOA 5KFTA 5KT2A 3JPNA 9ICWA 5DB6A 9ICVA 3HRDD 1T4GA 3ORYA 4M9GA 5JU5A 2R18A 4M0AA 1N60A 3SZ2A 3L5KA 3NVVA 3OHBA 3V7LA 1ZETA 3SD7A 1ZJMA 2YMMA 2PXIA 3HPOA 3M9NB 3WK9A 1ZQZA 2PI5A 5JRTA 2G07A 4QW8A 2LKYA 5DLGA 1L3VA 1N56A 1BPYA 3ZDDA 3QEAZ 5CEHA 5ALIA 4GC7A 2W8LA 1ZJNA 4QNLA 9ICLA 8ICRA 4F92B 5J0UA 7ICPA 3ISCA 4ECUA 2NRVA 2K4HA 5EE1A 5KAFU 2W9BB 1BPXA 1ZQ1C 4PZNA 3N97B 4F2SA 4QZEA 1NK0A 1OXJA 4PL2A 1KN5A 3RH5A 2YB1A 4GFJA 2QKQA 3PX4A 1HJPA 1GO3F 1S8OA 1XWLA 1B0XA 4EEYA 4A8EA 5KG2A 2WAQF 4KTQA 5KG7A 3LK9A 2DWQA 2LYAA 4MEXA 1Q3VA 3F5EA 1SXDA 4QWDA 5ALGA 3RJJA 3H8MA 3G6XA 4YMNA 4KLSA 2IHMA 1S0MA 4ECTA 3O0FA 1C20A 3BJYA 2HOFA 3F2DA 3MDAA 4C80A 2ASJA 5F3XB 5CP2A 2HW3A 2W55A 2K4IA 2QLTA 1ZRNA 5KT4A 1QCKA 5G5GA 2DQNB 3HWTA 8ICXA 2ZIUA 2ALZA 4UASA 2KZMA 3WK7A 5GTIU 3CRXA 4FS2A 3TFRA 3PR4A 4F3OA 1UCVA 1DXSA 2EZYA 5EE0A 3H4BA 2PI4A 2HBJA 3CYMA 3PVXA 2YB4A 1NK6A 3AQEA 2KFZA 4EBCA 3NUQA 3HW8A 4ECWA 5IIOA 2FDRA 2KKVA 2OHFA 4BWMA 3PW2A 1BPEA 5KL8B 1UQVA 2ASLA 4YCXA 4C7ZA 4ECRA 2DL0A 4KLJA 5AI5A 5ALWA 2KIWA 2FMSA 8ICQA 4DCCA 2F8KA 5D49A 3BQ7A 4CF3A 1JIHA 3H8SA 4CRXA 3CP8A 4PJ0U 2VIXA 4YR2A 2G08A 1M6YA 3KKAC 1UT8A 5AM3A 3QYPA 4M6WA 2Y9UA 2HI0A 3RJGA 1S97A 5J2EA 4QZ8A 1IXRA 1B4FA 2LBOA 1KL9A 5J2DA 4CDGA 5AKGA 4IQWA 2WB1F 3LVVA 4UB3A 1NK4A 3SV4A 5KFMA 2DGZA 5KL1B 2OYYA 3PSIA 2KV2A 1U45A 4FE3A 5J8YC 2BPGA 4RPZA 1UA0A 5ALFA 1ZQCA 1B43A 4B9VA 4NLKA 4K4IA 1XS9D 1FIQA 5ALUA 5A0LA 3MBYA 7ICTA 5AKLA 4NM1A 1SIJA 4F4YA 4JV0A 1NJYA 2F1IA 3RJHA 1MC8A 2GLEA 3C2KA 5ALOA 3PV8A 4ACOA 3Q8QB 3HILA 1ZYQA 3WKAA 2ZUBA 3M9MB 5KFEA 2PMZC 2XCAA 2VA2A 3SENA 5ALJA 2EAPA 4QZDA 2P35A 4O3PA 1L7NA 2HBLA 4Y2JA 1BPZA 1OUQA 1JXEA 1KFSA 2FPMA 2I5HA 3C5GA 3FDSA 1L8OA 2LM4A 3JPRA 2PFQA 4JV2A 1SV0A 5J0QA 3JPTA 2MRLA 1KBUA 3KBBA 1X9WA 5C5JA 2KVSA 5AK6A 4UB2A 4RQ3A 5DBBA 3GV5B 2LHTA 2YMLA 4PGQA 1ZQXA 2RQ5A 3THVA 4F4KA 8ICJA 2JZBB 2G09A 2K4EA 4QJFB 1N5WA 4B9TA 3JPQA 2WF8A 1SZHA 2CRXA 1KQQA 4YG2A 3WKBA 2G5IB 4XRHA 1Z3EB 2BQUA 2DBYA 3IRUA 2FMPA 1FFUA 4DQSA 2KZ3A 2KMDA 1ZOLA 2JXJA 3QZ8A 3NRZA 4QIWC 5KFUA 7ICJA 2BHNA 2QB0A 3K1ZA 3WKEA 4LVSA 2I6XA 4MEYA 4Q8EA 5BOLA 2ATLA 3R9KA 3AQFA 4F5QA 5ALMA 2E5SA 2OH2A 3MABA 4RQ6A 1NNLA 3BDPA 2UVVA 1A6SA 3T5JA 3QU2A 5KFWA 3PW4A 1SWWA 5J2JA 1X2IA 2KNJA 2ZTEA 1IV8A 4PHAA 4KN7A 4OJLA 5J0PA 4DO9A 1XSLA 2KKPA 2R8JA 5AI6A 3F2CA 8ICTA 2NO4A 4NJ8A 4JWNA 2ZXHA 2XGPA 5AKEA 4CF4A 5ALYA 2ZIWA 5AKKA 3NVYA 2W8KA 3IV6A 3JPSA 2KN7A 1D9DA 1IIPA 1TV9A 4C8OA 1QH9A 2BCSA 1DK3A 2XY7A 5DDYA 4B6JA 4ED8A 3V6KA 4J03A 1KKXA 1ZQJA 5KFVA 2W7PA 3PSTA 4F4ZA 1U4BA 2I9GA 5F9LA 2MUTA 1K5OA 3AU2A 1ZQGA 5ALPA 5ALKA 4Q44A 1S0OA 1T3QA 1LVHA 3Q8RB 1PK3A 1ZD5A 4J9SA 2OWOA 2JHDA 1HUOA 1WCLA 2K89A 3FYHA 1LKYB 2UVWA 2QB1A 1BPBA 3I76A 1DOQA 2F77X 3NVZA 2BDPA 5L1LA 1NOMA 3EWAA 4R63A 1XO0A 4KLQA 3H7IA 3AN1A 3C2LA 4Z6DA 4Z6CA 2VJ5A 7ICQA 4RNOA 4KMOB 2VKQA 2KFNA 4BXOA 1QLNA 4O3QA 8ICGA 5EWEA 4KLGA 4BWJA 3C21A 4C4TA 5CWRA 4IRKA 1UHUA 2JR5A 4QZHA 4KLLA 1TAMA 4MF2A 2G0AA 4F4WA 2HHTA 2KJ8A 1WWUA 4PHPA 2HHVA 2YMPA 2F1JA 3H0RB 4IR1A 3LYSA 1A0PA 2NV3A 4Y2RA 2KICA 1ZQLA 2HOQA 2BPFA 4IC9A 4O3RA 2RHFA 5HR6A 1ZQEA 4Z6FA 5D46A 1L3SA 4RQMA 5ALZA 5KFKA 4BGDA 2D6FC 2K4PA 3KKAA 2QARA 2PFOA 4F5OA 3QUQA 4J9RA 4BX9C 1ZQDA 2JEIA 3PY8A 5AI0A 2HMXA 4CE6A 4RQ0A 3RRGA 3OTQA 5CJ7A 2DUYA 2HDOA 1QQ7A 1D9FA 1RPLA 2UVRA 3EPIA 4NLGA 3RAXA 3UMCA 1Z00B 1U49A 4F91B 5KG5A 4O3NA 1DGJA 1N62A 1X6JA 8ICFA 4DL4A 4CF5A 4QWEA 3GU3A 5AKJA 4UQGA 2W54A 3L4PA 2ZTCA 1Z4OA 2V9WA 4UB4A 1PUZA 3LDAA 3UQ2A 1NZPA 1NJZA 2G06A 3QUTA 3KHGA 1RXWA 3F53A 4OJ6A 3HJEA 4P2HA 1ZQRA 8ICVA 4EENA 2LI6A 4GXIA 4I28A 3C5FA 1UPHA 3B0XA 1FEZA 4PGYA 4PHEA 5KFCA 4DF4A 4EZ6A 1Z1BA 3HKZF 1Q8KA 4PH5A 3TKAA 1PZNA 4XQ8A 4M9HA 4M04A 5AI4A 1S0NA 3EW9A 2NYVA 1L7PA 5AM5A 5ALRA 4YP3A 4UB5A 5KAIU 2JRZA 5AI9A 8ICYA 4I2EA 3C29A 3WKCA 1MSWD 3GV8B 3KD3A 4C8NA 1NK8A 9ICRA 4R8UB 4I2GA 5KFLA 8ICIA 2N1RA 5J2FA 2ISPA 3H0LB 4IQTA 1KFTA 2DKZA 3V72A 4YR3A 8ICZA 1KSPA 4F71A 5GTHU 1P7DA 4EBDA 4JUZA 1F44A 5AKZA 1A77A 4OJOA 3S6JA 3RFAA 1HUZA 1SL2A 2E1FA 2FJ6A 3RJFA 1SKWA 2ZTDA 5AHXA 4IL6U 2FMQA 5DDMA 5AI8A 4Q45A 4Z6EA 1ZQBA 4OJPA 3KTQA 4C7YA 5DQIA 4B9SA 1ZQYA 5IIIA 3MDCA 4OO1J 1DK2A 1ZQFA 4DOBA 1TFRA 3D2NA 2A1AA 1A76A 5DGAA 3E2EA 4P4OA 4GXJA 4JV1A 1NI3A 2FPLA 4KN4A 4UAUA 2ZIUB 1X40A 5ALLA 3ZI4A 4QZIA 2XVTA 1BVSA 5EOZA 4TQRA 1NK5A 2BPCA 2UVUA 2R8KA 4DSIA 3C1ZA 4QZBA 5KFQA 5DB9A 8ICLA 2OM6A 2JEJA 9ICAA 2RP5A 4YN4A 4UB8U 1FO4A 2KSOA 3GIJA 2F44A 3Q8PB 3T5KA 4RZRA 2HVHA 2W9CB 5DB8A 1CI4A 1JMSA 3B9JA 4AYBC 4QWCA 4RQ8A 5J0OA 1YT3A 3QU7A 4PPXA 2RLTA 2ZIXA 2NRTA 2K60A 4O3MA 2H3QA 3PW7A 4DOAA 1WG8A 1N2XA 1K1SA 3FAHA 5AKYA 1S77D 2LPEA 2ESEA 5J2GA 2EZXA 5DKWA 2P6RA 4M6WB 5IIKA 5J2AA 5ALTA 4DFMA 3LWLA 3KHLA 2KHQA 4RQ4A 2BCUA 1Z1VA 2HBKA 1X66A 2H5XA 4O5EA 2AH5A 4Y2XA 3QZ7A 9ICKA 1BNOA 2WFAA 8ICUA 4EX7A 2LMRA 4DSFA 1XSNA 4DS4A 3ZDEA 3M8RA 3PO5A 3UXOA 4RQ1A 1X9XA 5T14A 4M47A 2KIVA 5KFZA 5J2IA 1T94A 1X9SA 3UMBA 4B9UA 3NASA 4M2YA 5JTIA 5DLFA 4YD2A 3ZDCA 1RG6A 3N4MB 3T79A 4F2RA 4J9PA 4Y2SA 2NO5A 3BS5B 4ED2A 3M8SA 4JMUA 1ZQIA 2KVCA 4IS7A 2AHOB 4MFAA 2Y0SF 2FLPA 5AKXA 3EUB2 3SAGA 2IOFA 8ICCA 4FO6A 1URJA 2K8BB 3QUBA 4KLMA 2FE9A 2VANA 4EEKA 5DBAA 3JPPA 2OCEA 5KG0A 3SAFA 9ICHA 4DQPA 2ZIVA 1SWVA 1QSLA 1D8BA 3D2SA 3M1YA 5DGBA 2Y9TA 5ALNA 2XO7A 5J0RA 1HIWA 3LWMA 3ETLA 1RZTA 4F50A 5KTQA 4Q43A 4FBTA 4NV0A 1F0MA 3V6JA 1H38A 2H3VA 2HHSA 3OPXA 3IN5A 3ETRA 4MFCA 2JEFA 4F72A 4TUSA 2PFNA 3MGVA 5AIAA 1AROP 4FBUA 1NK9A 1QQ5A 1LB2B 2HHUA 2HBMA 2O6KA 5AKIA 8ICWA 2E1EA 7ICVA 5HR7A 4NY8A 1U9LA 5KFYA 3IHQB 1ZQKA 1J97A 4OCZA 4NLZA 1ZQUA 8ICOA 3M6KA 2EH9A 1Z4NA 1QSSA
chains in the Genus database with same CATH topology
1CRXA 2KICA 3F2BA 2HOQA 3NRWA 4ACOA 4BUGA 2ZXHA 2XVTA 2GH1A 4IC9A 2Q4TA 3T79A 2PMZC 2ZIWA 2G07A 2XI9A 2LKYA 3ICXA 2HBJA 2ZIWB 3CYMA 2RHFA 3SMVA 2YB4A 2MA1A 4KX3A 5HR6A 3IP4B 3AQEA 4OJ5A 3C29A 1NZBA 1IIPA 3NUQA 4JMUA 2HBLA 2OM6A 3H0MB 2KVCA 1DRGA 2RP5A 1PVRA 1OUQA 2D6FC 4QNLA 3ALRA 2KKVA 2JH7A 2Y0SF 2OXOA 1Z19A 3CRXA 4BX9C 3SAGA 5C0YA 2RRDA 1URJA 2K8BB 2MRLA 1KBUA 5KL8B 1PVPA 2XIDA 2W7PA 2HMXA 3PSTA 2WAQC 4AYBC 2K4HA 2WB1C 2A3VA 1YT3A 2KIWA 3AL0B 2Z7JA 2N1RA 3SAFA 3VCBA 2ZG6A 2W7OA 1Q3UA 2PMZF 2KOBA 3D2QA 3F5AA 2ZIXA 2VJ4A 2ZIVA 4O3MA 4P0PA 2H3QA 3IG8A 3IG5A 2LHTA 2ZIXB 4CRXA 3KFUF 2ZIVB 3CP8A 1ZQ1C 3PZPA 4P0PB 2VIXA 2JGAA 3H0LB 2H3ZA 2G08A 2G09A 2K4EA 2JHDA 4QJFB 1D8BA 3D2SA 3PSPA 3KZXA 4PL2A 2K89A 2KJ9A 1SZHA 2BDUA 2CRXA 4U7CA 2K8AA 2W04A 2YX8A 4FZLA 2YB1A 1ECWA 2F8LA 2DF4B 3M6ZA 4FZMA 4GFJA 1P7DA 3N7RC 4NLBA 1F44A 2G5IB 2XICA 1HIWA 2F77X 1HEKA 3GU3A 4P0QA 1GO3F 2H3IA 2GOLA 3C28A 2LBOA 4P0QB 4KX5A 4A8EA 3SAHA 3HKZC 2KHQA 4PL1A 4OJOA 2K8CB 3DEEA 2HOIA 3RFAA 4CDGA 1XO0A 2WAQF 3N7SC 2HBKA 4AYBF 4WJ3B 3RF9A 2WB1F 2KD1A 3LVVA 2ZXIA 4NV0A 3SQIA 2E1FA 3E0FA 2LYAA 3ONNA 3VC8A 2VJ5A 2JMGA 3F5EA 1Q3VA 2G06A 4QIWC 2DGZA 5KL1B 2M0NA 4NWIA 3N7PD 2F76X 2H3VA 2VKQA 2CN1A 3F53A 4ICAA 4KMOB 4OJ6A 2OYYA 2KHVA 2KV2A 3OPXA 3PSIA 2W03A 4FZNA 3IN5A 3K1ZA 1WUDA 4FE3A 4C0ZA 3L3FX 3O0FA 2KJ5A 2OH2A 3AQFA 3MGVA 1XNSA 2E5SA 1PVQA 4OJPA 3PSFA 1UPHA 2HOFA 4CGZA 4OO1J 3GZFA 3F2DA 1A6SA 2CPRA 5CRXA 2HBMA 2G5HB 3D2NA 2JH1A 5A0LA 2E1EA 4U6PA 1TAMA 2K4IA 2H3FA 2Y0SC 5HR7A 2R18A 2KNJA 5T14A 2G0AA 1Z1BA 3HKZF 2DQNB 1L6NA 2F2AB 3M7DA 2ZIUA 4NLCA 2KJ8A 3M6KA 2ZIUB 4OJLA 1MA7A 2KEYA 1T94A 3H0RB 3LVWA 3LYSA 2KKPA 2LYBA 1A0PA 2NV3A 3F2CA 4QIWF 4BJQA 1ED1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CRX A;  2KJ5 A;  1P7D A;  3MGV A;  1XNS A;  1PVP A;  3NRW A;  4ACO A;  1PVQ A;  1KBU A;  1F44 A;  2HOF A;  3C28 A;  2A3V A;  4A8E A;  2KIW A;  5CRX A;  2KHQ A;  2HOI A;  1XO0 A;  1Q3U A;  3C29 A;  2KOB A;  1NZB A;  2KD1 A;  1Z1B A;  1DRG A;  4CRX A;  1PVR A;  1Q3V A;  1OUQ A;  2KJ8 A;  2KKV A;  2OXO A;  1MA7 A;  2KEY A;  1Z19 A;  3CRX A;  3LYS A;  2KHV A;  2KKP A;  1A0P A;  2CRX A;  2KJ9 A; 
#chains in the Genus database with same CATH topology
 3EPG A;  4K4G A;  1JI7 A;  3WK5 A;  3RB3 A;  3RTV A;  2Q4T A;  3RB6 A;  2BR0 A;  3QE9 Y;  3V6H A;  2ZIW B;  4P4P A;  2MA1 A;  4FFD A;  5KFJ A;  5E79 U;  1L7M A;  3BS7 A;  7ICM A;  3K1R B;  1JRP A;  1J2M A;  3RBD A;  1FFV A;  5KFD A;  4YR0 A;  4RQ5 A;  5CHG A;  5KFH A;  1RYS A;  2WAQ C;  4CNQ A;  1Q46 A;  4XUS A;  2MUT B;  1V38 A;  1Q3U A;  2IHN A;  2WHE A;  4RT2 A;  4US8 A;  2RDI A;  4KLD A;  4DQQ A;  3PW0 A;  1L3T A;  2F3N A;  8ICN A;  5ALV A;  2A1J A;  4RQ7 A;  1LV5 A;  3HX0 A;  3C2M A;  4RUC A;  4PL1 A;  3AU6 A;  4FS1 A;  5HP4 A;  4WJ3 B;  5AKH A;  3QXG A;  2KZZ A;  5KFF A;  3ONN A;  2W9M A;  3GDX A;  3MR5 A;  4DSK A;  5DG8 A;  3RB0 A;  3ED5 A;  1XO1 A;  2PFP A;  1U48 A;  5ALE A;  1N63 A;  3G6V A;  4EYI B;  2KP7 A;  2F2A B;  4NLC A;  4PGX A;  3RH4 A;  5KT6 A;  4ECY A;  4DL7 A;  3OSP A;  3MR6 A;  1VLB A;  1SKS A;  2V4R A;  2B6G A;  4R64 A;  1TVA A;  3TAD C;  2ODG A;  1PVR A;  2IMW P;  3OSN A;  5KNI A;  1MQ3 A;  1TE2 A;  2E8N A;  2QAR B;  3QEB Z;  1XSP A;  4KLO A;  5C0Y A;  1MN8 A;  1VJ5 A;  3H8J A;  1T3N A;  2WB1 C;  1KEJ A;  1KW4 A;  2E8M A;  3AL0 B;  4I27 A;  2W43 A;  3F5A A;  8ICA A;  3RJE A;  2EZZ A;  4MHV A;  3Q8L A;  3IG8 A;  4P0P A;  9ICX A;  3DDH A;  2MAX A;  4IR9 A;  1SV4 A;  8ICH A;  3KZX A;  3G6Y A;  1BGX T;  8ICE A;  5L9X A;  4EEL A;  2P66 A;  1S0V A;  4Y2Q A;  4J9Q A;  4QZC A;  4C8L A;  2ZXI A;  4ZOH C;  1PK1 A;  3VC8 A;  2RDJ A;  3C23 A;  7ICO A;  2CN1 A;  5ALH A;  3OHA A;  4KIT B;  4FZN A;  5HMM A;  5J0X A;  1D8Y A;  4ZH4 A;  2AGP A;  4RQ2 A;  5H2F U;  2CPR A;  2EQY A;  1NKB A;  2W3S A;  1ZD2 P;  3RJI A;  1QSY A;  3UMG A;  5B5E U;  1L6N A;  3I1Y A;  3QNM A;  2JEG A;  5AM4 A;  4LZG A;  4MF8 A;  8ICP A;  2HCF A;  3QU5 A;  3MGI A;  4C8M A;  3RAQ A;  4DL2 A;  4KLF A;  9ICF A;  1IG6 A;  4UBB A;  5CR0 A;  1SGG A;  1ZQH A;  1Z00 A;  2FI1 A;  5IIN A;  4C4S A;  3UQ0 A;  2CXY A;  5DQH A;  5KG1 A;  2R8H A;  2R8G A;  4YQW A;  4O5C A;  9ICB A;  5IIM A;  7ICH A;  2OXO A;  4BDP A;  2JV3 A;  5KT3 A;  3T3F A;  1D8L A;  1ZQW A;  2J6T A;  3JPO A;  4B9N A;  2BCR A;  3OGU A;  2Z7J A;  2FPK A;  7ICU A;  2W7O A;  2PMZ F;  2KOB A;  3GFK B;  4G9B A;  1ZQT A;  2IOF K;  4O3S A;  3TQ1 A;  2J6U A;  3MFH A;  4IRD A;  3KHH A;  2WF7 A;  1L8L A;  1L5U A;  2BDU A;  2W04 A;  4FZL A;  3Q8K A;  5AK5 A;  1ECW A;  3N7R C;  4NLB A;  4UAT A;  4P0Q A;  2IBK A;  3M9O B;  1DGS A;  4KX5 A;  3PR5 B;  2K8C B;  3GIM A;  5HHI A;  2AU0 A;  2MSN A;  3KHR A;  2F76 X;  2AQ0 A;  5IIJ A;  5KFX A;  5KFO A;  3NTU A;  1RQL A;  1WUD A;  1NK7 A;  3D6J A;  5KFP A;  5AIC A;  2Y1I A;  2XC9 A;  3PSF A;  1ZQV A;  3AMZ A;  1KLN A;  4R66 A;  4M9N A;  1JRO A;  4LZD A;  1C7Y A;  4B9L A;  1IM4 A;  2H3F A;  3BZC A;  4CCH A;  5KFR A;  3M7D A;  2R8I A;  4O9M A;  1Y88 A;  8ICK A;  4F5N A;  2HHW A;  3WK8 A;  4QIW F;  5KT7 A;  5KG4 A;  4R8U A;  1ZQQ A;  3NRW A;  1X9M A;  5KT5 A;  5IIL A;  1XU4 A;  2BCV A;  4I2C A;  1KTQ A;  4I2I A;  4QZ9 A;  4JWM A;  4KX3 A;  3OJS A;  4OJ5 A;  3TAQ A;  4YMM A;  2EDU A;  5ALD A;  4KLE A;  2KK0 A;  2WF9 A;  9ICS A;  1O03 A;  5G5H A;  1WWV A;  4IQV A;  4ECX A;  1CEZ A;  3TI0 A;  2KSO B;  4ECZ A;  9ICJ A;  3ZDA A;  4KLU A;  3TFS A;  2W11 A;  5JUM A;  2BCQ A;  1TK8 A;  3UXN A;  4J9M A;  4KMU A;  2W9B A;  4M9L A;  1L3U A;  7ICK A;  1N5X A;  2W3R A;  4TUR A;  2KTQ A;  3IG5 A;  2ZIX B;  5DQG A;  1O08 A;  3QU4 A;  4DSJ A;  4EYH B;  5B66 U;  1SL1 A;  4P4M A;  1S5L U;  2EAM A;  2GOL A;  1RDF A;  3K75 D;  3ISD A;  4F5P A;  2HOI A;  2YMQ A;  2DFL A;  9ICT A;  2M0N A;  2NRZ A;  3UPQ A;  4RQN A;  7ICN A;  1TAU A;  3AEV A;  1X42 A;  4RT3 A;  2FLN A;  1XNS A;  5J2B A;  4AP9 A;  3GIK A;  3NVW A;  4CGZ A;  4F4X A;  1MQ2 A;  4ED7 A;  4O5K A;  2G5H B;  3ISB A;  3TAD A;  4F5R A;  4U6P A;  2E3T A;  4I2A A;  2C2R A;  9ICN A;  5L1J A;  2L5Y A;  4I2B A;  5BOM A;  2B21 A;  4TQS A;  1MA7 A;  3LVW A;  2LYB A;  2W9C A;  4DFJ A;  4BJQ A;  1EXN A;  1CRX A;  9ICQ A;  4USA A;  3TAP A;  1KRP A;  2GH1 A;  4I29 A;  3ICX A;  4MFF A;  5J2C A;  5EE3 A;  5HML A;  1ZD4 A;  2I1Q A;  4DSL A;  1RM6 C;  7ICE A;  2P6U A;  4Q8F A;  3H40 A;  3U26 A;  3BQ1 A;  1SKR A;  3IM1 A;  2NRX A;  9ICM A;  4NL9 A;  2GO7 A;  3K4G A;  4YFK A;  3IDW A;  3NGD A;  4QZG A;  5K4L A;  1JAL A;  1ZQS A;  5ALX A;  4YD1 A;  2ZJ5 A;  1S9F A;  4M9J A;  4GLX A;  4DQI A;  5EWG A;  4J9L A;  5KFN A;  4JK1 A;  2YTU A;  1JX4 A;  2LYH A;  2WTF A;  2ZIV B;  2XY6 A;  3MC1 A;  1JXL A;  1OW5 A;  1U47 A;  5J0W A;  2YQE A;  1NJX A;  3TAN A;  1ZQO A;  2GWS A;  4U7C A;  2KG5 A;  2K8A A;  1AQ6 A;  1SB3 C;  2F8L A;  2DF4 B;  3Q8S B;  1HEK A;  4F8R A;  3C28 A;  1NKC A;  1L7O A;  3HKZ C;  1COK A;  5FP0 A;  3DEE A;  1N61 A;  3N7S C;  2BQ3 A;  3RF9 A;  3SQI A;  3PO4 A;  3PML A;  3E0F A;  1J2N A;  9ICG A;  4NWI A;  2KHV A;  2WF5 A;  4UAY A;  3A0B U;  2AXT U;  2ASD A;  1WYG A;  3L3F X;  4RPX A;  1PVQ A;  2HVI A;  3BS5 A;  3A0H U;  1SZP A;  4J9O A;  3T5L A;  3RJK A;  5DG9 A;  1ZQM A;  1QQ6 A;  3WK4 A;  4B9M A;  3ZD9 A;  5ALQ A;  2W9A A;  4YXM A;  4YXJ A;  4DEZ A;  2KEY A;  2XCP A;  5TIS U;  2DPJ A;  9ICE A;  4DF8 A;  5KFA A;  5KG6 A;  2QB0 B;  3H8W A;  4BUG A;  4DOC A;  2AQ4 A;  2ZUD A;  2XI9 A;  2AGQ A;  3WKD A;  3IP4 B;  1NZB A;  3BQ0 A;  5KFG A;  3AUO A;  1N48 A;  3BQT A;  2J6S A;  3ALR A;  5KFB A;  2JH7 A;  2MU2 A;  4I2H A;  2ES6 A;  4DS5 A;  2KE7 A;  2ZUC A;  2XID A;  4I2D A;  3SEI A;  1TK0 A;  4Y2V A;  3V7K A;  3MGH A;  7ICI A;  5HHH A;  3RBE A;  4EZ9 A;  3VCB A;  3PW5 A;  2C2D A;  2F1H A;  4I2J A;  1UA1 A;  4EBE A;  4ED6 A;  1RQN A;  2BKE A;  3KFU F;  4DFK A;  9ICP A;  8ICB A;  2JZB A;  2C22 A;  3PZP A;  3WU2 U;  5KFS A;  3GIL A;  2ZJ8 A;  4RNM A;  4GXK A;  5HNK A;  1ZXI A;  4UB6 U;  2IA6 A;  5J29 A;  3PSP A;  5D4B A;  4DLE A;  3M6Z A;  4PZO A;  5EWF A;  4RPY A;  2XIC A;  2A1J B;  4JB3 A;  8ICS A;  4ECS A;  3SAH A;  2C28 A;  8ICM A;  2DPI A;  1RXV A;  4US9 A;  4ELU A;  5L1M A;  2JMG A;  1BPD A;  3FC4 A;  4DL3 A;  5BPC A;  3MR3 A;  2KJ5 A;  1F5S A;  4TUP A;  3SI8 A;  2OEH A;  2Q0Z X;  3GZF A;  1K1Q A;  4ED1 A;  3KZI U;  3EYZ A;  5AK4 A;  3GV7 B;  2VA3 A;  2ZJA A;  5EE9 A;  1V85 A;  3ZD8 A;  4G3I A;  4O0I A;  4NM2 A;  5AK3 A;  3HT3 A;  4DQR A;  1NKE A;  9ICI A;  3RR8 A;  5J2H A;  4DL5 A;  2EAO A;  1KFD A;  1BNP A;  2AGO A;  4BXO B;  3F2B A;  3DV9 A;  4TUQ A;  1SXE A;  2HSZ A;  1WCN A;  1V9P A;  4DFP A;  1QTM A;  4NLN A;  3EZ5 A;  1S10 A;  3UM9 A;  3SMV A;  4OD0 A;  3PX0 A;  1KDH A;  5DBC A;  3RRH A;  4QZA A;  4EX6 A;  4PHD A;  1ZD3 A;  2DKX A;  4GIB A;  3H0M B;  2FLL A;  4K4H A;  1UT5 A;  1DRG A;  4X5V A;  2NRW A;  4RUA A;  2BZF A;  1Z19 A;  1ZRM A;  4E0D A;  2E8O A;  4Y2Y A;  4XA5 A;  2A19 A;  2RRD A;  5DG7 A;  5ALS A;  4GC6 A;  2PKE A;  3RH6 A;  3ZDB A;  4QWB A;  4ELT A;  3RR7 A;  2ZG6 A;  4LJX A;  4UAW A;  2VJ4 A;  3QUC A;  1NJW A;  4F93 B;  4NXZ A;  4DL6 A;  4P0P B;  5J2K A;  9ICC A;  4YVZ A;  1LKY A;  2HHX A;  5AM0 A;  1RYR A;  3SR6 A;  3MR2 A;  5AIB A;  4FZM A;  4UW9 A;  4QWA A;  4KLT A;  4J9N A;  3TAC B;  2C2E A;  3GII A;  3BZK A;  4AYB F;  2HHQ A;  4C8K A;  2KD1 A;  3C1Y A;  9ICO A;  1V97 A;  3J81 j;  3N28 A;  2V4Q A;  3QU9 A;  1TAQ A;  1PK1 B;  3N7P D;  4C4R A;  4UB1 A;  4ECV A;  1T7P A;  1ZQP A;  3PX6 A;  2W03 A;  4NL9 C;  3Q8M A;  3PMN A;  5TZV A;  1VDV A;  2D8C A;  3QX7 A;  1COO A;  1T8E A;  3WK6 A;  1RYU A;  4ECQ A;  5CRX A;  4HYK A;  3RB4 A;  2JH1 A;  3PNC A;  2Y0S C;  2BQR A;  2YY6 A;  4DFD A;  7ICG A;  5L1K A;  2IOH A;  1TKD A;  4DWI A;  4QZF A;  1SL0 A;  4Y2U A;  1ZQN A;  4Y2T A;  7ICL A;  3BQ2 A;  1YZ6 A;  1ED1 A;  3CNH A;  1ZQA A;  4ED3 A;  5KG3 A;  2Y1J A;  4IRC A;  4HAI A;  7ICR A;  4UAZ A;  2XY5 A;  3NS1 A;  2D3D A;  2M9N A;  4ED0 A;  4I2F A;  2B0C A;  2XGQ A;  3V7J A;  3AM9 A;  3E58 A;  9ICU A;  2VA8 A;  5CA7 A;  2WF6 A;  3GQC A;  4UBC A;  5J8Y A;  2AJQ A;  5CB1 A;  5DB7 A;  1XC9 A;  3SV3 A;  1PVP A;  4RNN A;  3H4D A;  4O3O A;  5AM1 A;  7ICS A;  2A3V A;  4Y2P A;  2ISO A;  3T5H A;  3D2Q A;  5AM2 A;  1TK5 A;  5F9N A;  2EAN A;  3OJU A;  3UXP A;  4IQU A;  1JN3 A;  3I28 A;  2JGA A;  1CUK A;  2H3Z A;  4J9K A;  4DSE A;  2KJ9 A;  3KOO A;  3SYZ A;  2YX8 A;  4KLH A;  4QW9 A;  1SV0 C;  4R65 A;  2BGW A;  1X6I A;  4ELV A;  2H3I A;  3FM9 A;  4UAV A;  4P0Q B;  1S76 D;  5J0Y A;  5J0S A;  3B0Y A;  5J0T A;  7ICF A;  3TAR A;  2YN4 A;  5L1I A;  4DLG A;  2E8P A;  2LM1 A;  4UAR A;  4RU9 A;  3HP6 A;  4ICA A;  1B22 A;  1JUD A;  4KLI A;  1YZ7 A;  3MFI A;  4C0Z A;  5KFI A;  3CW2 C;  4YMO A;  5KFT A;  5KT2 A;  3JPN A;  9ICW A;  5DB6 A;  9ICV A;  3HRD D;  1T4G A;  3ORY A;  4M9G A;  5JU5 A;  2R18 A;  4M0A A;  1N60 A;  3SZ2 A;  3L5K A;  3NVV A;  3OHB A;  3V7L A;  1ZET A;  3SD7 A;  1ZJM A;  2YMM A;  2PXI A;  3HPO A;  3M9N B;  3WK9 A;  1ZQZ A;  2PI5 A;  5JRT A;  2G07 A;  4QW8 A;  2LKY A;  5DLG A;  1L3V A;  1N56 A;  1BPY A;  3ZDD A;  3QEA Z;  5CEH A;  5ALI A;  4GC7 A;  2W8L A;  1ZJN A;  4QNL A;  9ICL A;  8ICR A;  4F92 B;  5J0U A;  7ICP A;  3ISC A;  4ECU A;  2NRV A;  2K4H A;  5EE1 A;  5KAF U;  2W9B B;  1BPX A;  1ZQ1 C;  4PZN A;  3N97 B;  4F2S A;  4QZE A;  1NK0 A;  1OXJ A;  4PL2 A;  1KN5 A;  3RH5 A;  2YB1 A;  4GFJ A;  2QKQ A;  3PX4 A;  1HJP A;  1GO3 F;  1S8O A;  1XWL A;  1B0X A;  4EEY A;  4A8E A;  5KG2 A;  2WAQ F;  4KTQ A;  5KG7 A;  3LK9 A;  2DWQ A;  2LYA A;  4MEX A;  1Q3V A;  3F5E A;  1SXD A;  4QWD A;  5ALG A;  3RJJ A;  3H8M A;  3G6X A;  4YMN A;  4KLS A;  2IHM A;  1S0M A;  4ECT A;  3O0F A;  1C20 A;  3BJY A;  2HOF A;  3F2D A;  3MDA A;  4C80 A;  2ASJ A;  5F3X B;  5CP2 A;  2HW3 A;  2W55 A;  2K4I A;  2QLT A;  1ZRN A;  5KT4 A;  1QCK A;  5G5G A;  2DQN B;  3HWT A;  8ICX A;  2ZIU A;  2ALZ A;  4UAS A;  2KZM A;  3WK7 A;  5GTI U;  3CRX A;  4FS2 A;  3TFR A;  3PR4 A;  4F3O A;  1UCV A;  1DXS A;  2EZY A;  5EE0 A;  3H4B A;  2PI4 A;  2HBJ A;  3CYM A;  3PVX A;  2YB4 A;  1NK6 A;  3AQE A;  2KFZ A;  4EBC A;  3NUQ A;  3HW8 A;  4ECW A;  5IIO A;  2FDR A;  2KKV A;  2OHF A;  4BWM A;  3PW2 A;  1BPE A;  5KL8 B;  1UQV A;  2ASL A;  4YCX A;  4C7Z A;  4ECR A;  2DL0 A;  4KLJ A;  5AI5 A;  5ALW A;  2KIW A;  2FMS A;  8ICQ A;  4DCC A;  2F8K A;  5D49 A;  3BQ7 A;  4CF3 A;  1JIH A;  3H8S A;  4CRX A;  3CP8 A;  4PJ0 U;  2VIX A;  4YR2 A;  2G08 A;  1M6Y A;  3KKA C;  1UT8 A;  5AM3 A;  3QYP A;  4M6W A;  2Y9U A;  2HI0 A;  3RJG A;  1S97 A;  5J2E A;  4QZ8 A;  1IXR A;  1B4F A;  2LBO A;  1KL9 A;  5J2D A;  4CDG A;  5AKG A;  4IQW A;  2WB1 F;  3LVV A;  4UB3 A;  1NK4 A;  3SV4 A;  5KFM A;  2DGZ A;  5KL1 B;  2OYY A;  3PSI A;  2KV2 A;  1U45 A;  4FE3 A;  5J8Y C;  2BPG A;  4RPZ A;  1UA0 A;  5ALF A;  1ZQC A;  1B43 A;  4B9V A;  4NLK A;  4K4I A;  1XS9 D;  1FIQ A;  5ALU A;  5A0L A;  3MBY A;  7ICT A;  5AKL A;  4NM1 A;  1SIJ A;  4F4Y A;  4JV0 A;  1NJY A;  2F1I A;  3RJH A;  1MC8 A;  2GLE A;  3C2K A;  5ALO A;  3PV8 A;  4ACO A;  3Q8Q B;  3HIL A;  1ZYQ A;  3WKA A;  2ZUB A;  3M9M B;  5KFE A;  2PMZ C;  2XCA A;  2VA2 A;  3SEN A;  5ALJ A;  2EAP A;  4QZD A;  2P35 A;  4O3P A;  1L7N A;  2HBL A;  4Y2J A;  1BPZ A;  1OUQ A;  1JXE A;  1KFS A;  2FPM A;  2I5H A;  3C5G A;  3FDS A;  1L8O A;  2LM4 A;  3JPR A;  2PFQ A;  4JV2 A;  1SV0 A;  5J0Q A;  3JPT A;  2MRL A;  1KBU A;  3KBB A;  1X9W A;  5C5J A;  2KVS A;  5AK6 A;  4UB2 A;  4RQ3 A;  5DBB A;  3GV5 B;  2LHT A;  2YML A;  4PGQ A;  1ZQX A;  2RQ5 A;  3THV A;  4F4K A;  8ICJ A;  2JZB B;  2G09 A;  2K4E A;  4QJF B;  1N5W A;  4B9T A;  3JPQ A;  2WF8 A;  1SZH A;  2CRX A;  1KQQ A;  4YG2 A;  3WKB A;  2G5I B;  4XRH A;  1Z3E B;  2BQU A;  2DBY A;  3IRU A;  2FMP A;  1FFU A;  4DQS A;  2KZ3 A;  2KMD A;  1ZOL A;  2JXJ A;  3QZ8 A;  3NRZ A;  4QIW C;  5KFU A;  7ICJ A;  2BHN A;  2QB0 A;  3K1Z A;  3WKE A;  4LVS A;  2I6X A;  4MEY A;  4Q8E A;  5BOL A;  2ATL A;  3R9K A;  3AQF A;  4F5Q A;  5ALM A;  2E5S A;  2OH2 A;  3MAB A;  4RQ6 A;  1NNL A;  3BDP A;  2UVV A;  1A6S A;  3T5J A;  3QU2 A;  5KFW A;  3PW4 A;  1SWW A;  5J2J A;  1X2I A;  2KNJ A;  2ZTE A;  1IV8 A;  4PHA A;  4KN7 A;  4OJL A;  5J0P A;  4DO9 A;  1XSL A;  2KKP A;  2R8J A;  5AI6 A;  3F2C A;  8ICT A;  2NO4 A;  4NJ8 A;  4JWN A;  2ZXH A;  2XGP A;  5AKE A;  4CF4 A;  5ALY A;  2ZIW A;  5AKK A;  3NVY A;  2W8K A;  3IV6 A;  3JPS A;  2KN7 A;  1D9D A;  1IIP A;  1TV9 A;  4C8O A;  1QH9 A;  2BCS A;  1DK3 A;  2XY7 A;  5DDY A;  4B6J A;  4ED8 A;  3V6K A;  4J03 A;  1KKX A;  1ZQJ A;  5KFV A;  2W7P A;  3PST A;  4F4Z A;  1U4B A;  2I9G A;  5F9L A;  2MUT A;  1K5O A;  3AU2 A;  1ZQG A;  5ALP A;  5ALK A;  4Q44 A;  1S0O A;  1T3Q A;  1LVH A;  3Q8R B;  1PK3 A;  1ZD5 A;  4J9S A;  2OWO A;  2JHD A;  1HUO A;  1WCL A;  2K89 A;  3FYH A;  1LKY B;  2UVW A;  2QB1 A;  1BPB A;  3I76 A;  1DOQ A;  2F77 X;  3NVZ A;  2BDP A;  5L1L A;  1NOM A;  3EWA A;  4R63 A;  1XO0 A;  4KLQ A;  3H7I A;  3AN1 A;  3C2L A;  4Z6D A;  4Z6C A;  2VJ5 A;  7ICQ A;  4RNO A;  4KMO B;  2VKQ A;  2KFN A;  4BXO A;  1QLN A;  4O3Q A;  8ICG A;  5EWE A;  4KLG A;  4BWJ A;  3C21 A;  4C4T A;  5CWR A;  4IRK A;  1UHU A;  2JR5 A;  4QZH A;  4KLL A;  1TAM A;  4MF2 A;  2G0A A;  4F4W A;  2HHT A;  2KJ8 A;  1WWU A;  4PHP A;  2HHV A;  2YMP A;  2F1J A;  3H0R B;  4IR1 A;  3LYS A;  1A0P A;  2NV3 A;  4Y2R A;  2KIC A;  1ZQL A;  2HOQ A;  2BPF A;  4IC9 A;  4O3R A;  2RHF A;  5HR6 A;  1ZQE A;  4Z6F A;  5D46 A;  1L3S A;  4RQM A;  5ALZ A;  5KFK A;  4BGD A;  2D6F C;  2K4P A;  3KKA A;  2QAR A;  2PFO A;  4F5O A;  3QUQ A;  4J9R A;  4BX9 C;  1ZQD A;  2JEI A;  3PY8 A;  5AI0 A;  2HMX A;  4CE6 A;  4RQ0 A;  3RRG A;  3OTQ A;  5CJ7 A;  2DUY A;  2HDO A;  1QQ7 A;  1D9F A;  1RPL A;  2UVR A;  3EPI A;  4NLG A;  3RAX A;  3UMC A;  1Z00 B;  1U49 A;  4F91 B;  5KG5 A;  4O3N A;  1DGJ A;  1N62 A;  1X6J A;  8ICF A;  4DL4 A;  4CF5 A;  4QWE A;  3GU3 A;  5AKJ A;  4UQG A;  2W54 A;  3L4P A;  2ZTC A;  1Z4O A;  2V9W A;  4UB4 A;  1PUZ A;  3LDA A;  3UQ2 A;  1NZP A;  1NJZ A;  2G06 A;  3QUT A;  3KHG A;  1RXW A;  3F53 A;  4OJ6 A;  3HJE A;  4P2H A;  1ZQR A;  8ICV A;  4EEN A;  2LI6 A;  4GXI A;  4I28 A;  3C5F A;  1UPH A;  3B0X A;  1FEZ A;  4PGY A;  4PHE A;  5KFC A;  4DF4 A;  4EZ6 A;  1Z1B A;  3HKZ F;  1Q8K A;  4PH5 A;  3TKA A;  1PZN A;  4XQ8 A;  4M9H A;  4M04 A;  5AI4 A;  1S0N A;  3EW9 A;  2NYV A;  1L7P A;  5AM5 A;  5ALR A;  4YP3 A;  4UB5 A;  5KAI U;  2JRZ A;  5AI9 A;  8ICY A;  4I2E A;  3C29 A;  3WKC A;  1MSW D;  3GV8 B;  3KD3 A;  4C8N A;  1NK8 A;  9ICR A;  4R8U B;  4I2G A;  5KFL A;  8ICI A;  2N1R A;  5J2F A;  2ISP A;  3H0L B;  4IQT A;  1KFT A;  2DKZ A;  3V72 A;  4YR3 A;  8ICZ A;  1KSP A;  4F71 A;  5GTH U;  1P7D A;  4EBD A;  4JUZ A;  1F44 A;  5AKZ A;  1A77 A;  4OJO A;  3S6J A;  3RFA A;  1HUZ A;  1SL2 A;  2E1F A;  2FJ6 A;  3RJF A;  1SKW A;  2ZTD A;  5AHX A;  4IL6 U;  2FMQ A;  5DDM A;  5AI8 A;  4Q45 A;  4Z6E A;  1ZQB A;  4OJP A;  3KTQ A;  4C7Y A;  5DQI A;  4B9S A;  1ZQY A;  5III A;  3MDC A;  4OO1 J;  1DK2 A;  1ZQF A;  4DOB A;  1TFR A;  3D2N A;  2A1A A;  1A76 A;  5DGA A;  3E2E A;  4P4O A;  4GXJ A;  4JV1 A;  1NI3 A;  2FPL A;  4KN4 A;  4UAU A;  2ZIU B;  1X40 A;  5ALL A;  3ZI4 A;  4QZI A;  2XVT A;  1BVS A;  5EOZ A;  4TQR A;  1NK5 A;  2BPC A;  2UVU A;  2R8K A;  4DSI A;  3C1Z A;  4QZB A;  5KFQ A;  5DB9 A;  8ICL A;  2OM6 A;  2JEJ A;  9ICA A;  2RP5 A;  4YN4 A;  4UB8 U;  1FO4 A;  2KSO A;  3GIJ A;  2F44 A;  3Q8P B;  3T5K A;  4RZR A;  2HVH A;  2W9C B;  5DB8 A;  1CI4 A;  1JMS A;  3B9J A;  4AYB C;  4QWC A;  4RQ8 A;  5J0O A;  1YT3 A;  3QU7 A;  4PPX A;  2RLT A;  2ZIX A;  2NRT A;  2K60 A;  4O3M A;  2H3Q A;  3PW7 A;  4DOA A;  1WG8 A;  1N2X A;  1K1S A;  3FAH A;  5AKY A;  1S77 D;  2LPE A;  2ESE A;  5J2G A;  2EZX A;  5DKW A;  2P6R A;  4M6W B;  5IIK A;  5J2A A;  5ALT A;  4DFM A;  3LWL A;  3KHL A;  2KHQ A;  4RQ4 A;  2BCU A;  1Z1V A;  2HBK A;  1X66 A;  2H5X A;  4O5E A;  2AH5 A;  4Y2X A;  3QZ7 A;  9ICK A;  1BNO A;  2WFA A;  8ICU A;  4EX7 A;  2LMR A;  4DSF A;  1XSN A;  4DS4 A;  3ZDE A;  3M8R A;  3PO5 A;  3UXO A;  4RQ1 A;  1X9X A;  5T14 A;  4M47 A;  2KIV A;  5KFZ A;  5J2I A;  1T94 A;  1X9S A;  3UMB A;  4B9U A;  3NAS A;  4M2Y A;  5JTI A;  5DLF A;  4YD2 A;  3ZDC A;  1RG6 A;  3N4M B;  3T79 A;  4F2R A;  4J9P A;  4Y2S A;  2NO5 A;  3BS5 B;  4ED2 A;  3M8S A;  4JMU A;  1ZQI A;  2KVC A;  4IS7 A;  2AHO B;  4MFA A;  2Y0S F;  2FLP A;  5AKX A;  3EUB 2;  3SAG A;  2IOF A;  8ICC A;  4FO6 A;  1URJ A;  2K8B B;  3QUB A;  4KLM A;  2FE9 A;  2VAN A;  4EEK A;  5DBA A;  3JPP A;  2OCE A;  5KG0 A;  3SAF A;  9ICH A;  4DQP A;  2ZIV A;  1SWV A;  1QSL A;  1D8B A;  3D2S A;  3M1Y A;  5DGB A;  2Y9T A;  5ALN A;  2XO7 A;  5J0R A;  1HIW A;  3LWM A;  3ETL A;  1RZT A;  4F50 A;  5KTQ A;  4Q43 A;  4FBT A;  4NV0 A;  1F0M A;  3V6J A;  1H38 A;  2H3V A;  2HHS A;  3OPX A;  3IN5 A;  3ETR A;  4MFC A;  2JEF A;  4F72 A;  4TUS A;  2PFN A;  3MGV A;  5AIA A;  1ARO P;  4FBU A;  1NK9 A;  1QQ5 A;  1LB2 B;  2HHU A;  2HBM A;  2O6K A;  5AKI A;  8ICW A;  2E1E A;  7ICV A;  5HR7 A;  4NY8 A;  1U9L A;  5KFY A;  3IHQ B;  1ZQK A;  1J97 A;  4OCZ A;  4NLZ A;  1ZQU A;  8ICO A;  3M6K A;  2EH9 A;  1Z4N A;  1QSS A; 
#chains in the Genus database with same CATH homology
 1CRX A;  2KIC A;  3F2B A;  2HOQ A;  3NRW A;  4ACO A;  4BUG A;  2ZXH A;  2XVT A;  2GH1 A;  4IC9 A;  2Q4T A;  3T79 A;  2PMZ C;  2ZIW A;  2G07 A;  2XI9 A;  2LKY A;  3ICX A;  2HBJ A;  2ZIW B;  3CYM A;  2RHF A;  3SMV A;  2YB4 A;  2MA1 A;  4KX3 A;  5HR6 A;  3IP4 B;  3AQE A;  4OJ5 A;  3C29 A;  1NZB A;  1IIP A;  3NUQ A;  4JMU A;  2HBL A;  2OM6 A;  3H0M B;  2KVC A;  1DRG A;  2RP5 A;  1PVR A;  1OUQ A;  2D6F C;  4QNL A;  3ALR A;  2KKV A;  2JH7 A;  2Y0S F;  2OXO A;  1Z19 A;  3CRX A;  4BX9 C;  3SAG A;  5C0Y A;  2RRD A;  1URJ A;  2K8B B;  2MRL A;  1KBU A;  5KL8 B;  1PVP A;  2XID A;  2W7P A;  2HMX A;  3PST A;  2WAQ C;  4AYB C;  2K4H A;  2WB1 C;  2A3V A;  1YT3 A;  2KIW A;  3AL0 B;  2Z7J A;  2N1R A;  3SAF A;  3VCB A;  2ZG6 A;  2W7O A;  1Q3U A;  2PMZ F;  2KOB A;  3D2Q A;  3F5A A;  2ZIX A;  2VJ4 A;  2ZIV A;  4O3M A;  4P0P A;  2H3Q A;  3IG8 A;  3IG5 A;  2LHT A;  2ZIX B;  4CRX A;  3KFU F;  2ZIV B;  3CP8 A;  1ZQ1 C;  3PZP A;  4P0P B;  2VIX A;  2JGA A;  3H0L B;  2H3Z A;  2G08 A;  2G09 A;  2K4E A;  2JHD A;  4QJF B;  1D8B A;  3D2S A;  3PSP A;  3KZX A;  4PL2 A;  2K89 A;  2KJ9 A;  1SZH A;  2BDU A;  2CRX A;  4U7C A;  2K8A A;  2W04 A;  2YX8 A;  4FZL A;  2YB1 A;  1ECW A;  2F8L A;  2DF4 B;  3M6Z A;  4FZM A;  4GFJ A;  1P7D A;  3N7R C;  4NLB A;  1F44 A;  2G5I B;  2XIC A;  1HIW A;  2F77 X;  1HEK A;  3GU3 A;  4P0Q A;  1GO3 F;  2H3I A;  2GOL A;  3C28 A;  2LBO A;  4P0Q B;  4KX5 A;  4A8E A;  3SAH A;  3HKZ C;  2KHQ A;  4PL1 A;  4OJO A;  2K8C B;  3DEE A;  2HOI A;  3RFA A;  4CDG A;  1XO0 A;  2WAQ F;  3N7S C;  2HBK A;  4AYB F;  4WJ3 B;  3RF9 A;  2WB1 F;  2KD1 A;  3LVV A;  2ZXI A;  4NV0 A;  3SQI A;  2E1F A;  3E0F A;  2LYA A;  3ONN A;  3VC8 A;  2VJ5 A;  2JMG A;  3F5E A;  1Q3V A;  2G06 A;  4QIW C;  2DGZ A;  5KL1 B;  2M0N A;  4NWI A;  3N7P D;  2F76 X;  2H3V A;  2VKQ A;  2CN1 A;  3F53 A;  4ICA A;  4KMO B;  4OJ6 A;  2OYY A;  2KHV A;  2KV2 A;  3OPX A;  3PSI A;  2W03 A;  4FZN A;  3IN5 A;  3K1Z A;  1WUD A;  4FE3 A;  4C0Z A;  3L3F X;  3O0F A;  2KJ5 A;  2OH2 A;  3AQF A;  3MGV A;  1XNS A;  2E5S A;  1PVQ A;  4OJP A;  3PSF A;  1UPH A;  2HOF A;  4CGZ A;  4OO1 J;  3GZF A;  3F2D A;  1A6S A;  2CPR A;  5CRX A;  2HBM A;  2G5H B;  3D2N A;  2JH1 A;  5A0L A;  2E1E A;  4U6P A;  1TAM A;  2K4I A;  2H3F A;  2Y0S C;  5HR7 A;  2R18 A;  2KNJ A;  5T14 A;  2G0A A;  1Z1B A;  3HKZ F;  2DQN B;  1L6N A;  2F2A B;  3M7D A;  2ZIU A;  4NLC A;  2KJ8 A;  3M6K A;  2ZIU B;  4OJL A;  1MA7 A;  2KEY A;  1T94 A;  3H0R B;  3LVW A;  3LYS A;  2KKP A;  2LYB A;  1A0P A;  2NV3 A;  3F2C A;  4QIW F;  4BJQ A;  1ED1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...