2KJ9A

Nmr structure of intb phage-integrase-like protein fragment 90-199 from erwinia carotova subsp. atroseptica: northeast structural genomics consortium target ewr217e
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
118
structure length
118
Chain Sequence
KSVQEKRNNTRAFKTVAKSWFATKTTWSEDYQRSVWTRLETYLFPDIGNKDIAELDTGDLLVPIKKIEKLGYLEIAMRVKQYATAIMRYAVQQKMIRFNPAYDLEGAVQKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of IntB phage-integrase-like protein fragment 90-199 from Erwinia carotova subsp. atroseptica
rcsb
source organism Pectobacterium atrosepticum
molecule tags Dna binding protein
molecule keywords Integrase
total genus 35
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kj9A00
3LYSA 1OUQA 5CRXA 2HOFA 2OXOA 2KOBA 3MGVA 2CRXA 3NRWA 1PVRA 2KHQA 1Z19A 1P7DA 1NZBA 2KEYA 1Q3UA 3CRXA 4CRXA 4A8EA 1XO0A 3C29A 1XNSA 1A0PA 2KD1A 1MA7A 2KHVA 1PVPA 2KKVA 1PVQA 2A3VA 1DRGA 3C28A 2KJ8A 1Q3VA 4ACOA 2KJ5A 2KIWA 1KBUA 1Z1BA 2HOIA 1F44A 2KJ9A 1CRXA 2KKPA
chains in the Genus database with same CATH superfamily
3CNHA 2MUTB 1HUOA 2AH5A 2F77X 1WWUA 2E5SA 1SZPA 4J03A 1NJXA 2LM1A 4KITB 2WF6A 4DL6A 1ZQFA 1XU4A 4J9MA 3ONNA 4ECWA 4C4RA 2NO5A 4DL3A 8ICAA 4RZRA 3HW8A 2W9CB 1KFDA 3HKZC 3KHHA 1NK6A 3C5GA 3N97B 5L9XA 4UQGA 2ESEA 3K1ZA 4DQIA 1F0MA 4OJ6A 1DGSA 4PHPA 2I6XA 2J6UA 3E2EA 9ICMA 3AUOA 2C22A 4DQQA 2D6FC 2EH9A 3IG5A 2YY6A 2BCQA 3EW9A 3AM9A 3Q8QB 4QZEA 3H8SA 1NK8A 2ZJ8A 4RUAA 4DSEA 2C2DA 3ISCA 4RQ4A 3H4DA 2JV3A 4FBUA 4QZHA 4QZ8A 2JGAA 3T5HA 3TADC 2K4IA 1WCNA 3THVA 4ED3A 3GIKA 3LVVA 4IR1A 4MF8A 1NK5A 1ZQLA 2IBKA 5BOLA 3SAFA 3BQ2A 2EQYA 5EWEA 1FO4A 1A6SA 1S9FA 2BPGA 3RTVA 1Q3UA 1IG6A 5KG6A 5ALPA 5KG1A 1RYUA 3SI8A 3M6ZA 4EEYA 3PW2A 2BQUA 5L1LA 2ZUDA 5KT4A 4NLCA 4NL9A 3V7LA 5EE3A 4P0PA 3ORYA 2XY6A 2HCFA 3Q8MA 4YMOA 2Z7JA 4U7CA 5DGAA 3L3FX 2LMRA 3F2CA 3C2KA 3LWMA 2EANA 1NZBA 3ISBA 2ZIUB 2CPRA 2LYHA 9ICEA 9ICJA 2KSOA 2FPLA 3PNCA 3HKZF 2A1JB 1RQLA 3WK6A 2KNJA 4ACOA 4DO9A 4PZOA 3C1ZA 3RH5A 4O3QA 2UVRA 3AU2A 3KHGA 4RQ1A 4DL7A 3Q8KA 1L7PA 2HHQA 2FPKA 3IV6A 4PZNA 5DBCA 2K89A 4O3PA 2AGPA 2BZFA 2G07A 3NGDA 4B9UA 1T3NA 5KFVA 3RH4A 2H3VA 1F44A 2H5XA 2HMXA 3FAHA 4GIBA 5KAFU 2EAOA 4OJOA 4UATA 5ALSA 3OHBA 5IIIA 3SAGA 2R8GA 1PK1B 4RQ7A 3ETLA 5G5HA 9ICTA 2PMZF 3PSIA 5J0QA 3C28A 4ECZA 4M0AA 1D8LA 3M7DA 3V72A 2K4EA 8ICGA 4B9NA 3QX7A 4XUSA 2RRDA 4IRCA 1IXRA 4RPZA 4M04A 2KFZA 3KBBA 2IOHA 8ICYA 3EUB2 2KG5A 8ICHA 5CJ7A 1KRPA 8ICPA 1VDVA 1JN3A 2FI1A 1CUKA 1YZ6A 4JB3A 2N1RA 1D9FA 3RF9A 3LYSA 1XS9D 4TUSA 3OGUA 4JV2A 4DOAA 4UARA 4QZAA 2PFQA 2HHXA 4C8OA 2JEJA 1JX4A 2G0AA 4C8MA 1SZHA 2H3QA 1Q3VA 1YT3A 4M9HA 7ICOA 3RB6A 3SZ2A 1IM4A 4UB8U 5DLGA 2HHTA 3NRWA 5J8YC 4JWNA 1X6JA 3RBDA 2KZZA 3PY8A 2JZBB 4MF2A 4RU9A 4QZCA 3KKAA 3Q8RB 1L7MA 7ICKA 1GO3F 4J9KA 1ZRNA 5ALEA 2KVSA 3CW2C 5L1JA 7ICUA 1RM6C 4IQVA 4DF4A 2DF4B 2Q0ZX 5J2EA 5KFJA 3DDHA 5JRTA 4YQWA 2PFOA 3ZDAA 3TFRA 5J2FA 3BS5A 5AK5A 4Q43A 3ICXA 4UB1A 2MAXA 2W03A 2FDRA 3DV9A 3M9MB 2AU0A 1MQ2A 2M0NA 4KMUA 1H38A 1PK1A 2NYVA 5HR6A 5EWGA 5J0YA 5J2BA 5DB8A 1KFTA 7ICTA 1Z1VA 4M6WB 5IILA 4BWJA 4X5VA 4BX9C 3AL0B 1N63A 4Y2SA 2KIVA 4BDPA 5DQIA 1BPDA 4KLLA 9ICCA 4GFJA 5L1KA 4DLEA 3I28A 3C21A 4RQ2A 4TUQA 3G6XA 4KLHA 5J2CA 2G08A 8ICFA 3BQTA 2HBLA 1RXVA 4DF8A 1LVHA 2BQRA 4Y2RA 2QKQA 3H40A 2OHFA 3BZCA 5KFEA 5J0OA 8ICKA 1ED1A 4PJ0U 5ALGA 1Z1BA 3WK5A 4QJFB 3KHRA 3WKAA 3EZ5A 2I9GA 1QQ5A 2LM4A 4B9VA 2CRXA 2VA2A 2DL0A 1BPXA 3IN5A 4F8RA 5KFGA 1SB3C 4I2FA 4ZH4A 4I2EA 4C8LA 4CGZA 3LVWA 1SL0A 3RB4A 4B9MA 4NLKA 3TQ1A 5KFKA 3H8JA 3A0BU 3GIJA 7ICRA 1B22A 2QLTA 2M9NA 4R63A 1B0XA 3QZ7A 5D46A 3GFKB 5KL8B 5TZVA 3C1YA 3NVVA 1X6IA 2HHSA 4NY8A 4I2HA 2ZJAA 3PX4A 4Q8EA 4EEKA 4F2SA 5J0WA 4C4SA 1TVAA 3BQ1A 5ALXA 1ZQUA 1U49A 1K1QA 4I28A 1SV0C 4NLZA 5DKWA 3G6YA 5KT7A 4DQSA 1MA7A 1HIWA 4ECXA 5DB9A 3PMLA 5IIMA 1PK3A 3IHQB 3NASA 2RHFA 2E8OA 4DQPA 3G6VA 1J2NA 2WTFA 1NJZA 2DBYA 3TKAA 1JMSA 1NK0A 2HHWA 5L1MA 4JV1A 5KFAA 1X66A 1RYRA 1ZQCA 1V97A 3C29A 4FE3A 4KLOA 4RNOA 2R18A 4HYKA 1TKDA 5KG3A 3KZIU 2ISOA 2BDUA 2W9BA 4C7YA 3V6JA 4DFJA 4I2GA 3SQIA 2WB1F 2W8KA 2ASJA 5IIKA 2V4RA 4Y2QA 2XGQA 5AM1A 4E0DA 4QZBA 3CP8A 2ASLA 3D2QA 1UA0A 1WWVA 5CA7A 4K4GA 2JMGA 2JXJA 3NVZA 4KLFA 1Z4OA 1SXDA 4NV0A 2OM6A 5J2GA 3T5JA 2ZTCA 2KKVA 2A19A 3UM9A 4QWDA 4EZ6A 4KLSA 4M2YA 2HOIA 3HX0A 4UB6U 3F2DA 3MR5A 3M9OB 1Z00B 4M9LA 2F1HA 3GV8B 4YD2A 4O3NA 1ZQOA 2NRVA 2BPCA 1BNPA 1UQVA 4IQUA 4EBEA 3S6JA 1ZQVA 4RQ5A 2J6SA 5AI9A 3OHAA 3WK4A 3TAQA 1K1SA 3T5KA 3HP6A 2R8KA 3EWAA 3F5AA 4QZDA 2W9CA 4DS5A 4B9LA 3ZI4A 3ZDDA 1TK0A 1NJWA 1RYSA 3SD7A 3H7IA 5J2HA 4IQWA 2K4HA 5A0LA 2JEFA 3V7JA 1SKSA 4R8UB 4TURA 4XQ8A 3C2LA 4QW9A 3M9NB 2HBMA 4J9RA 1UT5A 4MEXA 4O5CA 2JHDA 2KV2A 1URJA 3JPOA 9ICGA 3RH6A 5AIAA 3EYZA 4FFDA 2Q4TA 5KG4A 4ED2A 1T8EA 1BPEA 3BS7A 4JK1A 5CHGA 4USAA 4CF4A 2ZIVB 2MSNA 5L1IA 4PL1A 4UAWA 9ICQA 5HP4A 2FMPA 2WB1C 5ALDA 1ZQKA 5CR0A 3C5FA 5DDMA 1QTMA 4R66A 2F1JA 2F8LA 4UB3A 2HSZA 3NTUA 4GC7A 5F9LA 2G09A 4YMNA 5ALQA 3QE9Y 4OJ5A 2MU2A 3PO4A 2PI4A 8ICTA 2NRTA 2P35A 5GTIU 2F3NA 4RQ3A 4QWAA 3QEBZ 3NVYA 3SV3A 4KLTA 3HILA 2K8AA 3K1RB 4CF5A 4P2HA 1S97A 2KSOB 1O03A 3Q8LA 4UAVA 2IOFA 2LPEA 2MA1A 3ISDA 4I29A 4Y2JA 4FZNA 4FO6A 4J9LA 4OJPA 1NKCA 4LJXA 1LKYA 2WAQC 3RB3A 4G3IA 3N28A 1WCLA 2OH2A 2ZIWB 2OXOA 1RPLA 2F76X 2J6TA 4I2DA 2QB0B 1BGXT 2P6UA 2R8JA 2DGZA 1XO0A 4OCZA 3MABA 2KZMA 2BDPA 5ALJA 2ZIWA 1S0MA 3BS5B 4UBBA 1RQNA 1QSSA 1JXLA 7ICMA 4M47A 2ZXHA 1KW4A 3TARA 2ZJ5A 1KSPA 1ZQRA 3J81j 2H3ZA 2XICA 4ED0A 3ZDCA 1TK5A 5C0YA 3WKCA 1J2MA 2KHQA 1L8OA 5DQGA 4F4YA 3QUBA 2YX8A 3H0RB 1ZOLA 1XNSA 2OCEA 3BQ0A 5DQHA 1U4BA 1C7YA 3AQEA 4BXOB 4J9SA 1COOA 5KFYA 3JPSA 2BQ3A 1DGJA 3AMZA 5KFOA 1QSLA 3RJFA 2XCAA 1COKA 2KJ9A 2PMZC 4NL9C 2AGOA 2GOLA 4M9JA 2OEHA 1L3TA 3I1YA 4EZ9A 5IIOA 4G9BA 5KFNA 3TI0A 9ICRA 5JTIA 2F44A 3SYZA 1D8YA 3SENA 5KFUA 2WF8A 2V4QA 4CF3A 1Z3EB 2AHOB 5J0SA 5KFPA 3C2MA 2DFLA 4ECSA 4MFAA 4KLIA 5KFWA 3TANA 1TAMA 4J9PA 2JR5A 4Q44A 3ALRA 1JXEA 1JIHA 1TK8A 4RUCA 4US8A 4ECQA 4PL2A 5J2IA 3JPRA 5CP2A 4F3OA 3AEVA 2ZUBA 3M8SA 5DG9A 1HEKA 2PXIA 2BHNA 4QZGA 3GV7B 4O0IA 3B0XA 5AM2A 4I2AA 1SV4A 2FLLA 4IRKA 4CCHA 2WAQF 5BPCA 8ICMA 4QZ9A 1QH9A 4RQ0A 2KTQA 2DQNB 1T3QA 3RAQA 4DL4A 3RJIA 4O3OA 2DPIA 4J9NA 4J9QA 2W9MA 3WKEA 5DB7A 2KHVA 5DBBA 1AROP 1ECWA 2AXTU 2QB0A 4QWEA 3HWTA 3UMCA 3GIIA 2LYAA 1MC8A 5ALLA 5FP0A 1HJPA 4EYIB 5JUMA 3IP4B 1XWLA 4YCXA 2E3TA 2KP7A 3F2BA 9ICIA 3IDWA 2XY5A 4IR9A 4Q45A 1ZQNA 2G06A 4Y2TA 1ZQXA 4QZFA 4RT3A 5CB1A 4O3SA 1NNLA 4BXOA 5AKGA 4YXMA 3MGVA 1KLNA 1KTQA 5ALZA 5KFMA 2LYBA 4FZLA 5F9NA 4DQRA 4RQNA 2VKQA 2W11A 1NK7A 1PVQA 1U9LA 1J97A 5AKKA 3PMNA 5ALTA 4F4KA 2PFNA 1KEJA 2BR0A 4DFMA 3EPIA 3VC8A 2XGPA 1N60A 3D2NA 2K8CB 1U45A 1U47A 4F5QA 2BKEA 5E79U 4QWBA 8ICSA 5KT5A 2YN4A 3RAXA 4DWIA 4YG2A 1UA1A 1XO1A 8ICOA 2LKYA 8ICLA 2B0CA 2NV3A 5AI0A 4ED7A 5J0PA 4RQ6A 4MEYA 5D49A 2KKPA 9ICKA 2VJ5A 4GLXA 1VLBA 2FPMA 4DSIA 1ZJMA 2H3IA 2E1FA 3JPPA 1A76A 3AQFA 1JALA 3RJKA 4F4ZA 3E58A 2WF5A 4DSFA 4KX3A 9ICWA 2NRZA 2IOFK 2RDJA 5J0UA 3H8MA 3IRUA 9ICPA 1ZXIA 3RRGA 4Q8FA 1D9DA 4IC9A 3QNMA 2GH1A 5B66U 1VJ5A 3PSTA 5J0TA 2Y1IA 1BNOA 3SEIA 5T14A 1CI4A 2A1JA 4I2JA 3QU2A 2NO4A 5AIBA 3MDCA 4CRXA 1SWWA 1N5XA 4FZMA 4F4XA 4RQ8A 1N48A 4KLJA 1ZQEA 4PH5A 4GXKA 4PPXA 3T3FA 2Y1JA 7ICHA 1A77A 3HT3A 5HMLA 4UB2A 3NS1A 1Z00A 4QIWC 4NM1A 1SL1A 3N7SC 3N7PD 1O08A 4B9SA 2RDIA 2NRWA 2UVUA 4R8UA 2ALZA 4QIWF 4KX5A 1UCVA 3K4GA 4PHDA 3TFSA 2KJ8A 1Z4NA 1FFVA 2AQ0A 8ICBA 2IMWP 4KLGA 1T4GA 2ZUCA 5EE1A 4P0QB 4YN4A 5ALVA 7ICSA 3OPXA 2XIDA 2YTUA 1X9SA 4F2RA 3QUTA 3MGIA 1K5OA 2GLEA 3GILA 5KT6A 5DG7A 2XCPA 4EBDA 4MFFA 4UASA 1N2XA 4DFKA 5K4LA 1JRPA 2W04A 5J0XA 5AKYA 3FM9A 4EX6A 3CYMA 4P0PB 7ICIA 4NLBA 2RP5A 2ZIVA 2KICA 4LVSA 4EELA 2DKXA 2KEYA 5CEHA 5H2FU 5C5JA 5ALUA 5AKJA 4PGQA 4IRDA 4F50A 3QU7A 3M1YA 1DRGA 1B43A 1L3VA 1ZQJA 2QARA 3QUQA 5HNKA 2ZTDA 4ZOHC 4P4PA 3DEEA 4YP3A 4I27A 3L5KA 3SAHA 1S10A 3PV8A 3B0YA 4NXZA 4DOBA 5KAIU 1V38A 3F5EA 3MC1A 3L4PA 2VIXA 2C2RA 2BCSA 3SMVA 3MR6A 4BWMA 4ECYA 4M9GA 1MN8A 9ICOA 4DEZA 1QQ7A 2PI5A 1ZQDA 4DSJA 4ED8A 5ALRA 1ZQIA 2VA8A 1PUZA 3AN1A 2IHMA 2KOBA 1X9MA 1ZQTA 3N4MB 1S0NA 3PW4A 3JPQA 3V7KA 4MHVA 4I2IA 3UQ0A 2UVWA 9ICNA 4DSKA 3UXPA 1ZJNA 1ZQGA 5KFHA 3ZDEA 5AK4A 4YXJA 3JPTA 8ICNA 3QEAZ 4KN7A 4NJ8A 3KZXA 1BPBA 4KLEA 2WFAA 4GXJA 1L3UA 4ELVA 3BZKA 5KFTA 4RNMA 2BCUA 4JMUA 2VA3A 5KFIA 1ZD2P 4JWMA 1N56A 1NKEA 3KOOA 4IQTA 5KG0A 4TQSA 8ICUA 1X40A 3WKBA 4KN4A 2QB1A 5G5GA 5AI4A 2WF7A 4TQRA 2W3SA 4ED1A 2W55A 1YZ7A 5KFLA 4PGYA 3KD3A 4NWIA 3RFAA 5GTHU 4O9MA 9ICUA 3ZDBA 1V9PA 5J2KA 4B6JA 4FS2A 2W7PA 2HHUA 2ZIXA 2QARB 4J9OA 5KG2A 5AICA 9ICHA 4XRHA 5KG5A 2ODGA 1X42A 2EZZA 5ALKA 4JV0A 2EDUA 2NRXA 2HVHA 1JI7A 5HHHA 2HW3A 5EE0A 4Z6DA 3LK9A 3BJYA 5KFDA 2W54A 4F5PA 5AKEA 5CRXA 2WHEA 2YMLA 4EENA 3ZD9A 3QU5A 8ICVA 4WJ3B 4A8EA 1ZD5A 3NUQA 4HAIA 5AM5A 2E1EA 2BGWA 1ZD3A 8ICEA 3PO5A 4QZIA 1TAUA 3WK9A 4DS4A 1KKXA 3M6KA 3A0HU 2KMDA 1UPHA 1NOMA 4Z6CA 5AKLA 4CDGA 4C7ZA 2JEGA 1OXJA 1JROA 3GZFA 1L8LA 1AQ6A 4EX7A 3U26A 3GIMA 2B6GA 1Q8KA 1X2IA 4F4WA 1TV9A 4RT2A 8ICWA 2O6KA 5KFSA 2F1IA 4P4MA 2A1AA 2W3RA 4RQMA 2UVVA 5KFBA 2GO7A 2HVIA 1RXWA 5HR7A 8ICIA 2ES6A 3MFHA 5AI8A 4KTQA 3PZPA 4O5KA 1ZRMA 3MDAA 1ZD4A 1A0PA 1TE2A 4NLNA 2I5HA 9ICFA 5AKIA 9ICBA 7ICVA 5AM4A 5J0RA 1XSNA 4AYBF 1ZQBA 2E8MA 4IS7A 3ETRA 3CRXA 4KLMA 1NK9A 2AGQA 1XC9A 2XI9A 1U48A 3N7RC 3RJGA 4UAUA 3WKDA 5J2DA 2FMSA 1L7OA 3OJUA 7ICJA 7ICFA 2H3FA 5ALFA 2D3DA 5EOZA 4CNQA 2LHTA 8ICQA 5AKXA 5AK3A 3TAPA 1NZPA 2JH1A 2IA6A 2EAPA 4QNLA 5JU5A 1SWVA 4DFDA 2R8HA 4QW8A 2G5IB 1WUDA 1SKWA 1SV0A 5EE9A 5DDYA 1UHUA 1T94A 3HRDD 4C0ZA 3WK7A 2D8CA 3UPQA 2GWSA 7ICGA 1CRXA 1F5SA 1FEZA 4NLGA 2P66A 1ZQZA 3B9JA 1S76D 3TADA 3GDXA 3I76A 3UMBA 5DG8A 4YR2A 2IHNA 1PVPA 3JPNA 4C4TA 3V6HA 1Q46A 3T79A 3HJEA 3T5LA 2KVCA 7ICPA 2YMMA 5AM3A 4DFPA 4KLDA 2B21A 2YQEA 1NJYA 5B5EU 4DSLA 3BQ7A 4YR0A 7ICQA 3H0MB 8ICXA 2E8NA 4ECTA 3Q8SB 3E0FA 4ICAA 4CE6A 1ZQMA 4O3RA 1FFUA 4LZGA 2W9AA 3C23A 3V6KA 4F71A 1CEZA 1ZYQA 2ISPA 9ICAA 4P0QA 2PKEA 5KFFA 2P6RA 4ELTA 4YMMA 1SKRA 2XC9A 3LDAA 5ALWA 4FBTA 1S0VA 2PFPA 2ZG6A 3QXGA 4DL5A 2ASDA 5EWFA 8ICCA 5D4BA 3RJJA 3K75D 9ICVA 2ZTEA 2CXYA 2V9WA 1KDHA 1D8BA 2DPJA 1M6YA 5KFZA 4OJLA 1SXEA 3PR4A 3QUCA 2BPFA 3RR7A 2RQ5A 1QLNA 2K60A 1SIJA 2FE9A 2BCRA 1L5UA 2FLPA 5ALNA 2Y0SF 4GXIA 4O3MA 1XSPA 4UBCA 3BDPA 2FMQA 1Z19A 4KLQA 4C80A 3SR6A 1L6NA 2I1QA 1S5LU 2Y0SC 3RJEA 5J29A 3QYPA 1DXSA 3RRHA 3QU9A 2HHVA 7ICNA 3OTQA 3Q8PB 4FS1A 4BJQA 4I2BA 5AKHA 3PSFA 2KK0A 1KFSA 2C2EA 5IIJA 1WYGA 1BPZA 1JUDA 2W8LA 2Y9TA 2K4PA 2YB1A 4R64A 5AI6A 3MGHA 3TACB 2JEIA 2XVTA 3HPOA 4GC6A 4DOCA 1X9XA 4IL6U 5J2JA 4Y2UA 4KMOB 4AP9A 4ED6A 4YVZA 3PVXA 1KQQA 5AK6A 1DOQA 1UT8A 4F72A 2VANA 3PX6A 4UB5A 8ICRA 2DKZA 1ZETA 3UXNA 5CWRA 2RLTA 3R9KA 4ECVA 3VCBA 2DWQA 4PGXA 3ED5A 3GV5B 1QQ6A 3M8RA 4RPYA 4Z6FA 4EBCA 4O5EA 2ZXIA 1HUZA 5ALIA 1L3SA 4DL2A 4C8KA 5KFRA 1OUQA 2HOFA 2K8BB 3GU3A 1V85A 3UMGA 4F93B 3KTQA 1P7DA 2ZIXB 3H0LB 5AKZA 3RB0A 2ZIUA 5KL1B 2CN1A 1FIQA 3FC4A 4F91B 3OSPA 4K4HA 4U6PA 3EPGA 2R8IA 4OD0A 4YFKA 4K4IA 1B4FA 3WU2U 1LKYB 2HOQA 1QCKA 4JUZA 3LWLA 3PW0A 4Z6EA 4B9TA 2WF9A 3QZ8A 5HMMA 5DLFA 2YMQA 1SGGA 2YB4A 4YD1A 4M9NA 4UB4A 1ZQSA 1PVRA 4M6WA 4US9A 5ALYA 3RBEA 1S77D 5ALHA 3QU4A 1NI3A 2G5HB 3PR5B 2XY7A 5ALOA 3NRZA 1ZQYA 4ECRA 5TISU 3OSNA 1X9WA 1TAQA 1NK4A 1TFRA 1ZQHA 2AQ4A 2OYYA 1MSWD 5F3XB 3IG8A 5KTQA 3ZD8A 5J8YA 2VJ4A 2LI6A 1NKBA 4R65A 3MBYA 1KBUA 4Y2PA 1L7NA 2FJ6A 5KFXA 3PW5A 3UXOA 4TUPA 4XA5A 5KT2A 4UW9A 3NVWA 5DB6A 2KD1A 1LB2B 4P4OA 2L5YA 4I2CA 1KN5A 1ZQQA 5DBAA 3AU6A 2F2AB 2KJ5A 3RJHA 4DLGA 1S8OA 4UAYA 2MRLA 3D6JA 4C8NA 4ECUA 4RPXA 7ICLA 5ALMA 8ICZA 1N62A 4F92B 2KFNA 4PHEA 3PX0A 5J2AA 1Y88A 2MUTA 2XO7A 2EZXA 1DK2A 5BOMA 8ICJA 2LBOA 1BVSA 5KNIA 4F5NA 4MFCA 1N61A 4YR3A 2F8KA 3KFUF 2HBJA 2DUYA 3IM1A 3H8WA 4OO1J 4NM2A 2JZBA 5AI5A 1N5WA 1XSLA 5AHXA 2KE7A 4BUGA 4EYHB 4KLUA 4RNNA 4UAZA 3KHLA 3FYHA 5IINA 3MR2A 2EAMA 2YMPA 4PHAA 2C28A 1KL9A 2E8PA 5KFCA 1DK3A 1QSYA 9ICSA 3O0FA 2OWOA 3SV4A 3OJSA 4F5RA 3H4BA 1ZQ1C 4BGDA 2W7OA 4QWCA 3PSPA 3MFIA 4F5OA 1BPYA 1RZTA 2JH7A 1IIPA 4LZDA 1MQ3A 2KZ3A 4DCCA 1EXNA 2KN7A 5DGBA 2BCVA 4Y2YA 3KKAC 4Y2XA 3RR8A 2Y9UA 2ATLA 2FLNA 1ZQAA 3UQ2A 4AYBC 4Y2VA 3FDSA 1T7PA 1IV8A 1RDFA 2JRZA 1LV5A 1PZNA 2A3VA 1OW5A 3GQCA 3D2SA 2HDOA 2HI0A 7ICEA 2W9BB 4ELUA 2AJQA 3F53A 1RG6A 1WG8A 3PW7A 2HBKA 1S0OA 5HHIA 5AM0A 9ICLA 2EZYA 3MR3A 1SL2A 1C20A 5KFQA 9ICXA 2KIWA 5KG7A 3WK8A 2W43A 1ZQWA 1ZQPA 5KT3A
chains in the Genus database with same CATH topology
3RF9A 3LYSA 3SAHA 2F77X 2XVTA 2YB4A 2H3ZA 2E5SA 2XICA 2HBLA 3L3FX 4AYBF 5T14A 3F2CA 2HBJA 3KFUF 2K4HA 5A0LA 5C0YA 2W7PA 1PVRA 2KHQA 2ZIXA 1NZBA 3IP4B 4KMOB 2ZIUB 3CRXA 2YX8A 2CPRA 3F5EA 4CRXA 3H0RB 4OO1J 3C29A 1XNSA 4FE3A 2XI9A 2VIXA 3N7RC 4FZMA 2R18A 2G0AA 3HKZF 3AQEA 3SMVA 2HBMA 2ZG6A 3F2BA 1ED1A 1SZHA 2H3QA 1Q3VA 2KNJA 2JHDA 4ACOA 1YT3A 2H3FA 2KV2A 1URJA 4BUGA 3ONNA 1Z1BA 2BDUA 2G06A 4QJFB 2LHTA 2G5HB 2KJ9A 2Q4TA 2PMZC 3HKZC 2GOLA 4QIWC 3VCBA 5CRXA 2KOBA 2JH1A 2WB1F 3SQIA 3MGVA 2CRXA 3N7SC 3N7PD 4QNLA 3NRWA 2ZIVB 2G5IB 1D8BA 4PL1A 4WJ3B 3IN5A 2K89A 3K1ZA 4A8EA 2LYBA 2WB1C 3NUQA 3O0FA 4FZLA 4OJ6A 1WUDA 2E1EA 4OJLA 4CGZA 2G07A 4QIWF 1ZQ1C 3LVWA 2W7OA 4KX5A 3PSPA 2VKQA 3CP8A 2F8LA 2ZXIA 2OYYA 1PVQA 1T94A 2KJ8A 2D6FC 3D2QA 3M6KA 1GO3F 2G09A 2H3VA 1IIPA 2JH7A 4C0ZA 3IG8A 3IG5A 4OJ5A 1F44A 2HMXA 1UPHA 4OJOA 2VJ4A 2Y0SF 4P0QB 1CRXA 1KBUA 4O3MA 1OUQA 2JMGA 4CDGA 3OPXA 2K8BB 2HOFA 2XIDA 3VC8A 2DF4B 1TAMA 3D2NA 2K8CB 3GZFA 3GU3A 3KZXA 3SAGA 4NV0A 1Z19A 1P7DA 3ALRA 2OM6A 2ZIXB 3H0LB 2JGAA 2ZIUA 5KL1B 2CN1A 1L6NA 4AYBC 2K8AA 2K4IA 2Y0SC 5KL8B 4PL2A 2KD1A 2PMZF 2MA1A 3ICXA 1PVPA 3PSIA 2KKVA 2W03A 4FZNA 3C28A 2A3VA 1HEKA 2LKYA 2F2AB 2KJ5A 2M0NA 3LVVA 2NV3A 3D2SA 4OJPA 4BJQA 3M7DA 3T79A 2WAQC 4JMUA 2KVCA 2HOIA 3F2DA 2K4EA 2MRLA 2W04A 5HR7A 5HR6A 3SAFA 2KKPA 2OH2A 2ZIWB 3F53A 3PSFA 4U6PA 2VJ5A 2OXOA 2WAQF 2F76X 2RRDA 3PZPA 3CYMA 1A6SA 2H3IA 2HBKA 2E1FA 4P0PB 3H0MB 4NLBA 2RP5A 2DQNB 2ZIVA 2KICA 3AQFA 2HOQA 2KEYA 1Q3UA 2DGZA 4P0QA 1XO0A 4BX9C 3E0FA 1A0PA 4ICAA 2ZIWA 3AL0B 1MA7A 1HIWA 3M6ZA 2KHVA 4KX3A 4NLCA 1ECWA 1DRGA 3RFAA 2RHFA 4NWIA 4P0PA 2KIWA 2ZXHA 2YB1A 4GFJA 2LYAA 4IC9A 3F5AA 2LBOA 2GH1A 2Z7JA 3PSTA 4U7CA 2N1RA 3DEEA 2G08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LYS A;  1OUQ A;  5CRX A;  2HOF A;  2OXO A;  2KOB A;  3MGV A;  2CRX A;  3NRW A;  1PVR A;  2KHQ A;  1Z19 A;  1P7D A;  1NZB A;  2KEY A;  1Q3U A;  3CRX A;  4CRX A;  4A8E A;  1XO0 A;  3C29 A;  1XNS A;  1A0P A;  2KD1 A;  1MA7 A;  2KHV A;  1PVP A;  2KKV A;  1PVQ A;  2A3V A;  1DRG A;  3C28 A;  2KJ8 A;  1Q3V A;  4ACO A;  2KJ5 A;  2KIW A;  1KBU A;  1Z1B A;  2HOI A;  1F44 A;  2KJ9 A;  1CRX A;  2KKP A; 
#chains in the Genus database with same CATH topology
 3CNH A;  2MUT B;  1HUO A;  2AH5 A;  2F77 X;  1WWU A;  2E5S A;  1SZP A;  4J03 A;  1NJX A;  2LM1 A;  4KIT B;  2WF6 A;  4DL6 A;  1ZQF A;  1XU4 A;  4J9M A;  3ONN A;  4ECW A;  4C4R A;  2NO5 A;  4DL3 A;  8ICA A;  4RZR A;  3HW8 A;  2W9C B;  1KFD A;  3HKZ C;  3KHH A;  1NK6 A;  3C5G A;  3N97 B;  5L9X A;  4UQG A;  2ESE A;  3K1Z A;  4DQI A;  1F0M A;  4OJ6 A;  1DGS A;  4PHP A;  2I6X A;  2J6U A;  3E2E A;  9ICM A;  3AUO A;  2C22 A;  4DQQ A;  2D6F C;  2EH9 A;  3IG5 A;  2YY6 A;  2BCQ A;  3EW9 A;  3AM9 A;  3Q8Q B;  4QZE A;  3H8S A;  1NK8 A;  2ZJ8 A;  4RUA A;  4DSE A;  2C2D A;  3ISC A;  4RQ4 A;  3H4D A;  2JV3 A;  4FBU A;  4QZH A;  4QZ8 A;  2JGA A;  3T5H A;  3TAD C;  2K4I A;  1WCN A;  3THV A;  4ED3 A;  3GIK A;  3LVV A;  4IR1 A;  4MF8 A;  1NK5 A;  1ZQL A;  2IBK A;  5BOL A;  3SAF A;  3BQ2 A;  2EQY A;  5EWE A;  1FO4 A;  1A6S A;  1S9F A;  2BPG A;  3RTV A;  1Q3U A;  1IG6 A;  5KG6 A;  5ALP A;  5KG1 A;  1RYU A;  3SI8 A;  3M6Z A;  4EEY A;  3PW2 A;  2BQU A;  5L1L A;  2ZUD A;  5KT4 A;  4NLC A;  4NL9 A;  3V7L A;  5EE3 A;  4P0P A;  3ORY A;  2XY6 A;  2HCF A;  3Q8M A;  4YMO A;  2Z7J A;  4U7C A;  5DGA A;  3L3F X;  2LMR A;  3F2C A;  3C2K A;  3LWM A;  2EAN A;  1NZB A;  3ISB A;  2ZIU B;  2CPR A;  2LYH A;  9ICE A;  9ICJ A;  2KSO A;  2FPL A;  3PNC A;  3HKZ F;  2A1J B;  1RQL A;  3WK6 A;  2KNJ A;  4ACO A;  4DO9 A;  4PZO A;  3C1Z A;  3RH5 A;  4O3Q A;  2UVR A;  3AU2 A;  3KHG A;  4RQ1 A;  4DL7 A;  3Q8K A;  1L7P A;  2HHQ A;  2FPK A;  3IV6 A;  4PZN A;  5DBC A;  2K89 A;  4O3P A;  2AGP A;  2BZF A;  2G07 A;  3NGD A;  4B9U A;  1T3N A;  5KFV A;  3RH4 A;  2H3V A;  1F44 A;  2H5X A;  2HMX A;  3FAH A;  4GIB A;  5KAF U;  2EAO A;  4OJO A;  4UAT A;  5ALS A;  3OHB A;  5III A;  3SAG A;  2R8G A;  1PK1 B;  4RQ7 A;  3ETL A;  5G5H A;  9ICT A;  2PMZ F;  3PSI A;  5J0Q A;  3C28 A;  4ECZ A;  4M0A A;  1D8L A;  3M7D A;  3V72 A;  2K4E A;  8ICG A;  4B9N A;  3QX7 A;  4XUS A;  2RRD A;  4IRC A;  1IXR A;  4RPZ A;  4M04 A;  2KFZ A;  3KBB A;  2IOH A;  8ICY A;  3EUB 2;  2KG5 A;  8ICH A;  5CJ7 A;  1KRP A;  8ICP A;  1VDV A;  1JN3 A;  2FI1 A;  1CUK A;  1YZ6 A;  4JB3 A;  2N1R A;  1D9F A;  3RF9 A;  3LYS A;  1XS9 D;  4TUS A;  3OGU A;  4JV2 A;  4DOA A;  4UAR A;  4QZA A;  2PFQ A;  2HHX A;  4C8O A;  2JEJ A;  1JX4 A;  2G0A A;  4C8M A;  1SZH A;  2H3Q A;  1Q3V A;  1YT3 A;  4M9H A;  7ICO A;  3RB6 A;  3SZ2 A;  1IM4 A;  4UB8 U;  5DLG A;  2HHT A;  3NRW A;  5J8Y C;  4JWN A;  1X6J A;  3RBD A;  2KZZ A;  3PY8 A;  2JZB B;  4MF2 A;  4RU9 A;  4QZC A;  3KKA A;  3Q8R B;  1L7M A;  7ICK A;  1GO3 F;  4J9K A;  1ZRN A;  5ALE A;  2KVS A;  3CW2 C;  5L1J A;  7ICU A;  1RM6 C;  4IQV A;  4DF4 A;  2DF4 B;  2Q0Z X;  5J2E A;  5KFJ A;  3DDH A;  5JRT A;  4YQW A;  2PFO A;  3ZDA A;  3TFR A;  5J2F A;  3BS5 A;  5AK5 A;  4Q43 A;  3ICX A;  4UB1 A;  2MAX A;  2W03 A;  2FDR A;  3DV9 A;  3M9M B;  2AU0 A;  1MQ2 A;  2M0N A;  4KMU A;  1H38 A;  1PK1 A;  2NYV A;  5HR6 A;  5EWG A;  5J0Y A;  5J2B A;  5DB8 A;  1KFT A;  7ICT A;  1Z1V A;  4M6W B;  5IIL A;  4BWJ A;  4X5V A;  4BX9 C;  3AL0 B;  1N63 A;  4Y2S A;  2KIV A;  4BDP A;  5DQI A;  1BPD A;  4KLL A;  9ICC A;  4GFJ A;  5L1K A;  4DLE A;  3I28 A;  3C21 A;  4RQ2 A;  4TUQ A;  3G6X A;  4KLH A;  5J2C A;  2G08 A;  8ICF A;  3BQT A;  2HBL A;  1RXV A;  4DF8 A;  1LVH A;  2BQR A;  4Y2R A;  2QKQ A;  3H40 A;  2OHF A;  3BZC A;  5KFE A;  5J0O A;  8ICK A;  1ED1 A;  4PJ0 U;  5ALG A;  1Z1B A;  3WK5 A;  4QJF B;  3KHR A;  3WKA A;  3EZ5 A;  2I9G A;  1QQ5 A;  2LM4 A;  4B9V A;  2CRX A;  2VA2 A;  2DL0 A;  1BPX A;  3IN5 A;  4F8R A;  5KFG A;  1SB3 C;  4I2F A;  4ZH4 A;  4I2E A;  4C8L A;  4CGZ A;  3LVW A;  1SL0 A;  3RB4 A;  4B9M A;  4NLK A;  3TQ1 A;  5KFK A;  3H8J A;  3A0B U;  3GIJ A;  7ICR A;  1B22 A;  2QLT A;  2M9N A;  4R63 A;  1B0X A;  3QZ7 A;  5D46 A;  3GFK B;  5KL8 B;  5TZV A;  3C1Y A;  3NVV A;  1X6I A;  2HHS A;  4NY8 A;  4I2H A;  2ZJA A;  3PX4 A;  4Q8E A;  4EEK A;  4F2S A;  5J0W A;  4C4S A;  1TVA A;  3BQ1 A;  5ALX A;  1ZQU A;  1U49 A;  1K1Q A;  4I28 A;  1SV0 C;  4NLZ A;  5DKW A;  3G6Y A;  5KT7 A;  4DQS A;  1MA7 A;  1HIW A;  4ECX A;  5DB9 A;  3PML A;  5IIM A;  1PK3 A;  3IHQ B;  3NAS A;  2RHF A;  2E8O A;  4DQP A;  3G6V A;  1J2N A;  2WTF A;  1NJZ A;  2DBY A;  3TKA A;  1JMS A;  1NK0 A;  2HHW A;  5L1M A;  4JV1 A;  5KFA A;  1X66 A;  1RYR A;  1ZQC A;  1V97 A;  3C29 A;  4FE3 A;  4KLO A;  4RNO A;  2R18 A;  4HYK A;  1TKD A;  5KG3 A;  3KZI U;  2ISO A;  2BDU A;  2W9B A;  4C7Y A;  3V6J A;  4DFJ A;  4I2G A;  3SQI A;  2WB1 F;  2W8K A;  2ASJ A;  5IIK A;  2V4R A;  4Y2Q A;  2XGQ A;  5AM1 A;  4E0D A;  4QZB A;  3CP8 A;  2ASL A;  3D2Q A;  1UA0 A;  1WWV A;  5CA7 A;  4K4G A;  2JMG A;  2JXJ A;  3NVZ A;  4KLF A;  1Z4O A;  1SXD A;  4NV0 A;  2OM6 A;  5J2G A;  3T5J A;  2ZTC A;  2KKV A;  2A19 A;  3UM9 A;  4QWD A;  4EZ6 A;  4KLS A;  4M2Y A;  2HOI A;  3HX0 A;  4UB6 U;  3F2D A;  3MR5 A;  3M9O B;  1Z00 B;  4M9L A;  2F1H A;  3GV8 B;  4YD2 A;  4O3N A;  1ZQO A;  2NRV A;  2BPC A;  1BNP A;  1UQV A;  4IQU A;  4EBE A;  3S6J A;  1ZQV A;  4RQ5 A;  2J6S A;  5AI9 A;  3OHA A;  3WK4 A;  3TAQ A;  1K1S A;  3T5K A;  3HP6 A;  2R8K A;  3EWA A;  3F5A A;  4QZD A;  2W9C A;  4DS5 A;  4B9L A;  3ZI4 A;  3ZDD A;  1TK0 A;  1NJW A;  1RYS A;  3SD7 A;  3H7I A;  5J2H A;  4IQW A;  2K4H A;  5A0L A;  2JEF A;  3V7J A;  1SKS A;  4R8U B;  4TUR A;  4XQ8 A;  3C2L A;  4QW9 A;  3M9N B;  2HBM A;  4J9R A;  1UT5 A;  4MEX A;  4O5C A;  2JHD A;  2KV2 A;  1URJ A;  3JPO A;  9ICG A;  3RH6 A;  5AIA A;  3EYZ A;  4FFD A;  2Q4T A;  5KG4 A;  4ED2 A;  1T8E A;  1BPE A;  3BS7 A;  4JK1 A;  5CHG A;  4USA A;  4CF4 A;  2ZIV B;  2MSN A;  5L1I A;  4PL1 A;  4UAW A;  9ICQ A;  5HP4 A;  2FMP A;  2WB1 C;  5ALD A;  1ZQK A;  5CR0 A;  3C5F A;  5DDM A;  1QTM A;  4R66 A;  2F1J A;  2F8L A;  4UB3 A;  2HSZ A;  3NTU A;  4GC7 A;  5F9L A;  2G09 A;  4YMN A;  5ALQ A;  3QE9 Y;  4OJ5 A;  2MU2 A;  3PO4 A;  2PI4 A;  8ICT A;  2NRT A;  2P35 A;  5GTI U;  2F3N A;  4RQ3 A;  4QWA A;  3QEB Z;  3NVY A;  3SV3 A;  4KLT A;  3HIL A;  2K8A A;  3K1R B;  4CF5 A;  4P2H A;  1S97 A;  2KSO B;  1O03 A;  3Q8L A;  4UAV A;  2IOF A;  2LPE A;  2MA1 A;  3ISD A;  4I29 A;  4Y2J A;  4FZN A;  4FO6 A;  4J9L A;  4OJP A;  1NKC A;  4LJX A;  1LKY A;  2WAQ C;  3RB3 A;  4G3I A;  3N28 A;  1WCL A;  2OH2 A;  2ZIW B;  2OXO A;  1RPL A;  2F76 X;  2J6T A;  4I2D A;  2QB0 B;  1BGX T;  2P6U A;  2R8J A;  2DGZ A;  1XO0 A;  4OCZ A;  3MAB A;  2KZM A;  2BDP A;  5ALJ A;  2ZIW A;  1S0M A;  3BS5 B;  4UBB A;  1RQN A;  1QSS A;  1JXL A;  7ICM A;  4M47 A;  2ZXH A;  1KW4 A;  3TAR A;  2ZJ5 A;  1KSP A;  1ZQR A;  3J81 j;  2H3Z A;  2XIC A;  4ED0 A;  3ZDC A;  1TK5 A;  5C0Y A;  3WKC A;  1J2M A;  2KHQ A;  1L8O A;  5DQG A;  4F4Y A;  3QUB A;  2YX8 A;  3H0R B;  1ZOL A;  1XNS A;  2OCE A;  3BQ0 A;  5DQH A;  1U4B A;  1C7Y A;  3AQE A;  4BXO B;  4J9S A;  1COO A;  5KFY A;  3JPS A;  2BQ3 A;  1DGJ A;  3AMZ A;  5KFO A;  1QSL A;  3RJF A;  2XCA A;  1COK A;  2KJ9 A;  2PMZ C;  4NL9 C;  2AGO A;  2GOL A;  4M9J A;  2OEH A;  1L3T A;  3I1Y A;  4EZ9 A;  5IIO A;  4G9B A;  5KFN A;  3TI0 A;  9ICR A;  5JTI A;  2F44 A;  3SYZ A;  1D8Y A;  3SEN A;  5KFU A;  2WF8 A;  2V4Q A;  4CF3 A;  1Z3E B;  2AHO B;  5J0S A;  5KFP A;  3C2M A;  2DFL A;  4ECS A;  4MFA A;  4KLI A;  5KFW A;  3TAN A;  1TAM A;  4J9P A;  2JR5 A;  4Q44 A;  3ALR A;  1JXE A;  1JIH A;  1TK8 A;  4RUC A;  4US8 A;  4ECQ A;  4PL2 A;  5J2I A;  3JPR A;  5CP2 A;  4F3O A;  3AEV A;  2ZUB A;  3M8S A;  5DG9 A;  1HEK A;  2PXI A;  2BHN A;  4QZG A;  3GV7 B;  4O0I A;  3B0X A;  5AM2 A;  4I2A A;  1SV4 A;  2FLL A;  4IRK A;  4CCH A;  2WAQ F;  5BPC A;  8ICM A;  4QZ9 A;  1QH9 A;  4RQ0 A;  2KTQ A;  2DQN B;  1T3Q A;  3RAQ A;  4DL4 A;  3RJI A;  4O3O A;  2DPI A;  4J9N A;  4J9Q A;  2W9M A;  3WKE A;  5DB7 A;  2KHV A;  5DBB A;  1ARO P;  1ECW A;  2AXT U;  2QB0 A;  4QWE A;  3HWT A;  3UMC A;  3GII A;  2LYA A;  1MC8 A;  5ALL A;  5FP0 A;  1HJP A;  4EYI B;  5JUM A;  3IP4 B;  1XWL A;  4YCX A;  2E3T A;  2KP7 A;  3F2B A;  9ICI A;  3IDW A;  2XY5 A;  4IR9 A;  4Q45 A;  1ZQN A;  2G06 A;  4Y2T A;  1ZQX A;  4QZF A;  4RT3 A;  5CB1 A;  4O3S A;  1NNL A;  4BXO A;  5AKG A;  4YXM A;  3MGV A;  1KLN A;  1KTQ A;  5ALZ A;  5KFM A;  2LYB A;  4FZL A;  5F9N A;  4DQR A;  4RQN A;  2VKQ A;  2W11 A;  1NK7 A;  1PVQ A;  1U9L A;  1J97 A;  5AKK A;  3PMN A;  5ALT A;  4F4K A;  2PFN A;  1KEJ A;  2BR0 A;  4DFM A;  3EPI A;  3VC8 A;  2XGP A;  1N60 A;  3D2N A;  2K8C B;  1U45 A;  1U47 A;  4F5Q A;  2BKE A;  5E79 U;  4QWB A;  8ICS A;  5KT5 A;  2YN4 A;  3RAX A;  4DWI A;  4YG2 A;  1UA1 A;  1XO1 A;  8ICO A;  2LKY A;  8ICL A;  2B0C A;  2NV3 A;  5AI0 A;  4ED7 A;  5J0P A;  4RQ6 A;  4MEY A;  5D49 A;  2KKP A;  9ICK A;  2VJ5 A;  4GLX A;  1VLB A;  2FPM A;  4DSI A;  1ZJM A;  2H3I A;  2E1F A;  3JPP A;  1A76 A;  3AQF A;  1JAL A;  3RJK A;  4F4Z A;  3E58 A;  2WF5 A;  4DSF A;  4KX3 A;  9ICW A;  2NRZ A;  2IOF K;  2RDJ A;  5J0U A;  3H8M A;  3IRU A;  9ICP A;  1ZXI A;  3RRG A;  4Q8F A;  1D9D A;  4IC9 A;  3QNM A;  2GH1 A;  5B66 U;  1VJ5 A;  3PST A;  5J0T A;  2Y1I A;  1BNO A;  3SEI A;  5T14 A;  1CI4 A;  2A1J A;  4I2J A;  3QU2 A;  2NO4 A;  5AIB A;  3MDC A;  4CRX A;  1SWW A;  1N5X A;  4FZM A;  4F4X A;  4RQ8 A;  1N48 A;  4KLJ A;  1ZQE A;  4PH5 A;  4GXK A;  4PPX A;  3T3F A;  2Y1J A;  7ICH A;  1A77 A;  3HT3 A;  5HML A;  4UB2 A;  3NS1 A;  1Z00 A;  4QIW C;  4NM1 A;  1SL1 A;  3N7S C;  3N7P D;  1O08 A;  4B9S A;  2RDI A;  2NRW A;  2UVU A;  4R8U A;  2ALZ A;  4QIW F;  4KX5 A;  1UCV A;  3K4G A;  4PHD A;  3TFS A;  2KJ8 A;  1Z4N A;  1FFV A;  2AQ0 A;  8ICB A;  2IMW P;  4KLG A;  1T4G A;  2ZUC A;  5EE1 A;  4P0Q B;  4YN4 A;  5ALV A;  7ICS A;  3OPX A;  2XID A;  2YTU A;  1X9S A;  4F2R A;  3QUT A;  3MGI A;  1K5O A;  2GLE A;  3GIL A;  5KT6 A;  5DG7 A;  2XCP A;  4EBD A;  4MFF A;  4UAS A;  1N2X A;  4DFK A;  5K4L A;  1JRP A;  2W04 A;  5J0X A;  5AKY A;  3FM9 A;  4EX6 A;  3CYM A;  4P0P B;  7ICI A;  4NLB A;  2RP5 A;  2ZIV A;  2KIC A;  4LVS A;  4EEL A;  2DKX A;  2KEY A;  5CEH A;  5H2F U;  5C5J A;  5ALU A;  5AKJ A;  4PGQ A;  4IRD A;  4F50 A;  3QU7 A;  3M1Y A;  1DRG A;  1B43 A;  1L3V A;  1ZQJ A;  2QAR A;  3QUQ A;  5HNK A;  2ZTD A;  4ZOH C;  4P4P A;  3DEE A;  4YP3 A;  4I27 A;  3L5K A;  3SAH A;  1S10 A;  3PV8 A;  3B0Y A;  4NXZ A;  4DOB A;  5KAI U;  1V38 A;  3F5E A;  3MC1 A;  3L4P A;  2VIX A;  2C2R A;  2BCS A;  3SMV A;  3MR6 A;  4BWM A;  4ECY A;  4M9G A;  1MN8 A;  9ICO A;  4DEZ A;  1QQ7 A;  2PI5 A;  1ZQD A;  4DSJ A;  4ED8 A;  5ALR A;  1ZQI A;  2VA8 A;  1PUZ A;  3AN1 A;  2IHM A;  2KOB A;  1X9M A;  1ZQT A;  3N4M B;  1S0N A;  3PW4 A;  3JPQ A;  3V7K A;  4MHV A;  4I2I A;  3UQ0 A;  2UVW A;  9ICN A;  4DSK A;  3UXP A;  1ZJN A;  1ZQG A;  5KFH A;  3ZDE A;  5AK4 A;  4YXJ A;  3JPT A;  8ICN A;  3QEA Z;  4KN7 A;  4NJ8 A;  3KZX A;  1BPB A;  4KLE A;  2WFA A;  4GXJ A;  1L3U A;  4ELV A;  3BZK A;  5KFT A;  4RNM A;  2BCU A;  4JMU A;  2VA3 A;  5KFI A;  1ZD2 P;  4JWM A;  1N56 A;  1NKE A;  3KOO A;  4IQT A;  5KG0 A;  4TQS A;  8ICU A;  1X40 A;  3WKB A;  4KN4 A;  2QB1 A;  5G5G A;  5AI4 A;  2WF7 A;  4TQR A;  2W3S A;  4ED1 A;  2W55 A;  1YZ7 A;  5KFL A;  4PGY A;  3KD3 A;  4NWI A;  3RFA A;  5GTH U;  4O9M A;  9ICU A;  3ZDB A;  1V9P A;  5J2K A;  4B6J A;  4FS2 A;  2W7P A;  2HHU A;  2ZIX A;  2QAR B;  4J9O A;  5KG2 A;  5AIC A;  9ICH A;  4XRH A;  5KG5 A;  2ODG A;  1X42 A;  2EZZ A;  5ALK A;  4JV0 A;  2EDU A;  2NRX A;  2HVH A;  1JI7 A;  5HHH A;  2HW3 A;  5EE0 A;  4Z6D A;  3LK9 A;  3BJY A;  5KFD A;  2W54 A;  4F5P A;  5AKE A;  5CRX A;  2WHE A;  2YML A;  4EEN A;  3ZD9 A;  3QU5 A;  8ICV A;  4WJ3 B;  4A8E A;  1ZD5 A;  3NUQ A;  4HAI A;  5AM5 A;  2E1E A;  2BGW A;  1ZD3 A;  8ICE A;  3PO5 A;  4QZI A;  1TAU A;  3WK9 A;  4DS4 A;  1KKX A;  3M6K A;  3A0H U;  2KMD A;  1UPH A;  1NOM A;  4Z6C A;  5AKL A;  4CDG A;  4C7Z A;  2JEG A;  1OXJ A;  1JRO A;  3GZF A;  1L8L A;  1AQ6 A;  4EX7 A;  3U26 A;  3GIM A;  2B6G A;  1Q8K A;  1X2I A;  4F4W A;  1TV9 A;  4RT2 A;  8ICW A;  2O6K A;  5KFS A;  2F1I A;  4P4M A;  2A1A A;  2W3R A;  4RQM A;  2UVV A;  5KFB A;  2GO7 A;  2HVI A;  1RXW A;  5HR7 A;  8ICI A;  2ES6 A;  3MFH A;  5AI8 A;  4KTQ A;  3PZP A;  4O5K A;  1ZRM A;  3MDA A;  1ZD4 A;  1A0P A;  1TE2 A;  4NLN A;  2I5H A;  9ICF A;  5AKI A;  9ICB A;  7ICV A;  5AM4 A;  5J0R A;  1XSN A;  4AYB F;  1ZQB A;  2E8M A;  4IS7 A;  3ETR A;  3CRX A;  4KLM A;  1NK9 A;  2AGQ A;  1XC9 A;  2XI9 A;  1U48 A;  3N7R C;  3RJG A;  4UAU A;  3WKD A;  5J2D A;  2FMS A;  1L7O A;  3OJU A;  7ICJ A;  7ICF A;  2H3F A;  5ALF A;  2D3D A;  5EOZ A;  4CNQ A;  2LHT A;  8ICQ A;  5AKX A;  5AK3 A;  3TAP A;  1NZP A;  2JH1 A;  2IA6 A;  2EAP A;  4QNL A;  5JU5 A;  1SWV A;  4DFD A;  2R8H A;  4QW8 A;  2G5I B;  1WUD A;  1SKW A;  1SV0 A;  5EE9 A;  5DDY A;  1UHU A;  1T94 A;  3HRD D;  4C0Z A;  3WK7 A;  2D8C A;  3UPQ A;  2GWS A;  7ICG A;  1CRX A;  1F5S A;  1FEZ A;  4NLG A;  2P66 A;  1ZQZ A;  3B9J A;  1S76 D;  3TAD A;  3GDX A;  3I76 A;  3UMB A;  5DG8 A;  4YR2 A;  2IHN A;  1PVP A;  3JPN A;  4C4T A;  3V6H A;  1Q46 A;  3T79 A;  3HJE A;  3T5L A;  2KVC A;  7ICP A;  2YMM A;  5AM3 A;  4DFP A;  4KLD A;  2B21 A;  2YQE A;  1NJY A;  5B5E U;  4DSL A;  3BQ7 A;  4YR0 A;  7ICQ A;  3H0M B;  8ICX A;  2E8N A;  4ECT A;  3Q8S B;  3E0F A;  4ICA A;  4CE6 A;  1ZQM A;  4O3R A;  1FFU A;  4LZG A;  2W9A A;  3C23 A;  3V6K A;  4F71 A;  1CEZ A;  1ZYQ A;  2ISP A;  9ICA A;  4P0Q A;  2PKE A;  5KFF A;  2P6R A;  4ELT A;  4YMM A;  1SKR A;  2XC9 A;  3LDA A;  5ALW A;  4FBT A;  1S0V A;  2PFP A;  2ZG6 A;  3QXG A;  4DL5 A;  2ASD A;  5EWF A;  8ICC A;  5D4B A;  3RJJ A;  3K75 D;  9ICV A;  2ZTE A;  2CXY A;  2V9W A;  1KDH A;  1D8B A;  2DPJ A;  1M6Y A;  5KFZ A;  4OJL A;  1SXE A;  3PR4 A;  3QUC A;  2BPF A;  3RR7 A;  2RQ5 A;  1QLN A;  2K60 A;  1SIJ A;  2FE9 A;  2BCR A;  1L5U A;  2FLP A;  5ALN A;  2Y0S F;  4GXI A;  4O3M A;  1XSP A;  4UBC A;  3BDP A;  2FMQ A;  1Z19 A;  4KLQ A;  4C80 A;  3SR6 A;  1L6N A;  2I1Q A;  1S5L U;  2Y0S C;  3RJE A;  5J29 A;  3QYP A;  1DXS A;  3RRH A;  3QU9 A;  2HHV A;  7ICN A;  3OTQ A;  3Q8P B;  4FS1 A;  4BJQ A;  4I2B A;  5AKH A;  3PSF A;  2KK0 A;  1KFS A;  2C2E A;  5IIJ A;  1WYG A;  1BPZ A;  1JUD A;  2W8L A;  2Y9T A;  2K4P A;  2YB1 A;  4R64 A;  5AI6 A;  3MGH A;  3TAC B;  2JEI A;  2XVT A;  3HPO A;  4GC6 A;  4DOC A;  1X9X A;  4IL6 U;  5J2J A;  4Y2U A;  4KMO B;  4AP9 A;  4ED6 A;  4YVZ A;  3PVX A;  1KQQ A;  5AK6 A;  1DOQ A;  1UT8 A;  4F72 A;  2VAN A;  3PX6 A;  4UB5 A;  8ICR A;  2DKZ A;  1ZET A;  3UXN A;  5CWR A;  2RLT A;  3R9K A;  4ECV A;  3VCB A;  2DWQ A;  4PGX A;  3ED5 A;  3GV5 B;  1QQ6 A;  3M8R A;  4RPY A;  4Z6F A;  4EBC A;  4O5E A;  2ZXI A;  1HUZ A;  5ALI A;  1L3S A;  4DL2 A;  4C8K A;  5KFR A;  1OUQ A;  2HOF A;  2K8B B;  3GU3 A;  1V85 A;  3UMG A;  4F93 B;  3KTQ A;  1P7D A;  2ZIX B;  3H0L B;  5AKZ A;  3RB0 A;  2ZIU A;  5KL1 B;  2CN1 A;  1FIQ A;  3FC4 A;  4F91 B;  3OSP A;  4K4H A;  4U6P A;  3EPG A;  2R8I A;  4OD0 A;  4YFK A;  4K4I A;  1B4F A;  3WU2 U;  1LKY B;  2HOQ A;  1QCK A;  4JUZ A;  3LWL A;  3PW0 A;  4Z6E A;  4B9T A;  2WF9 A;  3QZ8 A;  5HMM A;  5DLF A;  2YMQ A;  1SGG A;  2YB4 A;  4YD1 A;  4M9N A;  4UB4 A;  1ZQS A;  1PVR A;  4M6W A;  4US9 A;  5ALY A;  3RBE A;  1S77 D;  5ALH A;  3QU4 A;  1NI3 A;  2G5H B;  3PR5 B;  2XY7 A;  5ALO A;  3NRZ A;  1ZQY A;  4ECR A;  5TIS U;  3OSN A;  1X9W A;  1TAQ A;  1NK4 A;  1TFR A;  1ZQH A;  2AQ4 A;  2OYY A;  1MSW D;  5F3X B;  3IG8 A;  5KTQ A;  3ZD8 A;  5J8Y A;  2VJ4 A;  2LI6 A;  1NKB A;  4R65 A;  3MBY A;  1KBU A;  4Y2P A;  1L7N A;  2FJ6 A;  5KFX A;  3PW5 A;  3UXO A;  4TUP A;  4XA5 A;  5KT2 A;  4UW9 A;  3NVW A;  5DB6 A;  2KD1 A;  1LB2 B;  4P4O A;  2L5Y A;  4I2C A;  1KN5 A;  1ZQQ A;  5DBA A;  3AU6 A;  2F2A B;  2KJ5 A;  3RJH A;  4DLG A;  1S8O A;  4UAY A;  2MRL A;  3D6J A;  4C8N A;  4ECU A;  4RPX A;  7ICL A;  5ALM A;  8ICZ A;  1N62 A;  4F92 B;  2KFN A;  4PHE A;  3PX0 A;  5J2A A;  1Y88 A;  2MUT A;  2XO7 A;  2EZX A;  1DK2 A;  5BOM A;  8ICJ A;  2LBO A;  1BVS A;  5KNI A;  4F5N A;  4MFC A;  1N61 A;  4YR3 A;  2F8K A;  3KFU F;  2HBJ A;  2DUY A;  3IM1 A;  3H8W A;  4OO1 J;  4NM2 A;  2JZB A;  5AI5 A;  1N5W A;  1XSL A;  5AHX A;  2KE7 A;  4BUG A;  4EYH B;  4KLU A;  4RNN A;  4UAZ A;  3KHL A;  3FYH A;  5IIN A;  3MR2 A;  2EAM A;  2YMP A;  4PHA A;  2C28 A;  1KL9 A;  2E8P A;  5KFC A;  1DK3 A;  1QSY A;  9ICS A;  3O0F A;  2OWO A;  3SV4 A;  3OJS A;  4F5R A;  3H4B A;  1ZQ1 C;  4BGD A;  2W7O A;  4QWC A;  3PSP A;  3MFI A;  4F5O A;  1BPY A;  1RZT A;  2JH7 A;  1IIP A;  4LZD A;  1MQ3 A;  2KZ3 A;  4DCC A;  1EXN A;  2KN7 A;  5DGB A;  2BCV A;  4Y2Y A;  3KKA C;  4Y2X A;  3RR8 A;  2Y9U A;  2ATL A;  2FLN A;  1ZQA A;  3UQ2 A;  4AYB C;  4Y2V A;  3FDS A;  1T7P A;  1IV8 A;  1RDF A;  2JRZ A;  1LV5 A;  1PZN A;  2A3V A;  1OW5 A;  3GQC A;  3D2S A;  2HDO A;  2HI0 A;  7ICE A;  2W9B B;  4ELU A;  2AJQ A;  3F53 A;  1RG6 A;  1WG8 A;  3PW7 A;  2HBK A;  1S0O A;  5HHI A;  5AM0 A;  9ICL A;  2EZY A;  3MR3 A;  1SL2 A;  1C20 A;  5KFQ A;  9ICX A;  2KIW A;  5KG7 A;  3WK8 A;  2W43 A;  1ZQW A;  1ZQP A;  5KT3 A; 
#chains in the Genus database with same CATH homology
 3RF9 A;  3LYS A;  3SAH A;  2F77 X;  2XVT A;  2YB4 A;  2H3Z A;  2E5S A;  2XIC A;  2HBL A;  3L3F X;  4AYB F;  5T14 A;  3F2C A;  2HBJ A;  3KFU F;  2K4H A;  5A0L A;  5C0Y A;  2W7P A;  1PVR A;  2KHQ A;  2ZIX A;  1NZB A;  3IP4 B;  4KMO B;  2ZIU B;  3CRX A;  2YX8 A;  2CPR A;  3F5E A;  4CRX A;  3H0R B;  4OO1 J;  3C29 A;  1XNS A;  4FE3 A;  2XI9 A;  2VIX A;  3N7R C;  4FZM A;  2R18 A;  2G0A A;  3HKZ F;  3AQE A;  3SMV A;  2HBM A;  2ZG6 A;  3F2B A;  1ED1 A;  1SZH A;  2H3Q A;  1Q3V A;  2KNJ A;  2JHD A;  4ACO A;  1YT3 A;  2H3F A;  2KV2 A;  1URJ A;  4BUG A;  3ONN A;  1Z1B A;  2BDU A;  2G06 A;  4QJF B;  2LHT A;  2G5H B;  2KJ9 A;  2Q4T A;  2PMZ C;  3HKZ C;  2GOL A;  4QIW C;  3VCB A;  5CRX A;  2KOB A;  2JH1 A;  2WB1 F;  3SQI A;  3MGV A;  2CRX A;  3N7S C;  3N7P D;  4QNL A;  3NRW A;  2ZIV B;  2G5I B;  1D8B A;  4PL1 A;  4WJ3 B;  3IN5 A;  2K89 A;  3K1Z A;  4A8E A;  2LYB A;  2WB1 C;  3NUQ A;  3O0F A;  4FZL A;  4OJ6 A;  1WUD A;  2E1E A;  4OJL A;  4CGZ A;  2G07 A;  4QIW F;  1ZQ1 C;  3LVW A;  2W7O A;  4KX5 A;  3PSP A;  2VKQ A;  3CP8 A;  2F8L A;  2ZXI A;  2OYY A;  1PVQ A;  1T94 A;  2KJ8 A;  2D6F C;  3D2Q A;  3M6K A;  1GO3 F;  2G09 A;  2H3V A;  1IIP A;  2JH7 A;  4C0Z A;  3IG8 A;  3IG5 A;  4OJ5 A;  1F44 A;  2HMX A;  1UPH A;  4OJO A;  2VJ4 A;  2Y0S F;  4P0Q B;  1CRX A;  1KBU A;  4O3M A;  1OUQ A;  2JMG A;  4CDG A;  3OPX A;  2K8B B;  2HOF A;  2XID A;  3VC8 A;  2DF4 B;  1TAM A;  3D2N A;  2K8C B;  3GZF A;  3GU3 A;  3KZX A;  3SAG A;  4NV0 A;  1Z19 A;  1P7D A;  3ALR A;  2OM6 A;  2ZIX B;  3H0L B;  2JGA A;  2ZIU A;  5KL1 B;  2CN1 A;  1L6N A;  4AYB C;  2K8A A;  2K4I A;  2Y0S C;  5KL8 B;  4PL2 A;  2KD1 A;  2PMZ F;  2MA1 A;  3ICX A;  1PVP A;  3PSI A;  2KKV A;  2W03 A;  4FZN A;  3C28 A;  2A3V A;  1HEK A;  2LKY A;  2F2A B;  2KJ5 A;  2M0N A;  3LVV A;  2NV3 A;  3D2S A;  4OJP A;  4BJQ A;  3M7D A;  3T79 A;  2WAQ C;  4JMU A;  2KVC A;  2HOI A;  3F2D A;  2K4E A;  2MRL A;  2W04 A;  5HR7 A;  5HR6 A;  3SAF A;  2KKP A;  2OH2 A;  2ZIW B;  3F53 A;  3PSF A;  4U6P A;  2VJ5 A;  2OXO A;  2WAQ F;  2F76 X;  2RRD A;  3PZP A;  3CYM A;  1A6S A;  2H3I A;  2HBK A;  2E1F A;  4P0P B;  3H0M B;  4NLB A;  2RP5 A;  2DQN B;  2ZIV A;  2KIC A;  3AQF A;  2HOQ A;  2KEY A;  1Q3U A;  2DGZ A;  4P0Q A;  1XO0 A;  4BX9 C;  3E0F A;  1A0P A;  4ICA A;  2ZIW A;  3AL0 B;  1MA7 A;  1HIW A;  3M6Z A;  2KHV A;  4KX3 A;  4NLC A;  1ECW A;  1DRG A;  3RFA A;  2RHF A;  4NWI A;  4P0P A;  2KIW A;  2ZXH A;  2YB1 A;  4GFJ A;  2LYA A;  4IC9 A;  3F5A A;  2LBO A;  2GH1 A;  2Z7J A;  3PST A;  4U7C A;  2N1R A;  3DEE A;  2G08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...