2KJ9A

Nmr structure of intb phage-integrase-like protein fragment 90-199 from erwinia carotova subsp. atroseptica: northeast structural genomics consortium target ewr217e
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
118
structure length
118
Chain Sequence
KSVQEKRNNTRAFKTVAKSWFATKTTWSEDYQRSVWTRLETYLFPDIGNKDIAELDTGDLLVPIKKIEKLGYLEIAMRVKQYATAIMRYAVQQKMIRFNPAYDLEGAVQKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title NMR structure of IntB phage-integrase-like protein fragment 90-199 from Erwinia carotova subsp. atroseptica
rcsb
source organism Pectobacterium atrosepticum
molecule tags Dna binding protein
total genus 35
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kj9A00
2KD1A 4ACOA 2KIWA 2KHQA 2CRXA 2KJ8A 3NRWA 4A8EA 3LYSA 2KJ9A 1XO0A 4CRXA 2KHVA 3C28A 1PVRA 2KKVA 2KJ5A 3C29A 1XNSA 1Q3VA 3CRXA 2KOBA 2A3VA 1P7DA 2OXOA 2KKPA 1DRGA 1Z19A 2KEYA 1A0PA 1PVQA 1CRXA 3MGVA 1OUQA 1Q3UA 1F44A 1MA7A 1NZBA 1PVPA 1Z1BA 2HOIA 2HOFA 5CRXA 1KBUA
chains in the Genus database with same CATH superfamily
5KG1A 2R8GA 4RPXA 8ICNA 3B0YA 2JH1A 3TKAA 9ICIA 3CP8A 3CRXA 3RJHA 4CF3A 4TUSA 2JZBB 3PO4A 2W7PA 2ZIXB 4ED8A 2P35A 2XIDA 2YX8A 3MFIA 2NRTA 3TADC 3MR2A 5J0QA 2WB1F 5J2AA 4JV0A 1XU4A 2C2RA 2LMRA 5J2CA 4ECZA 1XSNA 1Q3VA 2R8IA 2W3RA 3AM9A 4AP9A 5E79U 4DFKA 4F8RA 8ICKA 4FZLA 1T7PA 4ZOHC 1C7YA 3N7SC 2RQ5A 4C4RA 2WF9A 2BQUA 4UB2A 4NXZA 9ICMA 5KFCA 1A76A 2KIVA 3V72A 1KFTA 2XO7A 5AK5A 3NVYA 2YMQA 2F8LA 3MDCA 1L3UA 8ICTA 9ICPA 9ICGA 4DFDA 1ZD2P 5KG5A 4EBDA 3PW4A 3KZIU 3IG8A 3HP6A 4M2YA 2OH2A 1BNOA 1T94A 4RT3A 3MC1A 4F93B 3IP4B 4DL6A 4KLLA 4O5CA 9ICUA 3OSNA 1B22A 2MRLA 2ZIUB 4YMMA 3H40A 1FIQA 2NO5A 4F91B 2FJ6A 3SI8A 4CNQA 5AK3A 1S77D 5HR6A 3RBDA 2BKEA 2VA8A 1ZQKA 2RLTA 4PHPA 3OJUA 2BHNA 3MR6A 3QU7A 5AKXA 2NRWA 2E8NA 4UAZA 3JPTA 2BZFA 4EZ6A 2OEHA 2HVIA 9ICCA 3OPXA 3TQ1A 2XICA 1QQ6A 5CR0A 5HP4A 5DLGA 1DGSA 2RP5A 4M0AA 3N7PD 3QUBA 3RB3A 4NWIA 4RQ7A 3QEBZ 4GLXA 2G09A 3TACB 2PFQA 3RJIA 3KKAC 1WUDA 1NJXA 3O0FA 4BDPA 8ICOA 2KJ9A 3PO5A 5DDYA 3QXGA 3V7JA 4YMOA 3QX7A 2C2DA 2E1EA 2G5HB 3C1ZA 3RR7A 1OW5A 2MUTA 4I2DA 1Z1BA 2XGPA 1LVHA 5J0YA 2G5IB 3WK4A 3TI0A 8ICLA 5DBCA 1KFSA 5J2BA 3PMLA 5AI8A 4QIWC 3BQ7A 5KFZA 3V6KA 4ELUA 2E1FA 2KVCA 2VJ5A 4YXJA 5KFXA 1L7PA 5D49A 4FE3A 1UCVA 2OCEA 2DF4B 1ZQFA 2R18A 3KFUF 3ED5A 2EANA 1OUQA 4LJXA 4RQ5A 3OHAA 3SAFA 3AN1A 1D8YA 2EH9A 4UAWA 3HKZC 4FZNA 4DL5A 4Q8EA 3M9OB 4F71A 2IOHA 3IG5A 5J2DA 9ICLA 3EPIA 3N7RC 4UBCA 1X9MA 1WG8A 2QB1A 4QZHA 1WWUA 4DSFA 2KTQA 1ZQYA 1ZQBA 4IRCA 3MR3A 1VLBA 3WKCA 3WK8A 2H5XA 1TAQA 3H8MA 4FO6A 2Q4TA 1PUZA 3KHGA 2YB1A 1L3VA 3H8JA 1ED1A 3QNMA 2FI1A 3AL0B 3T79A 1KBUA 1KRPA 1SL0A 1RQLA 3AMZA 4K4IA 2KJ8A 3BS7A 4ECSA 2K60A 2EQYA 2HBJA 3RJFA 5DBBA 3ETRA 2ESEA 4ELVA 3SV4A 2D3DA 4PL1A 3Q8MA 5EE9A 2FPLA 1N60A 1ZQIA 1NOMA 4JMUA 3LWMA 3LVVA 4BUGA 2JEJA 1UA1A 4DQIA 3SENA 1LV5A 9ICHA 4NLGA 1X9SA 3K1RB 3SYZA 4Y2UA 2OWOA 4R63A 3KZXA 3MABA 2C22A 1V97A 1IV8A 4B9VA 4QZBA 5IIMA 1BGXT 2G0AA 3RFAA 8ICIA 2ZTCA 7ICUA 2E5SA 3HKZF 5B66U 3GDXA 3KD3A 4UB1A 3OTQA 1GO3F 3GILA 5ALXA 5ALSA 2EZXA 4RPZA 5KFFA 1VDVA 3NRWA 4UB8U 3PY8A 1SXDA 4M04A 3RTVA 5CEHA 1NZPA 3F53A 1DRGA 5KFNA 4DF4A 5ALGA 3BJYA 3UQ2A 5ALHA 5HNKA 2GO7A 4Q8FA 4KLFA 5L1JA 2W43A 3ZDDA 2R8HA 5KG7A 3C5FA 7ICHA 4DSEA 1TFRA 1OXJA 2K4IA 3CW2C 3DV9A 4RQ2A 2FMPA 1T8EA 3UM9A 3AQFA 2P6RA 3UPQA 2BR0A 4P4PA 4RUAA 4J9PA 2MSNA 4C0ZA 1MQ2A 1T3QA 1N61A 3D6JA 2A1JA 1BPBA 5KFVA 3SR6A 4R8UB 2H3VA 4I27A 5AM3A 2JHDA 3PSIA 2KHQA 5J2KA 3ISBA 4ED1A 5KFMA 9ICAA 4F3OA 3QZ7A 4ED6A 4PZOA 3QUTA 2KOBA 1ZQOA 4KLSA 9ICXA 1X9WA 4GIBA 4JWNA 1KL9A 4F4ZA 4YD1A 4PHEA 5EWEA 3F2DA 5J0SA 4MFCA 5JRTA 3SAGA 4K4HA 2AQ0A 2I5HA 4EEKA 2BGWA 3F2CA 4IQUA 1NK7A 3ZI4A 2J6UA 4E0DA 3BQ1A 4I2CA 5ALUA 3RB0A 1HJPA 2PFPA 4RQNA 4CF4A 3HT3A 1S10A 3FAHA 3C2MA 4UATA 5KL1B 2HHVA 3NTUA 2HHSA 2W8LA 1TKDA 4Y2JA 5DBAA 2WF7A 1NK9A 3RR8A 2DFLA 1S5LU 2ZTDA 4M9GA 2MUTB 1HUZA 2F1IA 4RZRA 4DF8A 1SWVA 3SQIA 2UVRA 4QZGA 4F72A 2K4EA 5CA7A 5DB9A 4QNLA 4LVSA 3RJKA 2W7OA 4QZIA 4KTQA 4DL7A 1SKSA 2ZUDA 1ZQCA 3M9NB 3T5KA 4DFJA 1KLNA 5KT6A 5AKLA 4JV1A 7ICQA 3C23A 5DLFA 3PR5B 2CRXA 4J9NA 4FBUA 4YMNA 4CE6A 4GC7A 3TFSA 5FP0A 4R65A 5KFHA 1TAUA 4C80A 4YG2A 4XQ8A 2LM4A 1Q46A 5DGBA 4KLTA 4F5OA 3J81j 4ED2A 1KFDA 3L4PA 4F5NA 4UQGA 2KFZA 1ZRMA 4M9LA 3QUQA 1UA0A 5BOMA 4QW9A 1ZD3A 2LYBA 4KITB 2W04A 5HMLA 3PW5A 2OXOA 4KLUA 5KFYA 5J0PA 5CWRA 4X5VA 2AHOB 5KFKA 1RYRA 5AKHA 4JB3A 1C20A 4OJLA 5KNIA 1KSPA 1UPHA 7ICEA 2MU2A 1TK5A 1F0MA 3SZ2A 3RH5A 5EE1A 1KQQA 3OSPA 3B0XA 4O5EA 2DGZA 2WAQC 4J9QA 1BPEA 1ZQSA 2VKQA 4HYKA 2BCVA 1NK6A 2H3QA 4UARA 2ALZA 2WF8A 3KOOA 4OJ5A 4RQ0A 5JUMA 4I2IA 3RF9A 3SD7A 2KN7A 1SV4A 5AKGA 2K4PA 1JXEA 2I1QA 4J9KA 2A3VA 3R9KA 2G08A 1U4BA 5AK4A 1FEZA 3T5HA 1KKXA 4O3MA 4I2GA 2PKEA 3T5JA 2B21A 2Y0SC 5KFAA 2FLNA 2WFAA 5AK6A 4QWCA 1RDFA 3TAQA 3UXNA 2CXYA 2VA3A 4F5PA 2BQRA 4B6JA 1Z19A 4KX5A 4Y2XA 4UAUA 4CF5A 3MGVA 9ICJA 3DDHA 4P0PA 4DQRA 3GQCA 5IIJA 4RT2A 7ICRA 1U45A 1FO4A 4DL2A 3V6HA 1ZETA 1SV0A 2K89A 3M8RA 3EPGA 4ED0A 1YZ7A 1JN3A 2EAMA 3SAHA 2B6GA 3LWLA 4PL2A 4RQMA 1RXVA 4NJ8A 3N4MB 1ZQRA 3V6JA 2WAQF 5DG9A 5IIKA 3ETLA 4LZGA 4BGDA 1XC9A 5KAIU 4Y2SA 2ATLA 1BVSA 4KMOB 5AI0A 1Z00A 3HW8A 2D8CA 4RU9A 5AKYA 2V4RA 1NZBA 2LPEA 3K1ZA 5AKIA 3WK6A 2GOLA 1TK0A 3TFRA 4I2HA 3IV6A 2ZG6A 3H0LB 4GXJA 1QQ5A 9ICQA 3MGIA 2ES6A 2F44A 3L3FX 5KG2A 3ORYA 3B9JA 4F5QA 5DDMA 1SWWA 2IHNA 4J03A 4Z6EA 5AKKA 5ALRA 5KFDA 4KLJA 2L5YA 2QARB 3IM1A 3SV3A 3UMBA 4QWAA 2D6FC 1SGGA 4DSJA 3EZ5A 7ICIA 4I2JA 9ICNA 2AGPA 7ICMA 4IQVA 4Z6FA 3AQEA 7ICGA 1TAMA 1L7OA 2HSZA 1D9FA 3BQ2A 4JWMA 4O3SA 2LBOA 3CYMA 2JH7A 3ZDBA 4O3OA 3KTQA 4FBTA 2KK0A 3H8SA 2NO4A 4Z6CA 4ZH4A 4KLHA 2BDUA 3JPNA 2QLTA 5T14A 1KEJA 4J9MA 1PVPA 1L8OA 3C1YA 4YR2A 2PI5A 4F5RA 2OYYA 3H4BA 4I2AA 2NRXA 5JU5A 2KV2A 4PJ0U 4FS2A 1VJ5A 1ZD4A 4PPXA 4EZ9A 1U49A 2UVUA 1N5WA 2Y9UA 4R66A 1MSWD 5J2JA 3JPPA 3QU4A 4MEXA 3HJEA 4DOCA 3PW0A 4QWEA 3M6ZA 2DBYA 5ALFA 8ICXA 3M6KA 9ICVA 1ZQLA 5DG8A 4A8EA 4PZNA 2GWSA 3ZDCA 3QU9A 4DSKA 3WKAA 1K1SA 2F77X 3C29A 5GTHU 3NRZA 1WCLA 5KFGA 1CEZA 4WJ3B 5HMMA 5KFIA 3QU5A 3JPSA 2Z7JA 2WTFA 3VCBA 1UT5A 5J29A 3BS5A 3ISDA 4KLOA 5KT5A 8ICFA 1HEKA 2AGOA 4EENA 2JMGA 1NJYA 3Q8QB 2ZUCA 4I2BA 4YN4A 4ECXA 8ICMA 2DQNB 3AUOA 1MN8A 4O3NA 2RDIA 4PGQA 2BQ3A 2BPFA 4P2HA 3H7IA 5DKWA 2ISPA 3OGUA 1XSLA 2W9CA 4F92B 4OCZA 1QQ7A 2W9BA 2IHMA 2ZIWA 2G06A 1QSLA 5L1KA 3RJEA 4KLIA 1WYGA 1J97A 4DFPA 1COKA 3G6XA 2KD1A 4GXKA 4M6WA 5KFRA 4NLNA 5K4LA 4I28A 5ALOA 1KDHA 2K8CB 1XNSA 1NKBA 2BCRA 4DO9A 4GXIA 4QWDA 4TUQA 3ZDAA 5ALDA 2LKYA 4KN7A 1ZQDA 4KLDA 3RH6A 5J2HA 4I29A 3DEEA 7ICTA 2KKPA 4F2RA 2PI4A 3G6YA 3KKAA 2YN4A 3IRUA 4FZMA 4QIWF 1S8OA 1Z4NA 3EYZA 4EBEA 3GV5B 2ZUBA 1DXSA 2LM1A 1J2NA 4DL4A 2XY5A 1RYSA 4P0QA 4RPYA 3D2QA 3PW7A 8ICQA 1NKEA 4J9SA 4ELTA 4M47A 3C5GA 3QUCA 4Q44A 2YY6A 1Z00B 3MBYA 2KZZA 1ZQQA 4QW8A 2E8MA 1S0NA 4M9HA 4ECVA 1J2MA 4RQ6A 4C8OA 3PV8A 4B9LA 1TVAA 5C0YA 1COOA 1U48A 1RM6C 2YMPA 4IS7A 5KFLA 3KHHA 3UMGA 1ZQVA 1L5UA 1XO1A 1URJA 3N28A 3Q8SB 2LHTA 2CPRA 2DKZA 4BX9C 1JRPA 5JTIA 3FDSA 3H0RB 4OD0A 1SZPA 3QU2A 3QE9Y 5AM1A 5F9NA 1NK8A 1V85A 5CB1A 5DGAA 2IOFA 3SEIA 2HW3A 4M9NA 3RH4A 1SXEA 3PX4A 7ICPA 5IINA 1NKCA 4USAA 1X2IA 1UT8A 2Y1IA 4QZ8A 3WU2U 4KMUA 3GIKA 4MFFA 5J2IA 4UB3A 5IILA 2BPCA 5CHGA 5KT4A 4IRDA 2JZBA 1EXNA 4B9TA 4IR1A 2XI9A 3IN5A 2FMQA 4DWIA 2ZIXA 2W55A 4UAYA 1N48A 3ZDEA 3U26A 1S0OA 5G5GA 5J8YC 7ICVA 2I9GA 3KBBA 3VC8A 5KT2A 8ICAA 4RQ3A 4RQ1A 3OHBA 5AICA 4ED3A 5KFJA 3ALRA 1M6YA 5KT7A 5J2EA 1LB2B 2F76X 5KL8B 7ICOA 4NL9A 5AHXA 1JXLA 2HBMA 3ICXA 2XCPA 3HILA 4YVZA 1S97A 4NM1A 2IOFK 1ZD5A 1ZQJA 2FLPA 4IR9A 1S0MA 5KG4A 3Q8LA 3LVWA 4DSLA 1SKRA 8ICBA 3BS5B 1SZHA 1ZQTA 4KLMA 1D8LA 1XWLA 3PSTA 3LDAA 9ICOA 1UHUA 5DB7A 2XVTA 1MQ3A 2BCQA 4IQTA 2LYHA 2ZJ8A 5KT3A 2K8AA 2W9AA 2K8BB 4J9LA 4KLGA 2ZIUA 5J0XA 2EZYA 1RPLA 2HBLA 3NS1A 5J0UA 2W8KA 4EYIB 2ASJA 1ZRNA 1PVRA 8ICHA 3I28A 5ALZA 4MF8A 2W9CB 1ZQPA 4I2FA 2W9BB 2ZIWB 4DQPA 4C4SA 2F8KA 4B9UA 4NM2A 4BWJA 1QTMA 2E8PA 2KG5A 1DK2A 1ZXIA 3FYHA 4YR3A 5AM4A 4C8KA 1H38A 2KP7A 1X42A 2W3SA 4RUCA 2HMXA 2M9NA 4FFDA 2A19A 4M6WB 5F3XB 4MEYA 7ICJA 3GIIA 1AQ6A 2DUYA 5ALJA 5ALNA 4Y2TA 1X66A 1SV0C 4J9RA 3V7LA 5BOLA 4UW9A 4DS5A 3SMVA 3EW9A 5AM0A 2YB4A 2F1HA 4ACOA 2AGQA 4F4XA 1NJZA 4RNNA 1KTQA 3AU2A 1ZQMA 1BPYA 3FC4A 1L3SA 4PHAA 2AU0A 3NUQA 3MFHA 2G07A 4QZ9A 1S9FA 5EWGA 3BZKA 4PGYA 2ASLA 3GIMA 2PFOA 3RB4A 1AROP 3Q8RB 1K5OA 1FFVA 4TQSA 2KICA 5BPCA 4DS4A 2J6TA 1QCKA 4ECUA 4ICAA 4IRKA 1O03A 1WCNA 3RJGA 2HCFA 2NYVA 2WB1C 4YD2A 1L3TA 5ALLA 3RAXA 1ZQGA 2Q0ZX 2R8KA 4F2SA 4P0QB 1A0PA 5EE3A 4DQQA 2AH5A 2FE9A 2ZXHA 3WKEA 1RXWA 2JGAA 2YMMA 2KSOA 4O3QA 2J6SA 3WKBA 3T5LA 3PSFA 3N97B 3TARA 1T4GA 5ALQA 3QZ8A 3QEAZ 2KJ5A 1U47A 3KHLA 2HHXA 3BZCA 1XSPA 2N1RA 2KZMA 4ECRA 2LI6A 1NI3A 2PFNA 3S6JA 3PZPA 1L8LA 2DKXA 2WF5A 3PMNA 4DQSA 7ICSA 2H3FA 4YXMA 1JIHA 5AI5A 1SIJA 4EELA 4AYBC 4MHVA 2EDUA 3OJSA 7ICNA 1BNPA 3F5AA 4PGXA 5ALYA 5ALMA 1UQVA 5A0LA 2JEIA 2IMWP 3GIJA 5KFQA 2A1JB 4RQ8A 5DB8A 4G9BA 5EE0A 5DB6A 2V4QA 1S76D 5D4BA 2XC9A 2PXIA 3NVVA 2JXJA 4EX6A 2A1AA 9ICBA 3C2KA 5TZVA 5ALEA 2VANA 2XY7A 1Z3EB 5J2FA 5L1MA 4BJQA 2P6UA 4YFKA 2FLLA 2JRZA 1D8BA 1PK1A 5HHHA 2Y9TA 3F5EA 2C2EA 2Y0SF 2JR5A 5CRXA 8ICJA 3UMCA 1SKWA 5HHIA 1X9XA 5KFTA 1RYUA 2HBKA 1TE2A 2V9WA 4OJOA 3Q8KA 4EX7A 2H3ZA 3A0BU 4NLKA 5TISU 8ICPA 2ASDA 4DEZA 1MA7A 1O08A 9ICTA 4JV2A 2RDJA 1LKYA 5D46A 1BPZA 4AYBF 4RNOA 2IBKA 3GFKB 2HI0A 3WK5A 3PR4A 3PW2A 2BDPA 4PH5A 1CUKA 4Y2PA 4C7ZA 1JROA 5KFBA 5KTQA 4PHDA 1ZQZA 2AJQA 4OJ6A 4UBBA 1NJWA 2I6XA 5C5JA 4DOBA 4R8UA 1ZOLA 2ISOA 3FM9A 3H4DA 3KHRA 9ICSA 5F9LA 3MDAA 8ICZA 2JEGA 2JEFA 1JMSA 1D9DA 4BXOA 1RG6A 4QJFB 1HIWA 4Z6DA 1L7NA 2K4HA 4EBCA 3TAPA 8ICYA 3TADA 1B4FA 2WHEA 3AU6A 2O6KA 2NRVA 1IXRA 3WKDA 2EZZA 2FPKA 1K1QA 3GV8B 4QZFA 1DOQA 3L5KA 5AKEA 2KHVA 4KN4A 8ICEA 5AI4A 1SB3C 4NV0A 1N62A 1QSYA 4DL3A 1V9PA 1KW4A 4NY8A 8ICWA 4DLEA 4YCXA 1Y88A 4DFMA 1S0VA 1X6IA 4DLGA 1ZQAA 2ZIVA 4OJPA 1ZJMA 3H8WA 1PK3A 4K4GA 4LZDA 4Y2RA 4O3PA 2KZ3A 2W54A 4TQRA 1SL2A 2BCSA 4C8NA 5DQGA 7ICFA 9ICRA 2WF6A 2ZJ5A 3K4GA 1U9LA 4O9MA 2KSOB 1Z1VA 1V38A 3NVZA 4US9A 4UAVA 1IM4A 4KLEA 2KE7A 1ZQEA 2XGQA 5L1IA 4Y2QA 2ZJAA 3ZD8A 5KFSA 5IIIA 2RRDA 3T3FA 4GC6A 3I1YA 4KLQA 4P0PB 2LYAA 5HR7A 1NK5A 2AXTU 2HOQA 3HWTA 2GH1A 5J0WA 5H2FU 3TANA 1BPDA 1SL1A 2OM6A 5AKZA 5ALPA 4C7YA 1TV9A 3I76A 4O0IA 1A6SA 1ZQHA 2RHFA 3PX6A 4G3IA 4O5KA 4IL6U 1YT3A 2HDOA 2ZXIA 3AEVA 3K75D 3GZFA 8ICCA 5KAFU 2JV3A 8ICGA 5AI6A 1P7DA 5KFUA 4NL9C 3C2LA 3E58A 5KFPA 4F4KA 4XA5A 4ECQA 1F44A 3RB6A 3C21A 4B9SA 4TUPA 3GV7B 1NK4A 2BCUA 5L1LA 3RBEA 1XS9D 2KIWA 1L6NA 3ZD9A 4FS1A 3H0MB 3NASA 4MF2A 9ICKA 4P4MA 3EWAA 2QB0A 2CN1A 3UQ0A 9ICEA 1PK1B 3THVA 3M8SA 2MAXA 4C8MA 2UVWA 9ICFA 5J0TA 2NRZA 3D2SA 2HOFA 4U6PA 2IA6A 5ALVA 4QZEA 4B9MA 3HPOA 5B5EU 4I2EA 1ZQXA 3LYSA 4ECTA 2KKVA 4TURA 4DCCA 4J9OA 1B0XA 4UB4A 2PMZC 3RRGA 4C8LA 1DGJA 1PZNA 2F1JA 4NLZA 4BWMA 1CRXA 5DQHA 1ZQ1C 5J0OA 4UB5A 1Q3UA 2E8OA 3MR5A 4XUSA 4UASA 2C28A 2KVSA 3RRHA 8ICSA 4B9NA 1LKYB 5CP2A 4EYHB 4ECYA 4MFAA 1T3NA 2KFNA 1KN5A 1HUOA 5AM5A 2BPGA 3BQTA 1PVQA 2B0CA 2F2AB 2XY6A 1WWVA 1ZYQA 2H3IA 5G5HA 2VJ4A 4QZCA 1QLNA 5AI9A 3M9MB 3CNHA 4F4WA 5CJ7A 8ICRA 1Q8KA 4BXOB 4CCHA 2HHWA 2DPJA 4IQWA 3JPRA 4DOAA 7ICLA 1Z4OA 1N56A 3MGHA 3BQ0A 4CDGA 3PVXA 2MA1A 2HVHA 4CRXA 3E0FA 4C4TA 5EOZA 2F3NA 2QARA 1L7MA 4KX3A 3JPQA 1IIPA 4F50A 4EEYA 3WK7A 3HX0A 1ZQWA 2FPMA 4OO1J 2HOIA 3ISCA 4ED7A 1X6JA 2PMZF 5IIOA 4U7CA 4YP3A 3C28A 2DL0A 3WK9A 4HAIA 1BPXA 4XRHA 1NNLA 2W11A 2ZIVB 2NV3A 3UXPA 4O3RA 1JX4A 3NGDA 2R8JA 2HHQA 4NLBA 2W9MA 3ONNA 5KG0A 3RAQA 2KNJA 7ICKA 8ICVA 3M7DA 4Y2VA 3UXOA 5J0RA 1CI4A 4QZDA 1ZQNA 4JK1A 4JUZA 5KG6A 2KMDA 4M9JA 1FFUA 2VA2A 3BDPA 1ECWA 1A77A 1X40A 4UB6U 4RQ4A 3NVWA 2YQEA 4YQWA 1N63A 4Y2YA 2DPIA 1B43A 1JUDA 1DK3A 2DWQA 4QZAA 4IC9A 3RJJA 2AQ4A 1NK0A 5J8YA 2YMLA 2W03A 3F2BA 3QYPA 5KFWA 2HHTA 4US8A 1F5SA 5GTIU 2FMSA 4YR0A 5ALWA 3V7KA 3IDWA 3G6VA 3LK9A 1RZTA 8ICUA 5KG3A 1XO0A 1JALA 1MC8A 5AIBA 3EUB2 5KFEA 2GLEA 2ODGA 3JPOA 1ZQUA 3A0HU 5ALIA 2UVVA 3D2NA 5KFOA 3M1YA 4Q45A 2Y1JA 2HHUA 4RNMA 1QH9A 2E3TA 3PSPA 3PNCA 2QKQA 5DQIA 3HRDD 4DSIA 1IG6A 1YZ6A 1ZJNA 3IHQB 2QB0B 5L9XA 5DG7A 5J2GA 2FDRA 2KEYA 4NLCA 2XCAA 4GFJA 2EAPA 2YTUA 4F4YA 5ALTA 5AKJA 9ICWA 2EAOA 4QWBA 1N2XA 1N5XA 3GU3A 5EWFA 2P66A 4Q43A 2OHFA 1RQNA 5AM2A 3E2EA 4P4OA 5ALKA 4R64A 1TK8A 4CGZA 3Q8PB 4ECWA 2ZTEA 3PX0A 1QSSA 2VIXA 2M0NA 1JI7A 5AIAA
chains in the Genus database with same CATH topology
2VJ4A 2KICA 2Y0SC 1YT3A 3AQEA 1TAMA 4ICAA 2CRXA 4BJQA 2ZXIA 3LVWA 2JH1A 5C0YA 2K4IA 2LBOA 4IC9A 3CYMA 2ZIWA 2JH7A 2KHVA 3GZFA 1D8BA 1SZHA 2WB1C 3CP8A 3OPXA 3CRXA 2Q4TA 3PSTA 2W03A 2XICA 3F2BA 1P7DA 2BDUA 3F5EA 3AQFA 2G06A 4NV0A 2W7PA 1Z19A 1URJA 2ZIXB 1A0PA 2XVTA 2YB1A 4KX5A 2Y0SF 4C0ZA 2RP5A 2ZXHA 3N7PD 2XIDA 1ED1A 5T14A 2LHTA 3MGVA 1F44A 4NWIA 3AL0B 2JGAA 3T79A 2CPRA 2YX8A 1PVPA 4P0PA 2H3VA 5CRXA 1KBUA 4BX9C 2G09A 2KD1A 2OYYA 2JHDA 2KIWA 2WB1F 2KHQA 3PSIA 2K8AA 1WUDA 2K8BB 3H0RB 4CDGA 1L6NA 2KJ8A 3H0MB 3O0FA 2KV2A 2ZIUA 2HBLA 2MA1A 2HBJA 2HBKA 2KJ9A 3PSFA 1XO0A 4CRXA 3E0FA 1PVRA 2CN1A 2K8CB 2K89A 2KJ5A 2LYBA 1XNSA 1Q3VA 2ZIVA 2KOBA 2W04A 4KX3A 4OJPA 1IIPA 4OJOA 4PL1A 3SAHA 2ZIWB 2OXOA 2N1RA 4PL2A 2H3ZA 2E1EA 4JMUA 2G5HB 3LVVA 3F2DA 2LKYA 1MA7A 2WAQF 4BUGA 3SAGA 4OO1J 1Z1BA 2HOIA 3D2SA 4OJLA 2HOFA 1UPHA 3F2CA 3D2NA 3PZPA 2G5IB 3M6ZA 4U6PA 4AYBF 4FZLA 3M6KA 2H3FA 2PMZF 2HMXA 4A8EA 3PSPA 2DGZA 3N7SC 4QIWC 2WAQC 4U7CA 2XI9A 3IN5A 3LYSA 3KZXA 2E1FA 2KVCA 2F77X 2KKVA 2VJ5A 2ZIXA 4AYBC 3C28A 2VKQA 3C29A 4P0QB 4KMOB 2G0AA 3RFAA 2PMZC 4FE3A 3DEEA 2H3QA 4OJ6A 2DF4B 2KKPA 3F5AA 5KL1B 2E5SA 2KEYA 2F8LA 4NLCA 2ZIVB 4GFJA 2NV3A 2R18A 3HKZF 3KFUF 4WJ3B 1CRXA 1ZQ1C 1OUQA 3SMVA 1Q3UA 2RRDA 3VC8A 1NZBA 1GO3F 3K1ZA 4FZMA 3IG8A 4QIWF 5A0LA 2GOLA 2YB4A 4OJ5A 3SAFA 2ZG6A 4ACOA 2Z7JA 3H0LB 2OH2A 3RF9A 3VCBA 3GU3A 1T94A 3HKZC 4FZNA 3IP4B 4NLBA 3ONNA 4P0PB 2LYAA 3ALRA 3NRWA 2KNJA 1HEKA 5HR7A 2JMGA 3L3FX 2HOQA 2F76X 3M7DA 5KL8B 2GH1A 3SQIA 4QJFB 4P0QA 2K4EA 1HIWA 3D2QA 3IG5A 2MRLA 4QNLA 3NUQA 2ZIUB 2W7OA 2A3VA 2G08A 4CGZA 2G07A 2OM6A 2DQNB 3F53A 1DRGA 2K4HA 2VIXA 1PVQA 3N7RC 2F2AB 1ECWA 2HBMA 3ICXA 4O3MA 2M0NA 2D6FC 1A6SA 2RHFA 5HR6A 2H3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KD1 A;  4ACO A;  2KIW A;  2KHQ A;  2CRX A;  2KJ8 A;  3NRW A;  4A8E A;  3LYS A;  2KJ9 A;  1XO0 A;  4CRX A;  2KHV A;  3C28 A;  1PVR A;  2KKV A;  2KJ5 A;  3C29 A;  1XNS A;  1Q3V A;  3CRX A;  2KOB A;  2A3V A;  1P7D A;  2OXO A;  2KKP A;  1DRG A;  1Z19 A;  2KEY A;  1A0P A;  1PVQ A;  1CRX A;  3MGV A;  1OUQ A;  1Q3U A;  1F44 A;  1MA7 A;  1NZB A;  1PVP A;  1Z1B A;  2HOI A;  2HOF A;  5CRX A;  1KBU A; 
#chains in the Genus database with same CATH topology
 5KG1 A;  2R8G A;  4RPX A;  8ICN A;  3B0Y A;  2JH1 A;  3TKA A;  9ICI A;  3CP8 A;  3CRX A;  3RJH A;  4CF3 A;  4TUS A;  2JZB B;  3PO4 A;  2W7P A;  2ZIX B;  4ED8 A;  2P35 A;  2XID A;  2YX8 A;  3MFI A;  2NRT A;  3TAD C;  3MR2 A;  5J0Q A;  2WB1 F;  5J2A A;  4JV0 A;  1XU4 A;  2C2R A;  2LMR A;  5J2C A;  4ECZ A;  1XSN A;  1Q3V A;  2R8I A;  2W3R A;  3AM9 A;  4AP9 A;  5E79 U;  4DFK A;  4F8R A;  8ICK A;  4FZL A;  1T7P A;  4ZOH C;  1C7Y A;  3N7S C;  2RQ5 A;  4C4R A;  2WF9 A;  2BQU A;  4UB2 A;  4NXZ A;  9ICM A;  5KFC A;  1A76 A;  2KIV A;  3V72 A;  1KFT A;  2XO7 A;  5AK5 A;  3NVY A;  2YMQ A;  2F8L A;  3MDC A;  1L3U A;  8ICT A;  9ICP A;  9ICG A;  4DFD A;  1ZD2 P;  5KG5 A;  4EBD A;  3PW4 A;  3KZI U;  3IG8 A;  3HP6 A;  4M2Y A;  2OH2 A;  1BNO A;  1T94 A;  4RT3 A;  3MC1 A;  4F93 B;  3IP4 B;  4DL6 A;  4KLL A;  4O5C A;  9ICU A;  3OSN A;  1B22 A;  2MRL A;  2ZIU B;  4YMM A;  3H40 A;  1FIQ A;  2NO5 A;  4F91 B;  2FJ6 A;  3SI8 A;  4CNQ A;  5AK3 A;  1S77 D;  5HR6 A;  3RBD A;  2BKE A;  2VA8 A;  1ZQK A;  2RLT A;  4PHP A;  3OJU A;  2BHN A;  3MR6 A;  3QU7 A;  5AKX A;  2NRW A;  2E8N A;  4UAZ A;  3JPT A;  2BZF A;  4EZ6 A;  2OEH A;  2HVI A;  9ICC A;  3OPX A;  3TQ1 A;  2XIC A;  1QQ6 A;  5CR0 A;  5HP4 A;  5DLG A;  1DGS A;  2RP5 A;  4M0A A;  3N7P D;  3QUB A;  3RB3 A;  4NWI A;  4RQ7 A;  3QEB Z;  4GLX A;  2G09 A;  3TAC B;  2PFQ A;  3RJI A;  3KKA C;  1WUD A;  1NJX A;  3O0F A;  4BDP A;  8ICO A;  2KJ9 A;  3PO5 A;  5DDY A;  3QXG A;  3V7J A;  4YMO A;  3QX7 A;  2C2D A;  2E1E A;  2G5H B;  3C1Z A;  3RR7 A;  1OW5 A;  2MUT A;  4I2D A;  1Z1B A;  2XGP A;  1LVH A;  5J0Y A;  2G5I B;  3WK4 A;  3TI0 A;  8ICL A;  5DBC A;  1KFS A;  5J2B A;  3PML A;  5AI8 A;  4QIW C;  3BQ7 A;  5KFZ A;  3V6K A;  4ELU A;  2E1F A;  2KVC A;  2VJ5 A;  4YXJ A;  5KFX A;  1L7P A;  5D49 A;  4FE3 A;  1UCV A;  2OCE A;  2DF4 B;  1ZQF A;  2R18 A;  3KFU F;  3ED5 A;  2EAN A;  1OUQ A;  4LJX A;  4RQ5 A;  3OHA A;  3SAF A;  3AN1 A;  1D8Y A;  2EH9 A;  4UAW A;  3HKZ C;  4FZN A;  4DL5 A;  4Q8E A;  3M9O B;  4F71 A;  2IOH A;  3IG5 A;  5J2D A;  9ICL A;  3EPI A;  3N7R C;  4UBC A;  1X9M A;  1WG8 A;  2QB1 A;  4QZH A;  1WWU A;  4DSF A;  2KTQ A;  1ZQY A;  1ZQB A;  4IRC A;  3MR3 A;  1VLB A;  3WKC A;  3WK8 A;  2H5X A;  1TAQ A;  3H8M A;  4FO6 A;  2Q4T A;  1PUZ A;  3KHG A;  2YB1 A;  1L3V A;  3H8J A;  1ED1 A;  3QNM A;  2FI1 A;  3AL0 B;  3T79 A;  1KBU A;  1KRP A;  1SL0 A;  1RQL A;  3AMZ A;  4K4I A;  2KJ8 A;  3BS7 A;  4ECS A;  2K60 A;  2EQY A;  2HBJ A;  3RJF A;  5DBB A;  3ETR A;  2ESE A;  4ELV A;  3SV4 A;  2D3D A;  4PL1 A;  3Q8M A;  5EE9 A;  2FPL A;  1N60 A;  1ZQI A;  1NOM A;  4JMU A;  3LWM A;  3LVV A;  4BUG A;  2JEJ A;  1UA1 A;  4DQI A;  3SEN A;  1LV5 A;  9ICH A;  4NLG A;  1X9S A;  3K1R B;  3SYZ A;  4Y2U A;  2OWO A;  4R63 A;  3KZX A;  3MAB A;  2C22 A;  1V97 A;  1IV8 A;  4B9V A;  4QZB A;  5IIM A;  1BGX T;  2G0A A;  3RFA A;  8ICI A;  2ZTC A;  7ICU A;  2E5S A;  3HKZ F;  5B66 U;  3GDX A;  3KD3 A;  4UB1 A;  3OTQ A;  1GO3 F;  3GIL A;  5ALX A;  5ALS A;  2EZX A;  4RPZ A;  5KFF A;  1VDV A;  3NRW A;  4UB8 U;  3PY8 A;  1SXD A;  4M04 A;  3RTV A;  5CEH A;  1NZP A;  3F53 A;  1DRG A;  5KFN A;  4DF4 A;  5ALG A;  3BJY A;  3UQ2 A;  5ALH A;  5HNK A;  2GO7 A;  4Q8F A;  4KLF A;  5L1J A;  2W43 A;  3ZDD A;  2R8H A;  5KG7 A;  3C5F A;  7ICH A;  4DSE A;  1TFR A;  1OXJ A;  2K4I A;  3CW2 C;  3DV9 A;  4RQ2 A;  2FMP A;  1T8E A;  3UM9 A;  3AQF A;  2P6R A;  3UPQ A;  2BR0 A;  4P4P A;  4RUA A;  4J9P A;  2MSN A;  4C0Z A;  1MQ2 A;  1T3Q A;  1N61 A;  3D6J A;  2A1J A;  1BPB A;  5KFV A;  3SR6 A;  4R8U B;  2H3V A;  4I27 A;  5AM3 A;  2JHD A;  3PSI A;  2KHQ A;  5J2K A;  3ISB A;  4ED1 A;  5KFM A;  9ICA A;  4F3O A;  3QZ7 A;  4ED6 A;  4PZO A;  3QUT A;  2KOB A;  1ZQO A;  4KLS A;  9ICX A;  1X9W A;  4GIB A;  4JWN A;  1KL9 A;  4F4Z A;  4YD1 A;  4PHE A;  5EWE A;  3F2D A;  5J0S A;  4MFC A;  5JRT A;  3SAG A;  4K4H A;  2AQ0 A;  2I5H A;  4EEK A;  2BGW A;  3F2C A;  4IQU A;  1NK7 A;  3ZI4 A;  2J6U A;  4E0D A;  3BQ1 A;  4I2C A;  5ALU A;  3RB0 A;  1HJP A;  2PFP A;  4RQN A;  4CF4 A;  3HT3 A;  1S10 A;  3FAH A;  3C2M A;  4UAT A;  5KL1 B;  2HHV A;  3NTU A;  2HHS A;  2W8L A;  1TKD A;  4Y2J A;  5DBA A;  2WF7 A;  1NK9 A;  3RR8 A;  2DFL A;  1S5L U;  2ZTD A;  4M9G A;  2MUT B;  1HUZ A;  2F1I A;  4RZR A;  4DF8 A;  1SWV A;  3SQI A;  2UVR A;  4QZG A;  4F72 A;  2K4E A;  5CA7 A;  5DB9 A;  4QNL A;  4LVS A;  3RJK A;  2W7O A;  4QZI A;  4KTQ A;  4DL7 A;  1SKS A;  2ZUD A;  1ZQC A;  3M9N B;  3T5K A;  4DFJ A;  1KLN A;  5KT6 A;  5AKL A;  4JV1 A;  7ICQ A;  3C23 A;  5DLF A;  3PR5 B;  2CRX A;  4J9N A;  4FBU A;  4YMN A;  4CE6 A;  4GC7 A;  3TFS A;  5FP0 A;  4R65 A;  5KFH A;  1TAU A;  4C80 A;  4YG2 A;  4XQ8 A;  2LM4 A;  1Q46 A;  5DGB A;  4KLT A;  4F5O A;  3J81 j;  4ED2 A;  1KFD A;  3L4P A;  4F5N A;  4UQG A;  2KFZ A;  1ZRM A;  4M9L A;  3QUQ A;  1UA0 A;  5BOM A;  4QW9 A;  1ZD3 A;  2LYB A;  4KIT B;  2W04 A;  5HML A;  3PW5 A;  2OXO A;  4KLU A;  5KFY A;  5J0P A;  5CWR A;  4X5V A;  2AHO B;  5KFK A;  1RYR A;  5AKH A;  4JB3 A;  1C20 A;  4OJL A;  5KNI A;  1KSP A;  1UPH A;  7ICE A;  2MU2 A;  1TK5 A;  1F0M A;  3SZ2 A;  3RH5 A;  5EE1 A;  1KQQ A;  3OSP A;  3B0X A;  4O5E A;  2DGZ A;  2WAQ C;  4J9Q A;  1BPE A;  1ZQS A;  2VKQ A;  4HYK A;  2BCV A;  1NK6 A;  2H3Q A;  4UAR A;  2ALZ A;  2WF8 A;  3KOO A;  4OJ5 A;  4RQ0 A;  5JUM A;  4I2I A;  3RF9 A;  3SD7 A;  2KN7 A;  1SV4 A;  5AKG A;  2K4P A;  1JXE A;  2I1Q A;  4J9K A;  2A3V A;  3R9K A;  2G08 A;  1U4B A;  5AK4 A;  1FEZ A;  3T5H A;  1KKX A;  4O3M A;  4I2G A;  2PKE A;  3T5J A;  2B21 A;  2Y0S C;  5KFA A;  2FLN A;  2WFA A;  5AK6 A;  4QWC A;  1RDF A;  3TAQ A;  3UXN A;  2CXY A;  2VA3 A;  4F5P A;  2BQR A;  4B6J A;  1Z19 A;  4KX5 A;  4Y2X A;  4UAU A;  4CF5 A;  3MGV A;  9ICJ A;  3DDH A;  4P0P A;  4DQR A;  3GQC A;  5IIJ A;  4RT2 A;  7ICR A;  1U45 A;  1FO4 A;  4DL2 A;  3V6H A;  1ZET A;  1SV0 A;  2K89 A;  3M8R A;  3EPG A;  4ED0 A;  1YZ7 A;  1JN3 A;  2EAM A;  3SAH A;  2B6G A;  3LWL A;  4PL2 A;  4RQM A;  1RXV A;  4NJ8 A;  3N4M B;  1ZQR A;  3V6J A;  2WAQ F;  5DG9 A;  5IIK A;  3ETL A;  4LZG A;  4BGD A;  1XC9 A;  5KAI U;  4Y2S A;  2ATL A;  1BVS A;  4KMO B;  5AI0 A;  1Z00 A;  3HW8 A;  2D8C A;  4RU9 A;  5AKY A;  2V4R A;  1NZB A;  2LPE A;  3K1Z A;  5AKI A;  3WK6 A;  2GOL A;  1TK0 A;  3TFR A;  4I2H A;  3IV6 A;  2ZG6 A;  3H0L B;  4GXJ A;  1QQ5 A;  9ICQ A;  3MGI A;  2ES6 A;  2F44 A;  3L3F X;  5KG2 A;  3ORY A;  3B9J A;  4F5Q A;  5DDM A;  1SWW A;  2IHN A;  4J03 A;  4Z6E A;  5AKK A;  5ALR A;  5KFD A;  4KLJ A;  2L5Y A;  2QAR B;  3IM1 A;  3SV3 A;  3UMB A;  4QWA A;  2D6F C;  1SGG A;  4DSJ A;  3EZ5 A;  7ICI A;  4I2J A;  9ICN A;  2AGP A;  7ICM A;  4IQV A;  4Z6F A;  3AQE A;  7ICG A;  1TAM A;  1L7O A;  2HSZ A;  1D9F A;  3BQ2 A;  4JWM A;  4O3S A;  2LBO A;  3CYM A;  2JH7 A;  3ZDB A;  4O3O A;  3KTQ A;  4FBT A;  2KK0 A;  3H8S A;  2NO4 A;  4Z6C A;  4ZH4 A;  4KLH A;  2BDU A;  3JPN A;  2QLT A;  5T14 A;  1KEJ A;  4J9M A;  1PVP A;  1L8O A;  3C1Y A;  4YR2 A;  2PI5 A;  4F5R A;  2OYY A;  3H4B A;  4I2A A;  2NRX A;  5JU5 A;  2KV2 A;  4PJ0 U;  4FS2 A;  1VJ5 A;  1ZD4 A;  4PPX A;  4EZ9 A;  1U49 A;  2UVU A;  1N5W A;  2Y9U A;  4R66 A;  1MSW D;  5J2J A;  3JPP A;  3QU4 A;  4MEX A;  3HJE A;  4DOC A;  3PW0 A;  4QWE A;  3M6Z A;  2DBY A;  5ALF A;  8ICX A;  3M6K A;  9ICV A;  1ZQL A;  5DG8 A;  4A8E A;  4PZN A;  2GWS A;  3ZDC A;  3QU9 A;  4DSK A;  3WKA A;  1K1S A;  2F77 X;  3C29 A;  5GTH U;  3NRZ A;  1WCL A;  5KFG A;  1CEZ A;  4WJ3 B;  5HMM A;  5KFI A;  3QU5 A;  3JPS A;  2Z7J A;  2WTF A;  3VCB A;  1UT5 A;  5J29 A;  3BS5 A;  3ISD A;  4KLO A;  5KT5 A;  8ICF A;  1HEK A;  2AGO A;  4EEN A;  2JMG A;  1NJY A;  3Q8Q B;  2ZUC A;  4I2B A;  4YN4 A;  4ECX A;  8ICM A;  2DQN B;  3AUO A;  1MN8 A;  4O3N A;  2RDI A;  4PGQ A;  2BQ3 A;  2BPF A;  4P2H A;  3H7I A;  5DKW A;  2ISP A;  3OGU A;  1XSL A;  2W9C A;  4F92 B;  4OCZ A;  1QQ7 A;  2W9B A;  2IHM A;  2ZIW A;  2G06 A;  1QSL A;  5L1K A;  3RJE A;  4KLI A;  1WYG A;  1J97 A;  4DFP A;  1COK A;  3G6X A;  2KD1 A;  4GXK A;  4M6W A;  5KFR A;  4NLN A;  5K4L A;  4I28 A;  5ALO A;  1KDH A;  2K8C B;  1XNS A;  1NKB A;  2BCR A;  4DO9 A;  4GXI A;  4QWD A;  4TUQ A;  3ZDA A;  5ALD A;  2LKY A;  4KN7 A;  1ZQD A;  4KLD A;  3RH6 A;  5J2H A;  4I29 A;  3DEE A;  7ICT A;  2KKP A;  4F2R A;  2PI4 A;  3G6Y A;  3KKA A;  2YN4 A;  3IRU A;  4FZM A;  4QIW F;  1S8O A;  1Z4N A;  3EYZ A;  4EBE A;  3GV5 B;  2ZUB A;  1DXS A;  2LM1 A;  1J2N A;  4DL4 A;  2XY5 A;  1RYS A;  4P0Q A;  4RPY A;  3D2Q A;  3PW7 A;  8ICQ A;  1NKE A;  4J9S A;  4ELT A;  4M47 A;  3C5G A;  3QUC A;  4Q44 A;  2YY6 A;  1Z00 B;  3MBY A;  2KZZ A;  1ZQQ A;  4QW8 A;  2E8M A;  1S0N A;  4M9H A;  4ECV A;  1J2M A;  4RQ6 A;  4C8O A;  3PV8 A;  4B9L A;  1TVA A;  5C0Y A;  1COO A;  1U48 A;  1RM6 C;  2YMP A;  4IS7 A;  5KFL A;  3KHH A;  3UMG A;  1ZQV A;  1L5U A;  1XO1 A;  1URJ A;  3N28 A;  3Q8S B;  2LHT A;  2CPR A;  2DKZ A;  4BX9 C;  1JRP A;  5JTI A;  3FDS A;  3H0R B;  4OD0 A;  1SZP A;  3QU2 A;  3QE9 Y;  5AM1 A;  5F9N A;  1NK8 A;  1V85 A;  5CB1 A;  5DGA A;  2IOF A;  3SEI A;  2HW3 A;  4M9N A;  3RH4 A;  1SXE A;  3PX4 A;  7ICP A;  5IIN A;  1NKC A;  4USA A;  1X2I A;  1UT8 A;  2Y1I A;  4QZ8 A;  3WU2 U;  4KMU A;  3GIK A;  4MFF A;  5J2I A;  4UB3 A;  5IIL A;  2BPC A;  5CHG A;  5KT4 A;  4IRD A;  2JZB A;  1EXN A;  4B9T A;  4IR1 A;  2XI9 A;  3IN5 A;  2FMQ A;  4DWI A;  2ZIX A;  2W55 A;  4UAY A;  1N48 A;  3ZDE A;  3U26 A;  1S0O A;  5G5G A;  5J8Y C;  7ICV A;  2I9G A;  3KBB A;  3VC8 A;  5KT2 A;  8ICA A;  4RQ3 A;  4RQ1 A;  3OHB A;  5AIC A;  4ED3 A;  5KFJ A;  3ALR A;  1M6Y A;  5KT7 A;  5J2E A;  1LB2 B;  2F76 X;  5KL8 B;  7ICO A;  4NL9 A;  5AHX A;  1JXL A;  2HBM A;  3ICX A;  2XCP A;  3HIL A;  4YVZ A;  1S97 A;  4NM1 A;  2IOF K;  1ZD5 A;  1ZQJ A;  2FLP A;  4IR9 A;  1S0M A;  5KG4 A;  3Q8L A;  3LVW A;  4DSL A;  1SKR A;  8ICB A;  3BS5 B;  1SZH A;  1ZQT A;  4KLM A;  1D8L A;  1XWL A;  3PST A;  3LDA A;  9ICO A;  1UHU A;  5DB7 A;  2XVT A;  1MQ3 A;  2BCQ A;  4IQT A;  2LYH A;  2ZJ8 A;  5KT3 A;  2K8A A;  2W9A A;  2K8B B;  4J9L A;  4KLG A;  2ZIU A;  5J0X A;  2EZY A;  1RPL A;  2HBL A;  3NS1 A;  5J0U A;  2W8K A;  4EYI B;  2ASJ A;  1ZRN A;  1PVR A;  8ICH A;  3I28 A;  5ALZ A;  4MF8 A;  2W9C B;  1ZQP A;  4I2F A;  2W9B B;  2ZIW B;  4DQP A;  4C4S A;  2F8K A;  4B9U A;  4NM2 A;  4BWJ A;  1QTM A;  2E8P A;  2KG5 A;  1DK2 A;  1ZXI A;  3FYH A;  4YR3 A;  5AM4 A;  4C8K A;  1H38 A;  2KP7 A;  1X42 A;  2W3S A;  4RUC A;  2HMX A;  2M9N A;  4FFD A;  2A19 A;  4M6W B;  5F3X B;  4MEY A;  7ICJ A;  3GII A;  1AQ6 A;  2DUY A;  5ALJ A;  5ALN A;  4Y2T A;  1X66 A;  1SV0 C;  4J9R A;  3V7L A;  5BOL A;  4UW9 A;  4DS5 A;  3SMV A;  3EW9 A;  5AM0 A;  2YB4 A;  2F1H A;  4ACO A;  2AGQ A;  4F4X A;  1NJZ A;  4RNN A;  1KTQ A;  3AU2 A;  1ZQM A;  1BPY A;  3FC4 A;  1L3S A;  4PHA A;  2AU0 A;  3NUQ A;  3MFH A;  2G07 A;  4QZ9 A;  1S9F A;  5EWG A;  3BZK A;  4PGY A;  2ASL A;  3GIM A;  2PFO A;  3RB4 A;  1ARO P;  3Q8R B;  1K5O A;  1FFV A;  4TQS A;  2KIC A;  5BPC A;  4DS4 A;  2J6T A;  1QCK A;  4ECU A;  4ICA A;  4IRK A;  1O03 A;  1WCN A;  3RJG A;  2HCF A;  2NYV A;  2WB1 C;  4YD2 A;  1L3T A;  5ALL A;  3RAX A;  1ZQG A;  2Q0Z X;  2R8K A;  4F2S A;  4P0Q B;  1A0P A;  5EE3 A;  4DQQ A;  2AH5 A;  2FE9 A;  2ZXH A;  3WKE A;  1RXW A;  2JGA A;  2YMM A;  2KSO A;  4O3Q A;  2J6S A;  3WKB A;  3T5L A;  3PSF A;  3N97 B;  3TAR A;  1T4G A;  5ALQ A;  3QZ8 A;  3QEA Z;  2KJ5 A;  1U47 A;  3KHL A;  2HHX A;  3BZC A;  1XSP A;  2N1R A;  2KZM A;  4ECR A;  2LI6 A;  1NI3 A;  2PFN A;  3S6J A;  3PZP A;  1L8L A;  2DKX A;  2WF5 A;  3PMN A;  4DQS A;  7ICS A;  2H3F A;  4YXM A;  1JIH A;  5AI5 A;  1SIJ A;  4EEL A;  4AYB C;  4MHV A;  2EDU A;  3OJS A;  7ICN A;  1BNP A;  3F5A A;  4PGX A;  5ALY A;  5ALM A;  1UQV A;  5A0L A;  2JEI A;  2IMW P;  3GIJ A;  5KFQ A;  2A1J B;  4RQ8 A;  5DB8 A;  4G9B A;  5EE0 A;  5DB6 A;  2V4Q A;  1S76 D;  5D4B A;  2XC9 A;  2PXI A;  3NVV A;  2JXJ A;  4EX6 A;  2A1A A;  9ICB A;  3C2K A;  5TZV A;  5ALE A;  2VAN A;  2XY7 A;  1Z3E B;  5J2F A;  5L1M A;  4BJQ A;  2P6U A;  4YFK A;  2FLL A;  2JRZ A;  1D8B A;  1PK1 A;  5HHH A;  2Y9T A;  3F5E A;  2C2E A;  2Y0S F;  2JR5 A;  5CRX A;  8ICJ A;  3UMC A;  1SKW A;  5HHI A;  1X9X A;  5KFT A;  1RYU A;  2HBK A;  1TE2 A;  2V9W A;  4OJO A;  3Q8K A;  4EX7 A;  2H3Z A;  3A0B U;  4NLK A;  5TIS U;  8ICP A;  2ASD A;  4DEZ A;  1MA7 A;  1O08 A;  9ICT A;  4JV2 A;  2RDJ A;  1LKY A;  5D46 A;  1BPZ A;  4AYB F;  4RNO A;  2IBK A;  3GFK B;  2HI0 A;  3WK5 A;  3PR4 A;  3PW2 A;  2BDP A;  4PH5 A;  1CUK A;  4Y2P A;  4C7Z A;  1JRO A;  5KFB A;  5KTQ A;  4PHD A;  1ZQZ A;  2AJQ A;  4OJ6 A;  4UBB A;  1NJW A;  2I6X A;  5C5J A;  4DOB A;  4R8U A;  1ZOL A;  2ISO A;  3FM9 A;  3H4D A;  3KHR A;  9ICS A;  5F9L A;  3MDA A;  8ICZ A;  2JEG A;  2JEF A;  1JMS A;  1D9D A;  4BXO A;  1RG6 A;  4QJF B;  1HIW A;  4Z6D A;  1L7N A;  2K4H A;  4EBC A;  3TAP A;  8ICY A;  3TAD A;  1B4F A;  2WHE A;  3AU6 A;  2O6K A;  2NRV A;  1IXR A;  3WKD A;  2EZZ A;  2FPK A;  1K1Q A;  3GV8 B;  4QZF A;  1DOQ A;  3L5K A;  5AKE A;  2KHV A;  4KN4 A;  8ICE A;  5AI4 A;  1SB3 C;  4NV0 A;  1N62 A;  1QSY A;  4DL3 A;  1V9P A;  1KW4 A;  4NY8 A;  8ICW A;  4DLE A;  4YCX A;  1Y88 A;  4DFM A;  1S0V A;  1X6I A;  4DLG A;  1ZQA A;  2ZIV A;  4OJP A;  1ZJM A;  3H8W A;  1PK3 A;  4K4G A;  4LZD A;  4Y2R A;  4O3P A;  2KZ3 A;  2W54 A;  4TQR A;  1SL2 A;  2BCS A;  4C8N A;  5DQG A;  7ICF A;  9ICR A;  2WF6 A;  2ZJ5 A;  3K4G A;  1U9L A;  4O9M A;  2KSO B;  1Z1V A;  1V38 A;  3NVZ A;  4US9 A;  4UAV A;  1IM4 A;  4KLE A;  2KE7 A;  1ZQE A;  2XGQ A;  5L1I A;  4Y2Q A;  2ZJA A;  3ZD8 A;  5KFS A;  5III A;  2RRD A;  3T3F A;  4GC6 A;  3I1Y A;  4KLQ A;  4P0P B;  2LYA A;  5HR7 A;  1NK5 A;  2AXT U;  2HOQ A;  3HWT A;  2GH1 A;  5J0W A;  5H2F U;  3TAN A;  1BPD A;  1SL1 A;  2OM6 A;  5AKZ A;  5ALP A;  4C7Y A;  1TV9 A;  3I76 A;  4O0I A;  1A6S A;  1ZQH A;  2RHF A;  3PX6 A;  4G3I A;  4O5K A;  4IL6 U;  1YT3 A;  2HDO A;  2ZXI A;  3AEV A;  3K75 D;  3GZF A;  8ICC A;  5KAF U;  2JV3 A;  8ICG A;  5AI6 A;  1P7D A;  5KFU A;  4NL9 C;  3C2L A;  3E58 A;  5KFP A;  4F4K A;  4XA5 A;  4ECQ A;  1F44 A;  3RB6 A;  3C21 A;  4B9S A;  4TUP A;  3GV7 B;  1NK4 A;  2BCU A;  5L1L A;  3RBE A;  1XS9 D;  2KIW A;  1L6N A;  3ZD9 A;  4FS1 A;  3H0M B;  3NAS A;  4MF2 A;  9ICK A;  4P4M A;  3EWA A;  2QB0 A;  2CN1 A;  3UQ0 A;  9ICE A;  1PK1 B;  3THV A;  3M8S A;  2MAX A;  4C8M A;  2UVW A;  9ICF A;  5J0T A;  2NRZ A;  3D2S A;  2HOF A;  4U6P A;  2IA6 A;  5ALV A;  4QZE A;  4B9M A;  3HPO A;  5B5E U;  4I2E A;  1ZQX A;  3LYS A;  4ECT A;  2KKV A;  4TUR A;  4DCC A;  4J9O A;  1B0X A;  4UB4 A;  2PMZ C;  3RRG A;  4C8L A;  1DGJ A;  1PZN A;  2F1J A;  4NLZ A;  4BWM A;  1CRX A;  5DQH A;  1ZQ1 C;  5J0O A;  4UB5 A;  1Q3U A;  2E8O A;  3MR5 A;  4XUS A;  4UAS A;  2C28 A;  2KVS A;  3RRH A;  8ICS A;  4B9N A;  1LKY B;  5CP2 A;  4EYH B;  4ECY A;  4MFA A;  1T3N A;  2KFN A;  1KN5 A;  1HUO A;  5AM5 A;  2BPG A;  3BQT A;  1PVQ A;  2B0C A;  2F2A B;  2XY6 A;  1WWV A;  1ZYQ A;  2H3I A;  5G5H A;  2VJ4 A;  4QZC A;  1QLN A;  5AI9 A;  3M9M B;  3CNH A;  4F4W A;  5CJ7 A;  8ICR A;  1Q8K A;  4BXO B;  4CCH A;  2HHW A;  2DPJ A;  4IQW A;  3JPR A;  4DOA A;  7ICL A;  1Z4O A;  1N56 A;  3MGH A;  3BQ0 A;  4CDG A;  3PVX A;  2MA1 A;  2HVH A;  4CRX A;  3E0F A;  4C4T A;  5EOZ A;  2F3N A;  2QAR A;  1L7M A;  4KX3 A;  3JPQ A;  1IIP A;  4F50 A;  4EEY A;  3WK7 A;  3HX0 A;  1ZQW A;  2FPM A;  4OO1 J;  2HOI A;  3ISC A;  4ED7 A;  1X6J A;  2PMZ F;  5IIO A;  4U7C A;  4YP3 A;  3C28 A;  2DL0 A;  3WK9 A;  4HAI A;  1BPX A;  4XRH A;  1NNL A;  2W11 A;  2ZIV B;  2NV3 A;  3UXP A;  4O3R A;  1JX4 A;  3NGD A;  2R8J A;  2HHQ A;  4NLB A;  2W9M A;  3ONN A;  5KG0 A;  3RAQ A;  2KNJ A;  7ICK A;  8ICV A;  3M7D A;  4Y2V A;  3UXO A;  5J0R A;  1CI4 A;  4QZD A;  1ZQN A;  4JK1 A;  4JUZ A;  5KG6 A;  2KMD A;  4M9J A;  1FFU A;  2VA2 A;  3BDP A;  1ECW A;  1A77 A;  1X40 A;  4UB6 U;  4RQ4 A;  3NVW A;  2YQE A;  4YQW A;  1N63 A;  4Y2Y A;  2DPI A;  1B43 A;  1JUD A;  1DK3 A;  2DWQ A;  4QZA A;  4IC9 A;  3RJJ A;  2AQ4 A;  1NK0 A;  5J8Y A;  2YML A;  2W03 A;  3F2B A;  3QYP A;  5KFW A;  2HHT A;  4US8 A;  1F5S A;  5GTI U;  2FMS A;  4YR0 A;  5ALW A;  3V7K A;  3IDW A;  3G6V A;  3LK9 A;  1RZT A;  8ICU A;  5KG3 A;  1XO0 A;  1JAL A;  1MC8 A;  5AIB A;  3EUB 2;  5KFE A;  2GLE A;  2ODG A;  3JPO A;  1ZQU A;  3A0H U;  5ALI A;  2UVV A;  3D2N A;  5KFO A;  3M1Y A;  4Q45 A;  2Y1J A;  2HHU A;  4RNM A;  1QH9 A;  2E3T A;  3PSP A;  3PNC A;  2QKQ A;  5DQI A;  3HRD D;  4DSI A;  1IG6 A;  1YZ6 A;  1ZJN A;  3IHQ B;  2QB0 B;  5L9X A;  5DG7 A;  5J2G A;  2FDR A;  2KEY A;  4NLC A;  2XCA A;  4GFJ A;  2EAP A;  2YTU A;  4F4Y A;  5ALT A;  5AKJ A;  9ICW A;  2EAO A;  4QWB A;  1N2X A;  1N5X A;  3GU3 A;  5EWF A;  2P66 A;  4Q43 A;  2OHF A;  1RQN A;  5AM2 A;  3E2E A;  4P4O A;  5ALK A;  4R64 A;  1TK8 A;  4CGZ A;  3Q8P B;  4ECW A;  2ZTE A;  3PX0 A;  1QSS A;  2VIX A;  2M0N A;  1JI7 A;  5AIA A; 
#chains in the Genus database with same CATH homology
 2VJ4 A;  2KIC A;  2Y0S C;  1YT3 A;  3AQE A;  1TAM A;  4ICA A;  2CRX A;  4BJQ A;  2ZXI A;  3LVW A;  2JH1 A;  5C0Y A;  2K4I A;  2LBO A;  4IC9 A;  3CYM A;  2ZIW A;  2JH7 A;  2KHV A;  3GZF A;  1D8B A;  1SZH A;  2WB1 C;  3CP8 A;  3OPX A;  3CRX A;  2Q4T A;  3PST A;  2W03 A;  2XIC A;  3F2B A;  1P7D A;  2BDU A;  3F5E A;  3AQF A;  2G06 A;  4NV0 A;  2W7P A;  1Z19 A;  1URJ A;  2ZIX B;  1A0P A;  2XVT A;  2YB1 A;  4KX5 A;  2Y0S F;  4C0Z A;  2RP5 A;  2ZXH A;  3N7P D;  2XID A;  1ED1 A;  5T14 A;  2LHT A;  3MGV A;  1F44 A;  4NWI A;  3AL0 B;  2JGA A;  3T79 A;  2CPR A;  2YX8 A;  1PVP A;  4P0P A;  2H3V A;  5CRX A;  1KBU A;  4BX9 C;  2G09 A;  2KD1 A;  2OYY A;  2JHD A;  2KIW A;  2WB1 F;  2KHQ A;  3PSI A;  2K8A A;  1WUD A;  2K8B B;  3H0R B;  4CDG A;  1L6N A;  2KJ8 A;  3H0M B;  3O0F A;  2KV2 A;  2ZIU A;  2HBL A;  2MA1 A;  2HBJ A;  2HBK A;  2KJ9 A;  3PSF A;  1XO0 A;  4CRX A;  3E0F A;  1PVR A;  2CN1 A;  2K8C B;  2K89 A;  2KJ5 A;  2LYB A;  1XNS A;  1Q3V A;  2ZIV A;  2KOB A;  2W04 A;  4KX3 A;  4OJP A;  1IIP A;  4OJO A;  4PL1 A;  3SAH A;  2ZIW B;  2OXO A;  2N1R A;  4PL2 A;  2H3Z A;  2E1E A;  4JMU A;  2G5H B;  3LVV A;  3F2D A;  2LKY A;  1MA7 A;  2WAQ F;  4BUG A;  3SAG A;  4OO1 J;  1Z1B A;  2HOI A;  3D2S A;  4OJL A;  2HOF A;  1UPH A;  3F2C A;  3D2N A;  3PZP A;  2G5I B;  3M6Z A;  4U6P A;  4AYB F;  4FZL A;  3M6K A;  2H3F A;  2PMZ F;  2HMX A;  4A8E A;  3PSP A;  2DGZ A;  3N7S C;  4QIW C;  2WAQ C;  4U7C A;  2XI9 A;  3IN5 A;  3LYS A;  3KZX A;  2E1F A;  2KVC A;  2F77 X;  2KKV A;  2VJ5 A;  2ZIX A;  4AYB C;  3C28 A;  2VKQ A;  3C29 A;  4P0Q B;  4KMO B;  2G0A A;  3RFA A;  2PMZ C;  4FE3 A;  3DEE A;  2H3Q A;  4OJ6 A;  2DF4 B;  2KKP A;  3F5A A;  5KL1 B;  2E5S A;  2KEY A;  2F8L A;  4NLC A;  2ZIV B;  4GFJ A;  2NV3 A;  2R18 A;  3HKZ F;  3KFU F;  4WJ3 B;  1CRX A;  1ZQ1 C;  1OUQ A;  3SMV A;  1Q3U A;  2RRD A;  3VC8 A;  1NZB A;  1GO3 F;  3K1Z A;  4FZM A;  3IG8 A;  4QIW F;  5A0L A;  2GOL A;  2YB4 A;  4OJ5 A;  3SAF A;  2ZG6 A;  4ACO A;  2Z7J A;  3H0L B;  2OH2 A;  3RF9 A;  3VCB A;  3GU3 A;  1T94 A;  3HKZ C;  4FZN A;  3IP4 B;  4NLB A;  3ONN A;  4P0P B;  2LYA A;  3ALR A;  3NRW A;  2KNJ A;  1HEK A;  5HR7 A;  2JMG A;  3L3F X;  2HOQ A;  2F76 X;  3M7D A;  5KL8 B;  2GH1 A;  3SQI A;  4QJF B;  4P0Q A;  2K4E A;  1HIW A;  3D2Q A;  3IG5 A;  2MRL A;  4QNL A;  3NUQ A;  2ZIU B;  2W7O A;  2A3V A;  2G08 A;  4CGZ A;  2G07 A;  2OM6 A;  2DQN B;  3F53 A;  1DRG A;  2K4H A;  2VIX A;  1PVQ A;  3N7R C;  2F2A B;  1ECW A;  2HBM A;  3ICX A;  4O3M A;  2M0N A;  2D6F C;  1A6S A;  2RHF A;  5HR6 A;  2H3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...