2KJGA

Solution structure of an archaeal protein sso6904 from hyperthermophilic sulfolobus solfataricus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
MSILEDPEFVKLRQFKGKVNFNLVMQILDEIELDLRGSDNIKTSIIYVYSSHLDEIRKNKEFYDMIAEILQRYYKKIGIENVNQLILTTIKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and calcium binding of protein SSO6904 from the hyperthermophilic archaeon Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Metal binding protein
molecule keywords Archaeal protein SSO6904
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18249 Ca_bind_SSO6904 Calcium binding protein SSO6904
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.970 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2kjgA00
2KJGA
chains in the Genus database with same CATH superfamily
4CJGA 1A7EA 1NU7D 1EKYA 3BRJA 3ZQYA 4LERA 2QY9A 1T6QA 1YARO 1VTMP 2R7TA 4WABA 5JRAA 1OKKD 3NYLA 2WVQA 5E33A 3RKOF 2HJ3A 3B9QA 4DJ9A 3CZ6A 3DE8A 5EHHA 2OQMA 2KNHA 2PBEA 3AG2C 2WZFA 4JZAA 1LKXA 3K7DA 1Q0DA 5GPGB 2LSEA 2QTVA 1LE2A 5E2QA 3GM3A 3SXMA 5L0CA 1U0BB 3S28A 3SXZA 4PK4A 1OXBA 2R7UA 4I44A 1A7VA 4IARA 2FGYA 1TWAA 2ZD9A 5COFA 1JRAA 2HV6A 2I15A 1H6GA 3M1CB 3V5YA 4AL0A 1WGWA 4OINF 3HLZA 4JEAA 3PCVA 5JSLA 4BEJA 3RQEA 4YT2A 2PNOA 5KYYA 4NTBA 1I4ZA 5K0IA 3EFOB 3QW0A 4XLPF 3DJUB 4MS2A 2VB6A 3DAGA 1PV3A 3ABMC 3U3FA 2R02A 3NG1A 1ZU5A 1JOGA 2Y3GA 2FAPB 4OIQF 3EGXA 3KH2A 2LP4A 4DRJB 3IHUA 2P61A 2D4UA 4PFOA 2I8BA 1E2XA 1ORJA 2OKUA 4FWVA 1SZIA 1APCA 3DI5A 3FAPB 3U9JA 3VRCA 1QLEC 1U89A 1TWCA 3LNRA 1O87A 3QZCA 4WJ0A 3VAYA 4BJ5C 1UFBA 1ZHYA 2ZXPA 3EGDA 4E7SA 2P6VA 4U5BE 2Y3BA 4XPXA 4QDLA 3DM5A 1FTSA 5HV9A 2J7PA 3L34A 3OEOA 1YYXA 1L7CA 3KPHA 3HNKA 2YHSA 3R7CA 3F47A 3ATPA 3PHF2 4Q5SF 3SNHA 3FMSA 4LDKA 2P0NA 2AU5A 1O3UA 4C3DA 1EA8A 3EHNA 2XLHA 1K04A 3NKEA 4EIYA 5L3VA 3LEVA 1D0ZA 4H54A 4JURI 4U5CE 1DOVA 2YLDA 1OR2A 1M6TA 1OQCA 1KU2A 4YL1A 2L6HA 2LQGA 2UUHA 2ICWG 3MYFA 3EZHA 3K33A 2R05A 3K1HA 1L3PA 4CS7A 4CIPA 3LAYA 4E17A 3T9OA 3K1IA 4JIOA 2EPMX 1OXKA 2B0HA 3W8IA 1OCZC 3W8HA 3ASNC 3CAXA 3IQ5A 4J7YA 3GWLA 3UMIA 1DOWA 2PF4E 2Q9BA 3LS1A 3ZVRA 1WN0A 1R4TA 4EWCA 3U8VA 4E7ZA 2XS8A 4BPMA 4IGGA 2W4BA 4GEHA 3O55A 4CX9A 1T6UA 2DYRC 5E3CA 3KYJA 1EI7A 4JCZA 2ZXOA 1ORYA 2IXOA 2VH3A 2ETSA 2NPUA 3HNIA 3U2MA 4HEAJ 4A2NB 2J0XA 4RDAA 2IXMA 4K7BA 2C03A 2JD3A 2XLDA 4JTAB 1K40A 2X51A 3SXKA 4KBLA 3RQGA 3AOUA 2Y3DA 3VYWA 3DAFA 3O39A 3NMKA 1FMWA 1A7DA 2IXPA 1YAUO 3RW0A 4ANJA 2M64A 4B6IA 5IY5C 4LLCA 1Y6DA 4OIRF 5KYYB 3DE9A 3N0TA 4NTAA 1XWJA 2R7VA 2ZPAA 3MLGA 3C8GB 1VYKA 3AGUA 4MVQA 4XQ1A 4H4KC 3LNMB 2A0UA 2DGJA 1OCCC 2J8WA 3U5SA 3ZSUA 2A68F 3JYYA 1Q0GA 4XWJA 1RKCA 1B68A 4Z9JA 1YZCA 5B3IA 3AG4C 2H7VC 1H7IA 3ECSA 5A6BD 5A6BA 3A11A 4P6IC 5CIVA 1NFNA 4ZLDA 4N06A 1ZYRF 2OJED 5DVWA 2R7RA 2L9JA 2NUPB 5JS5A 3PDMP 1LS1A 1M2OA 5DS6A 4KI2A 2Q9AA 2AWCA 2KJGA 4UDVA 3ABKC 3KMIA 1ST6A 2OOCA 4XPWA 5L0IA 4YT4A 1CGME 1G8XA 4G0HA 1HMOA 1FAPB 2UUIA 5T3TA 1LI7A 3HTKC 3AG1C 5JUAA 3RH3A 1EQ1A 4CBEA 4J30B 4HFKB 2YZSA 3O6XA 4OD4A 2QUPA 2P1AA 4JEBA 1CGNA 2NUPA 4LLEA 4M63A 4MQ9F 3T4RA 1TWGA 1CPQA 1OR3A 4YL0A 2Q00A 3CQZA 5D92A 2ZXWC 1G4WR 4KNWA 1H9TA 4EBKA 1JPJA 2A6EF 1XZPA 3FHDA 1GS9A 3H65A 3PMRA 4U5FE 3EQLF 4RBNA 4LDRA 1T5OA 1ZW3A 1I4YA 2HUJA 3S27A 1E86A 2VCCA 4OD5A 4ER9A 5F5FA 3DM9B 3W2WA 1YVIA 2AWYA 2LFDA 1WATA 3JCUQ 3SZRA 4JW1A 4DRIB 3EGDB 2GAQA 3KKBA 2VCAA 2W4MA 1D1BA 2E87A 3QTHA 3ZTMA 3HNJA 3AGTA 5B1BC 4IAQA 4N4WA 3AJMA 1KNYA 5AGFA 2YLIA 4HFFB 1OCRC 3QW1A 4JC7A 3DD7A 3B0PA 2IXNA 4K1OA 2XLWA 4C3EA 3DMDA 4Z9IA 2NSFA 4CDVA 4K0DA 2V26A 2G3KA 3DKAA 3W4YA 3A9CA 3I4UA 3FVYA 2DB4A 3MBGA 4MVOA 1YZAA 5B1AC 5L0FA 2YEVA 2CW0F 5BQGA 2IOQA 3AQCA 2OEVA 3Q7LA 1JAFA 4D4NA 3S9OA 4BJ1A 4FX5A 2LD6A 5A6AA 3C8ZA 3EG9A 4NTFA 1TFOB 1BR4A 2PX3A 2Q3TA 2CDQA 3LEOA 2ASRA 2JPUA 4U9DA 4C3BA 1G4US 2L6FA 4P9FA 4CS8C 3C8GD 2VCBA 4EHPA 4OIOF 2HMQA 4JVSA 2C04A 2KW3C 4MTOA 2HSQA 1YA9A 2XM4A 3M15A 3B0UX 2CYDA 1ZZPA 2RD9A 4R32A 3NMIA 1FFHA 1O5HA 3O10A 4U5GA 3U2LA 3OWTA 1RKEA 1QQ3A 4CIHA 5EK0A 1TFKB 3GANA 4IJJA 4XEKA 1RJ9B 1C02A 4O7GA 4AE4A 4N6HA 1LVKA 5T1DB 3X1OA 3U3BA 1Q0MA 2XS1A 3EH1A 1T01A 1E85A 2KC3A 1BDJB 1VMAA 4DXWA 3K1IC 1VLTA 1ZHXA 2MYSA 2CNWD 2Q4FA 3IQTA 3QMKA 3L8JA 1CPRA 2EIMC 3NKDA 4AK9A 2MHRA 4N6CA 3RF3A 4CSAA 3US6A 1NG1A 3T6GB 2EIJC 2OJQA 1RKEB 3ITFA 1MMNA 4MVRA 2R7OA 4WGZA 5A6JA 3BEHA 5BQIA 5L0JA 1GQAA 4J32B 2DI3A 3TJ6A 4NQFA 5F28E 3M4BA 3UMHA 1SYQA 1HE1A 1OW6A 1V55C 2HSBA 2YL7A 4AX2A 2CNWA 1A0BA 1QVXA 4I1MA 1IW7F 3GEIA 3F46A 3K6BA 3JSZA 2HMZA 1LE4A 2QE9A 1H9GA 3MYIA 5FZTA 2CCYA 1A41A 2G3VA 2H8AA 2NSGA 2GWWA 3B29A 3LUTB 4YL3A 3WODF 3UR3C 2KK1A 3Q6MA 4DVZA 1PCXA 1Q0FA 4IB4A 4EKWA 4W8PA 1ORSC 3B71A 2A1DD 4Z9HA 1WASA 3IEEA 2B0JA 2HV7A 2H7OA 4QI2A 2R7WA 2A69F 4JE9A 3RIPA 1U6HA 5A6KA 2J45A 5KYWB 1M56C 3V5XA 4ONSA 5DS5A 2BL2A 3C8GA 4YK5A 1T9KA 1YA7O 2DYSC 3FOOA 4PFPA 3SXYA 4JTDB 2YKZA 5COGA 4MVUA 5E3AA 5D91A 2WVNA 5BUOA 1NSGB 3MX3A 3AG3C 4PACA 3V7OA 1F1MA 1ZHWA 3V5ZA 1D0YA 2J46A 3R2PA 4MTGA 2Z15A 5BQHA 1C17M 1Z63A 3EZIA 3DXJF 1FMVA 4MVSA 1VOMA 3ZWIA 1PD1A 3WAQA 1LS4A 4CS9C 5A69A 1FFTC 2VASA 4U9EA 1J8YF 5DLJA 3FDQA 4PJJA 5KYWA 2WB7A 4KNVA 1MMAA 3H2UA 3NYMA 1MQVA 2W9YA 3TD7A 3EFOA 3N24A 3G4XA 2EIKC 2A6HF 3TJ5A 3KL4A 3VM6A 2W45A 2OG2A 2H7BA 2R9RB 3C18A 4FESA 2HJMA 3SEOA 3WHNA 1TWHA 5T3WA 1V4AA 1Y4CA 4YT5A 3T6BA 4G7HF 1K05A 3NDBB 2KSFA 4JTCB 4EBJA 1BBHA 2XLVA 4NC3A 5L0GA 3GEHA 4LDQA 4CJOA 1J8MF 3X2QC 4U5HA 3TK0A 1R5ID 3HKKA 2XLMA 3GM2A 4PJMA 2XRHA 3ZTZA 5TJ5E 2WL8A 2RSEB 3KYIA 1QSPA 3ASOC 3JSEO 4MW8A 4BJTA 1LPEA 4A4AA 2Y3HA 4DBQA 1NZEA 2ZXRA 1JR8A 3ZQVA 2Q7RA 2QLAA 1D1AA 4U5DE 3UMKA 4C7OA 4D4XA 2HFIA 2EPLX 1CGOA 1WTYA 4EUKB 1AUEA 5KYXB 1D1CA 1M2VB 1KTMA 1I5NA 4MNDA 1AVOB 2PFDA 4Q4ZF 1G5ZA 1QZXA 3S29A 1YDIA 3S90A 4HE8D 3LJBA 3LESA 1VYIA 256BA 5JP7A 1S05A 4OIPF 2XLEA 4W8KA 3RQFA 3TQOA 4ULVA 1GGQA 2BC5A 2NUTB 2XLOA 5KYUA 3JYHA 4CDYA 1BR2A 2AP3A 2QNLA 3FAJA 3G4ZA 3GORA 3U9MA 3NMJA 1BZ4A 1HE9A 4AE4B 3UGOA 1N1CA 1WWPA 3GM1A 2NG1A 4E0IA 3M4CA 2FFHA 5B3SC 1W2WA 4XLNF 2XM0A 3JTLO 4YJWA 3WG7C 3U8PA 4YT8A 2XXAB 2GA0A 1GM5A 3DZAA 3QVZA 1VB5A 1Z3IX 1HMDA 1T6IA 4BJ6A 3GWNA 5JVEA 5L0HA 4O6YA 3DWWA 2NUTA 2Y39A 1ZVZA 2YQYA 3L0IA 3OA1A 1JMWA 4E18A 2IYLD 4BEMJ 1LIHA 3NYJA 1WOLA 4J7TA 3GEEA 4JJGA 1MMDA 1OW8A 3T6JA 3FXHA 3I5PA 1Z5ZA 2BE5F 3AQBA 3VF0A 1M57C 3Q7GA 4X0RA 4YWQA 2R7QA 4I1OB 2XL4A 2YRFA 3HNLA 4NCQA 2YL1A 4BJ5A 3K66A 4KC9A 2PP4A 2XL8A 4JCHA 3CSKA 1IZMA 4O6NA 3RVZA 1MNEA 4XEVA 3JT1A 2YL3A 4LACB 3ABLC 3N2ZB 3MFNA 4XEFA 3H2VA 4IRUA 5KYNA 2V3CC 1C03A 4FAPB 5JLIA 1ZU4A 1NFOA 3S84A 4IWBA 1RMVA 1VLSA 4U5EE 3EHMA 5HSWA 4Q7CA 3E9VA 3L8IA 1ZHTA 3IQCA 4I3MA 1TR2A 3J06A 2G62A 2WVOA 1YYJA 4F4BA 1AEPA 4G78A 2MWQA 2VC9A 2PX0A 2YL0A 2HKVA 4MVZA 4MW3A 4PJNA 2KQ9A 1LM3B 2YVKA 1Q0KA 4G7OF 2HS5A 4MTFA 3RVYA 4DOZA 1Z23A 3C62A 1OW7A 3Q6NA 2WZGA 2EINC 3EH2A 4YN0B 3UNGC 3I5QA 4GYTA 5DQZA 5KYXA 2LK4A 1QPUA 2P7VA 5CI9A 3M79A 4DVYP 3B0VC 4WGYA 3CEXA 2EILC 2F22A 5AC4A 3S0XA 2A0BA 1OKKA 4XPYA 1RCPA 1XZQA 3TULA 1V74B 1TQGA 2O9XA 2R03A 2Y69C 5F5HA 5L0DA 3LLKA 1TKNA 1HY5A 4L6RA 5KYUB 3RFYA 1QKRA 1D0XA 1HW1A 2IBFA 3EPVA 2XSEA 2WZLA 3U0CA 4NY3A 4P9TA 3JZ0A 4DRHB 1V54C 2XXAA 1FNTc 2OCCC 2CGEA 2L7AA 2GFHA 2J7PD 3G50A 5AC5A 1ZHZA 4BJ6C 1BR1A 3EJNA 2GDCA 2KYHA 3LLIA 5CI8A 2EPOA 4CS8A 5EGYA 5JT4A 4XTKA 1UG7A 4DBRA 1RXQA 5L3QA 3IQ6A 1NBBA 4EBBA 2L81A 1NU9C 1RJ9A 1JPNA 2YWAA 2AVKA 5DS4A 4CS9A 4AL1A 1MMGA 3SYNA 4PJLA 2IM8A 2HZ8A 3FOPA 1MNDA 2Q9CA 3L1MA 4C7OB 4JRZA 3EGXB 3QVYA 2EPNA 2OU6A 1M2VA 3C63A 2XL6A 4MVMA 2R25A 2YLGA 1SR2A 2OEXA 3E70C 5COMA 3TOLA 4CDAA 5FCLA 1Z6AA 3C7JA 3IPMO 2J9UA 1LI5A 4JKVA 2EPKX 2LFFA 3DJNB 3LS0A 3ZDLA 1SMYF 2M4EA 1ZW2A 5DQTA 2TMVP 4IAOA 3JRTA 3RYLA 4E0HA 1Z7Qc 2R7SA 3GODA 1E83A 2R7XA 3NRHA 2J9WA 3JRMO 3ZG1A 1SF8A 2LCHA 3UGPA 1HW2A 4CSAC 1YJGA 2J9BA 2LIGA 4O79A 3SP1A 1S7ZA 2KGOA 1VK5A 3EG9B 4O6MA 4RD9A 4ZLCA 2J0WA 3POVA 2JX0A 3ZC4A 1E84A 4PR9A 4BG0A 4JJFA 1NLXA 2D5RB 3W2VA 4G7ZF 1OCOC 3ZIBA 2L6GA 4ULWA 2J9VA 4GQHA 1FR0A 1PD0A 1YLMA 2X0CA 3TOMA 4QI0A 3HJCA
chains in the Genus database with same CATH topology
1NU7D 2R7TA 4LERA 2QY9A 1OKKD 3NYLA 2WVQA 5E33A 3RKOF 3B9QA 3CZ6A 5EHHA 2KNHA 3AG2C 2WZFA 4JZAA 1LKXA 3K7DA 2LSEA 2QTVA 5E2QA 3S28A 4PK4A 2R7UA 4I44A 2FGYA 1TWAA 2HV6A 3M1CB 1WGWA 4OINF 3HLZA 5KYYA 4BEJA 4YT2A 3EFOB 4XLPF 3DJUB 2VB6A 3DAGA 3ABMC 3NG1A 1ZU5A 2Y3GA 3EGXA 3KH2A 4PFOA 2I8BA 4FWVA 1SZIA 4BJ5C 1QLEC 1TWCA 3LNRA 1O87A 3QZCA 4WJ0A 3VAYA 1ZHYA 2ZXPA 3EGDA 4E7SA 2P6VA 4U5BE 2Y3BA 4QDLA 3DM5A 1FTSA 2J7PA 3L34A 3OEOA 2YHSA 3F47A 3PHF2 4Q5SF 3SNHA 4C3DA 3EHNA 3NKEA 5L3VA 3LEVA 1D0ZA 4U5CE 4JURI 1KU2A 3EZHA 3K33A 3K1HA 4CS7A 3LAYA 3W8IA 3W8HA 1OCZC 3ASNC 3UMIA 3LS1A 2PF4E 2Q9BA 3ZVRA 4E7ZA 4EWCA 2W4BA 4GEHA 2DYRC 5E3CA 2ZXOA 2IXOA 2VH3A 4HEAJ 4A2NB 2J0XA 4RDAA 2IXMA 4K7BA 2C03A 2JD3A 2X51A 4KBLA 2Y3DA 3VYWA 3DAFA 3O39A 4ANJA 1FMWA 2IXPA 4B6IA 4LLCA 4OIRF 5KYYB 3N0TA 2R7VA 2ZPAA 3MLGA 1VYKA 4H4KC 2DGJA 1OCCC 3ZSUA 2A68F 4XWJA 3AG4C 2H7VC 3ECSA 4P6IC 4ZLDA 4N06A 1ZYRF 5DVWA 2R7RA 2L9JA 2NUPB 1LS1A 1M2OA 5DS6A 4KI2A 2Q9AA 2KJGA 3ABKC 3KMIA 1ST6A 4YT4A 1G8XA 4G0HA 5T3TA 3HTKC 3AG1C 3RH3A 4CBEA 4J30B 4HFKB 2YZSA 3O6XA 4OD4A 4LLEA 4M63A 2NUPA 4MQ9F 3T4RA 1TWGA 3CQZA 5D92A 2ZXWC 4KNWA 1JPJA 2A6EF 3FHDA 3H65A 3PMRA 4U5FE 3EQLF 4RBNA 3S27A 4OD5A 5F5FA 3DM9B 3W2WA 3JCUQ 3SZRA 4JW1A 3EGDB 3KKBA 2W4MA 1D1BA 2E87A 5B1BC 4HFFB 1OCRC 3DD7A 3B0PA 2IXNA 4C3EA 3DMDA 4K0DA 2V26A 2G3KA 3I4UA 3FVYA 5B1AC 2YEVA 2CW0F 2IOQA 3AQCA 3Q7LA 4BJ1A 4FX5A 3EG9A 1BR4A 2PX3A 2Q3TA 2CDQA 4C3BA 4CS8C 4OIOF 4JVSA 2C04A 2KW3C 3B0UX 1FFHA 1O5HA 4U5GA 3OWTA 4CIHA 4IJJA 3GANA 1RJ9B 4O7GA 4AE4A 1LVKA 5T1DB 3X1OA 3EH1A 1VMAA 3K1IC 1ZHXA 2MYSA 2CNWD 3QMKA 2EIMC 3NKDA 4AK9A 4CSAA 1NG1A 2EIJC 3ITFA 1MMNA 2R7OA 4J32B 3UMHA 1V55C 4AX2A 2CNWA 4I1MA 1IW7F 3F46A 3K6BA 3JSZA 2G3VA 3WODF 3UR3C 3Q6MA 4DVZA 1PCXA 2A1DD 3IEEA 2B0JA 2HV7A 2H7OA 4QI2A 2R7WA 2A69F 3RIPA 5KYWB 5DS5A 2J45A 1M56C 2DYSC 4PFPA 5E3AA 5D91A 2WVNA 5BUOA 3MX3A 3AG3C 3V7OA 4G7HF 1ZHWA 1D0YA 2J46A 2Z15A 1Z63A 3EZIA 3DXJF 1FMVA 1VOMA 1PD1A 4CS9C 1FFTC 2VASA 1J8YF 5DLJA 3FDQA 4PJJA 5KYWA 2WB7A 4KNVA 1MMAA 3NYMA 3TD7A 5DS4A 2W9YA 3EFOA 3N24A 2EIKC 2A6HF 3KL4A 2W45A 2OG2A 2H7BA 4FESA 3SEOA 1TWHA 5T3WA 4YT5A 3T6BA 3NDBB 1J8MF 3X2QC 4U5HA 4PJMA 2XRHA 2WL8A 3ASOC 4BJTA 4DBQA 2Y3HA 1NZEA 2ZXRA 1D1AA 4U5DE 3UMKA 4C7OA 5KYXB 1D1CA 1M2VB 4MNDA 2PFDA 4Q4ZF 3S29A 1QZXA 4HE8D 3LJBA 3LESA 1VYIA 4OIPF 4W8KA 2NUTB 5KYUA 5IY5C 3JYHA 1BR2A 3FAJA 4AE4B 3UGOA 1N1CA 2NG1A 2FFHA 5B3SC 1W2WA 4XLNF 4YJWA 3WG7C 4YT8A 2XXAB 3DZAA 1Z3IX 4BJ6A 4O6YA 2NUTA 2Y39A 3L0IA 3OA1A 2IYLD 3NYJA 4JJGA 1MMDA 3T6JA 3I5PA 1Z5ZA 2BE5F 3AQBA 1M57C 3Q7GA 4X0RA 4YWQA 2R7QA 4I1OB 2XL4A 4BJ5A 3K66A 4KC9A 2PP4A 4JCHA 3CSKA 1IZMA 4O6NA 1MNEA 3JT1A 4LACB 3ABLC 3N2ZB 2V3CC 5KYNA 4IRUA 1ZU4A 4IWBA 4U5EE 3EHMA 5HSWA 4Q7CA 3E9VA 1ZHTA 4I3MA 1TR2A 2G62A 2WVOA 4F4BA 2MWQA 2PX0A 4PJNA 2KQ9A 4G7OF 4DOZA 1Z23A 3Q6NA 2WZGA 2EINC 3EH2A 4YN0B 3UNGC 4GYTA 3I5QA 5DQZA 5KYXA 5CI9A 2P7VA 4DVYP 3B0VC 2EILC 3S0XA 1OKKA 5F5HA 2O9XA 2Y69C 3LLKA 1TKNA 5KYUB 3RFYA 1D0XA 3EPVA 2XSEA 2WZLA 4NY3A 1V54C 2XXAA 2OCCC 2CGEA 2GFHA 2J7PD 1ZHZA 4BJ6C 1BR1A 3EJNA 5CI8A 3LLIA 4CS8A 5EGYA 4XTKA 4DBRA 5L3QA 4EBBA 2L81A 1NU9C 1RJ9A 1JPNA 4CS9A 1MMGA 3SYNA 4PJLA 1MNDA 2Q9CA 4C7OB 3EGXB 1M2VA 3E70C 5FCLA 1Z6AA 2J9UA 4OIQF 3DJNB 5DQTA 3LS0A 1SMYF 2M4EA 4IAOA 3JRTA 3RYLA 2R7SA 3GODA 2R7XA 3NRHA 2J9WA 3ZG1A 3UGPA 1SF8A 4CSAC 3SP1A 4O79A 1S7ZA 2KGOA 1VK5A 3EG9B 4O6MA 4RD9A 4ZLCA 2J0WA 3POVA 3ZC4A 4BG0A 4JJFA 2D5RB 3W2VA 4G7ZF 1OCOC 3ZIBA 4ULWA 2J9VA 1PD0A 4QI0A 3HJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KJG A; 
#chains in the Genus database with same CATH topology
 4CJG A;  1A7E A;  1NU7 D;  1EKY A;  3BRJ A;  3ZQY A;  4LER A;  2QY9 A;  1T6Q A;  1YAR O;  1VTM P;  2R7T A;  4WAB A;  5JRA A;  1OKK D;  3NYL A;  2WVQ A;  5E33 A;  3RKO F;  2HJ3 A;  3B9Q A;  4DJ9 A;  3CZ6 A;  3DE8 A;  5EHH A;  2OQM A;  2KNH A;  2PBE A;  3AG2 C;  2WZF A;  4JZA A;  1LKX A;  3K7D A;  1Q0D A;  5GPG B;  2LSE A;  2QTV A;  1LE2 A;  5E2Q A;  3GM3 A;  3SXM A;  5L0C A;  1U0B B;  3S28 A;  3SXZ A;  4PK4 A;  1OXB A;  2R7U A;  4I44 A;  1A7V A;  4IAR A;  2FGY A;  1TWA A;  2ZD9 A;  5COF A;  1JRA A;  2HV6 A;  2I15 A;  1H6G A;  3M1C B;  3V5Y A;  4AL0 A;  1WGW A;  4OIN F;  3HLZ A;  4JEA A;  3PCV A;  5JSL A;  4BEJ A;  3RQE A;  4YT2 A;  2PNO A;  5KYY A;  4NTB A;  1I4Z A;  5K0I A;  3EFO B;  3QW0 A;  4XLP F;  3DJU B;  4MS2 A;  2VB6 A;  3DAG A;  1PV3 A;  3ABM C;  3U3F A;  2R02 A;  3NG1 A;  1ZU5 A;  1JOG A;  2Y3G A;  2FAP B;  4OIQ F;  3EGX A;  3KH2 A;  2LP4 A;  4DRJ B;  3IHU A;  2P61 A;  2D4U A;  4PFO A;  2I8B A;  1E2X A;  1ORJ A;  2OKU A;  4FWV A;  1SZI A;  1APC A;  3DI5 A;  3FAP B;  3U9J A;  3VRC A;  1QLE C;  1U89 A;  1TWC A;  3LNR A;  1O87 A;  3QZC A;  4WJ0 A;  3VAY A;  4BJ5 C;  1UFB A;  1ZHY A;  2ZXP A;  3EGD A;  4E7S A;  2P6V A;  4U5B E;  2Y3B A;  4XPX A;  4QDL A;  3DM5 A;  1FTS A;  5HV9 A;  2J7P A;  3L34 A;  3OEO A;  1YYX A;  1L7C A;  3KPH A;  3HNK A;  2YHS A;  3R7C A;  3F47 A;  3ATP A;  3PHF 2;  4Q5S F;  3SNH A;  3FMS A;  4LDK A;  2P0N A;  2AU5 A;  1O3U A;  4C3D A;  1EA8 A;  3EHN A;  2XLH A;  1K04 A;  3NKE A;  4EIY A;  5L3V A;  3LEV A;  1D0Z A;  4H54 A;  4JUR I;  4U5C E;  1DOV A;  2YLD A;  1OR2 A;  1M6T A;  1OQC A;  1KU2 A;  4YL1 A;  2L6H A;  2LQG A;  2UUH A;  2ICW G;  3MYF A;  3EZH A;  3K33 A;  2R05 A;  3K1H A;  1L3P A;  4CS7 A;  4CIP A;  3LAY A;  4E17 A;  3T9O A;  3K1I A;  4JIO A;  2EPM X;  1OXK A;  2B0H A;  3W8I A;  1OCZ C;  3W8H A;  3ASN C;  3CAX A;  3IQ5 A;  4J7Y A;  3GWL A;  3UMI A;  1DOW A;  2PF4 E;  2Q9B A;  3LS1 A;  3ZVR A;  1WN0 A;  1R4T A;  4EWC A;  3U8V A;  4E7Z A;  2XS8 A;  4BPM A;  4IGG A;  2W4B A;  4GEH A;  3O55 A;  4CX9 A;  1T6U A;  2DYR C;  5E3C A;  3KYJ A;  1EI7 A;  4JCZ A;  2ZXO A;  1ORY A;  2IXO A;  2VH3 A;  2ETS A;  2NPU A;  3HNI A;  3U2M A;  4HEA J;  4A2N B;  2J0X A;  4RDA A;  2IXM A;  4K7B A;  2C03 A;  2JD3 A;  2XLD A;  4JTA B;  1K40 A;  2X51 A;  3SXK A;  4KBL A;  3RQG A;  3AOU A;  2Y3D A;  3VYW A;  3DAF A;  3O39 A;  3NMK A;  1FMW A;  1A7D A;  2IXP A;  1YAU O;  3RW0 A;  4ANJ A;  2M64 A;  4B6I A;  5IY5 C;  4LLC A;  1Y6D A;  4OIR F;  5KYY B;  3DE9 A;  3N0T A;  4NTA A;  1XWJ A;  2R7V A;  2ZPA A;  3MLG A;  3C8G B;  1VYK A;  3AGU A;  4MVQ A;  4XQ1 A;  4H4K C;  3LNM B;  2A0U A;  2DGJ A;  1OCC C;  2J8W A;  3U5S A;  3ZSU A;  2A68 F;  3JYY A;  1Q0G A;  4XWJ A;  1RKC A;  1B68 A;  4Z9J A;  1YZC A;  5B3I A;  3AG4 C;  2H7V C;  1H7I A;  3ECS A;  5A6B D;  5A6B A;  3A11 A;  4P6I C;  5CIV A;  1NFN A;  4ZLD A;  4N06 A;  1ZYR F;  2OJE D;  5DVW A;  2R7R A;  2L9J A;  2NUP B;  5JS5 A;  3PDM P;  1LS1 A;  1M2O A;  5DS6 A;  4KI2 A;  2Q9A A;  2AWC A;  2KJG A;  4UDV A;  3ABK C;  3KMI A;  1ST6 A;  2OOC A;  4XPW A;  5L0I A;  4YT4 A;  1CGM E;  1G8X A;  4G0H A;  1HMO A;  1FAP B;  2UUI A;  5T3T A;  1LI7 A;  3HTK C;  3AG1 C;  5JUA A;  3RH3 A;  1EQ1 A;  4CBE A;  4J30 B;  4HFK B;  2YZS A;  3O6X A;  4OD4 A;  2QUP A;  2P1A A;  4JEB A;  1CGN A;  2NUP A;  4LLE A;  4M63 A;  4MQ9 F;  3T4R A;  1TWG A;  1CPQ A;  1OR3 A;  4YL0 A;  2Q00 A;  3CQZ A;  5D92 A;  2ZXW C;  1G4W R;  4KNW A;  1H9T A;  4EBK A;  1JPJ A;  2A6E F;  1XZP A;  3FHD A;  1GS9 A;  3H65 A;  3PMR A;  4U5F E;  3EQL F;  4RBN A;  4LDR A;  1T5O A;  1ZW3 A;  1I4Y A;  2HUJ A;  3S27 A;  1E86 A;  2VCC A;  4OD5 A;  4ER9 A;  5F5F A;  3DM9 B;  3W2W A;  1YVI A;  2AWY A;  2LFD A;  1WAT A;  3JCU Q;  3SZR A;  4JW1 A;  4DRI B;  3EGD B;  2GAQ A;  3KKB A;  2VCA A;  2W4M A;  1D1B A;  2E87 A;  3QTH A;  3ZTM A;  3HNJ A;  3AGT A;  5B1B C;  4IAQ A;  4N4W A;  3AJM A;  1KNY A;  5AGF A;  2YLI A;  4HFF B;  1OCR C;  3QW1 A;  4JC7 A;  3DD7 A;  3B0P A;  2IXN A;  4K1O A;  2XLW A;  4C3E A;  3DMD A;  4Z9I A;  2NSF A;  4CDV A;  4K0D A;  2V26 A;  2G3K A;  3DKA A;  3W4Y A;  3A9C A;  3I4U A;  3FVY A;  2DB4 A;  3MBG A;  4MVO A;  1YZA A;  5B1A C;  5L0F A;  2YEV A;  2CW0 F;  5BQG A;  2IOQ A;  3AQC A;  2OEV A;  3Q7L A;  1JAF A;  4D4N A;  3S9O A;  4BJ1 A;  4FX5 A;  2LD6 A;  5A6A A;  3C8Z A;  3EG9 A;  4NTF A;  1TFO B;  1BR4 A;  2PX3 A;  2Q3T A;  2CDQ A;  3LEO A;  2ASR A;  2JPU A;  4U9D A;  4C3B A;  1G4U S;  2L6F A;  4P9F A;  4CS8 C;  3C8G D;  2VCB A;  4EHP A;  4OIO F;  2HMQ A;  4JVS A;  2C04 A;  2KW3 C;  4MTO A;  2HSQ A;  1YA9 A;  2XM4 A;  3M15 A;  3B0U X;  2CYD A;  1ZZP A;  2RD9 A;  4R32 A;  3NMI A;  1FFH A;  1O5H A;  3O10 A;  4U5G A;  3U2L A;  3OWT A;  1RKE A;  1QQ3 A;  4CIH A;  5EK0 A;  1TFK B;  3GAN A;  4IJJ A;  4XEK A;  1RJ9 B;  1C02 A;  4O7G A;  4AE4 A;  4N6H A;  1LVK A;  5T1D B;  3X1O A;  3U3B A;  1Q0M A;  2XS1 A;  3EH1 A;  1T01 A;  1E85 A;  2KC3 A;  1BDJ B;  1VMA A;  4DXW A;  3K1I C;  1VLT A;  1ZHX A;  2MYS A;  2CNW D;  2Q4F A;  3IQT A;  3QMK A;  3L8J A;  1CPR A;  2EIM C;  3NKD A;  4AK9 A;  2MHR A;  4N6C A;  3RF3 A;  4CSA A;  3US6 A;  1NG1 A;  3T6G B;  2EIJ C;  2OJQ A;  1RKE B;  3ITF A;  1MMN A;  4MVR A;  2R7O A;  4WGZ A;  5A6J A;  3BEH A;  5BQI A;  5L0J A;  1GQA A;  4J32 B;  2DI3 A;  3TJ6 A;  4NQF A;  5F28 E;  3M4B A;  3UMH A;  1SYQ A;  1HE1 A;  1OW6 A;  1V55 C;  2HSB A;  2YL7 A;  4AX2 A;  2CNW A;  1A0B A;  1QVX A;  4I1M A;  1IW7 F;  3GEI A;  3F46 A;  3K6B A;  3JSZ A;  2HMZ A;  1LE4 A;  2QE9 A;  1H9G A;  3MYI A;  5FZT A;  2CCY A;  1A41 A;  2G3V A;  2H8A A;  2NSG A;  2GWW A;  3B29 A;  3LUT B;  4YL3 A;  3WOD F;  3UR3 C;  2KK1 A;  3Q6M A;  4DVZ A;  1PCX A;  1Q0F A;  4IB4 A;  4EKW A;  4W8P A;  1ORS C;  3B71 A;  2A1D D;  4Z9H A;  1WAS A;  3IEE A;  2B0J A;  2HV7 A;  2H7O A;  4QI2 A;  2R7W A;  2A69 F;  4JE9 A;  3RIP A;  1U6H A;  5A6K A;  2J45 A;  5KYW B;  1M56 C;  3V5X A;  4ONS A;  5DS5 A;  2BL2 A;  3C8G A;  4YK5 A;  1T9K A;  1YA7 O;  2DYS C;  3FOO A;  4PFP A;  3SXY A;  4JTD B;  2YKZ A;  5COG A;  4MVU A;  5E3A A;  5D91 A;  2WVN A;  5BUO A;  1NSG B;  3MX3 A;  3AG3 C;  4PAC A;  3V7O A;  1F1M A;  1ZHW A;  3V5Z A;  1D0Y A;  2J46 A;  3R2P A;  4MTG A;  2Z15 A;  5BQH A;  1C17 M;  1Z63 A;  3EZI A;  3DXJ F;  1FMV A;  4MVS A;  1VOM A;  3ZWI A;  1PD1 A;  3WAQ A;  1LS4 A;  4CS9 C;  5A69 A;  1FFT C;  2VAS A;  4U9E A;  1J8Y F;  5DLJ A;  3FDQ A;  4PJJ A;  5KYW A;  2WB7 A;  4KNV A;  1MMA A;  3H2U A;  3NYM A;  1MQV A;  2W9Y A;  3TD7 A;  3EFO A;  3N24 A;  3G4X A;  2EIK C;  2A6H F;  3TJ5 A;  3KL4 A;  3VM6 A;  2W45 A;  2OG2 A;  2H7B A;  2R9R B;  3C18 A;  4FES A;  2HJM A;  3SEO A;  3WHN A;  1TWH A;  5T3W A;  1V4A A;  1Y4C A;  4YT5 A;  3T6B A;  4G7H F;  1K05 A;  3NDB B;  2KSF A;  4JTC B;  4EBJ A;  1BBH A;  2XLV A;  4NC3 A;  5L0G A;  3GEH A;  4LDQ A;  4CJO A;  1J8M F;  3X2Q C;  4U5H A;  3TK0 A;  1R5I D;  3HKK A;  2XLM A;  3GM2 A;  4PJM A;  2XRH A;  3ZTZ A;  5TJ5 E;  2WL8 A;  2RSE B;  3KYI A;  1QSP A;  3ASO C;  3JSE O;  4MW8 A;  4BJT A;  1LPE A;  4A4A A;  2Y3H A;  4DBQ A;  1NZE A;  2ZXR A;  1JR8 A;  3ZQV A;  2Q7R A;  2QLA A;  1D1A A;  4U5D E;  3UMK A;  4C7O A;  4D4X A;  2HFI A;  2EPL X;  1CGO A;  1WTY A;  4EUK B;  1AUE A;  5KYX B;  1D1C A;  1M2V B;  1KTM A;  1I5N A;  4MND A;  1AVO B;  2PFD A;  4Q4Z F;  1G5Z A;  1QZX A;  3S29 A;  1YDI A;  3S90 A;  4HE8 D;  3LJB A;  3LES A;  1VYI A;  256B A;  5JP7 A;  1S05 A;  4OIP F;  2XLE A;  4W8K A;  3RQF A;  3TQO A;  4ULV A;  1GGQ A;  2BC5 A;  2NUT B;  2XLO A;  5KYU A;  3JYH A;  4CDY A;  1BR2 A;  2AP3 A;  2QNL A;  3FAJ A;  3G4Z A;  3GOR A;  3U9M A;  3NMJ A;  1BZ4 A;  1HE9 A;  4AE4 B;  3UGO A;  1N1C A;  1WWP A;  3GM1 A;  2NG1 A;  4E0I A;  3M4C A;  2FFH A;  5B3S C;  1W2W A;  4XLN F;  2XM0 A;  3JTL O;  4YJW A;  3WG7 C;  3U8P A;  4YT8 A;  2XXA B;  2GA0 A;  1GM5 A;  3DZA A;  3QVZ A;  1VB5 A;  1Z3I X;  1HMD A;  1T6I A;  4BJ6 A;  3GWN A;  5JVE A;  5L0H A;  4O6Y A;  3DWW A;  2NUT A;  2Y39 A;  1ZVZ A;  2YQY A;  3L0I A;  3OA1 A;  1JMW A;  4E18 A;  2IYL D;  4BEM J;  1LIH A;  3NYJ A;  1WOL A;  4J7T A;  3GEE A;  4JJG A;  1MMD A;  1OW8 A;  3T6J A;  3FXH A;  3I5P A;  1Z5Z A;  2BE5 F;  3AQB A;  3VF0 A;  1M57 C;  3Q7G A;  4X0R A;  4YWQ A;  2R7Q A;  4I1O B;  2XL4 A;  2YRF A;  3HNL A;  4NCQ A;  2YL1 A;  4BJ5 A;  3K66 A;  4KC9 A;  2PP4 A;  2XL8 A;  4JCH A;  3CSK A;  1IZM A;  4O6N A;  3RVZ A;  1MNE A;  4XEV A;  3JT1 A;  2YL3 A;  4LAC B;  3ABL C;  3N2Z B;  3MFN A;  4XEF A;  3H2V A;  4IRU A;  5KYN A;  2V3C C;  1C03 A;  4FAP B;  5JLI A;  1ZU4 A;  1NFO A;  3S84 A;  4IWB A;  1RMV A;  1VLS A;  4U5E E;  3EHM A;  5HSW A;  4Q7C A;  3E9V A;  3L8I A;  1ZHT A;  3IQC A;  4I3M A;  1TR2 A;  3J06 A;  2G62 A;  2WVO A;  1YYJ A;  4F4B A;  1AEP A;  4G78 A;  2MWQ A;  2VC9 A;  2PX0 A;  2YL0 A;  2HKV A;  4MVZ A;  4MW3 A;  4PJN A;  2KQ9 A;  1LM3 B;  2YVK A;  1Q0K A;  4G7O F;  2HS5 A;  4MTF A;  3RVY A;  4DOZ A;  1Z23 A;  3C62 A;  1OW7 A;  3Q6N A;  2WZG A;  2EIN C;  3EH2 A;  4YN0 B;  3UNG C;  3I5Q A;  4GYT A;  5DQZ A;  5KYX A;  2LK4 A;  1QPU A;  2P7V A;  5CI9 A;  3M79 A;  4DVY P;  3B0V C;  4WGY A;  3CEX A;  2EIL C;  2F22 A;  5AC4 A;  3S0X A;  2A0B A;  1OKK A;  4XPY A;  1RCP A;  1XZQ A;  3TUL A;  1V74 B;  1TQG A;  2O9X A;  2R03 A;  2Y69 C;  5F5H A;  5L0D A;  3LLK A;  1TKN A;  1HY5 A;  4L6R A;  5KYU B;  3RFY A;  1QKR A;  1D0X A;  1HW1 A;  2IBF A;  3EPV A;  2XSE A;  2WZL A;  3U0C A;  4NY3 A;  4P9T A;  3JZ0 A;  4DRH B;  1V54 C;  2XXA A;  1FNT c;  2OCC C;  2CGE A;  2L7A A;  2GFH A;  2J7P D;  3G50 A;  5AC5 A;  1ZHZ A;  4BJ6 C;  1BR1 A;  3EJN A;  2GDC A;  2KYH A;  3LLI A;  5CI8 A;  2EPO A;  4CS8 A;  5EGY A;  5JT4 A;  4XTK A;  1UG7 A;  4DBR A;  1RXQ A;  5L3Q A;  3IQ6 A;  1NBB A;  4EBB A;  2L81 A;  1NU9 C;  1RJ9 A;  1JPN A;  2YWA A;  2AVK A;  5DS4 A;  4CS9 A;  4AL1 A;  1MMG A;  3SYN A;  4PJL A;  2IM8 A;  2HZ8 A;  3FOP A;  1MND A;  2Q9C A;  3L1M A;  4C7O B;  4JRZ A;  3EGX B;  3QVY A;  2EPN A;  2OU6 A;  1M2V A;  3C63 A;  2XL6 A;  4MVM A;  2R25 A;  2YLG A;  1SR2 A;  2OEX A;  3E70 C;  5COM A;  3TOL A;  4CDA A;  5FCL A;  1Z6A A;  3C7J A;  3IPM O;  2J9U A;  1LI5 A;  4JKV A;  2EPK X;  2LFF A;  3DJN B;  3LS0 A;  3ZDL A;  1SMY F;  2M4E A;  1ZW2 A;  5DQT A;  2TMV P;  4IAO A;  3JRT A;  3RYL A;  4E0H A;  1Z7Q c;  2R7S A;  3GOD A;  1E83 A;  2R7X A;  3NRH A;  2J9W A;  3JRM O;  3ZG1 A;  1SF8 A;  2LCH A;  3UGP A;  1HW2 A;  4CSA C;  1YJG A;  2J9B A;  2LIG A;  4O79 A;  3SP1 A;  1S7Z A;  2KGO A;  1VK5 A;  3EG9 B;  4O6M A;  4RD9 A;  4ZLC A;  2J0W A;  3POV A;  2JX0 A;  3ZC4 A;  1E84 A;  4PR9 A;  4BG0 A;  4JJF A;  1NLX A;  2D5R B;  3W2V A;  4G7Z F;  1OCO C;  3ZIB A;  2L6G A;  4ULW A;  2J9V A;  4GQH A;  1FR0 A;  1PD0 A;  1YLM A;  2X0C A;  3TOM A;  4QI0 A;  3HJC A; 
#chains in the Genus database with same CATH homology
 1NU7 D;  2R7T A;  4LER A;  2QY9 A;  1OKK D;  3NYL A;  2WVQ A;  5E33 A;  3RKO F;  3B9Q A;  3CZ6 A;  5EHH A;  2KNH A;  3AG2 C;  2WZF A;  4JZA A;  1LKX A;  3K7D A;  2LSE A;  2QTV A;  5E2Q A;  3S28 A;  4PK4 A;  2R7U A;  4I44 A;  2FGY A;  1TWA A;  2HV6 A;  3M1C B;  1WGW A;  4OIN F;  3HLZ A;  5KYY A;  4BEJ A;  4YT2 A;  3EFO B;  4XLP F;  3DJU B;  2VB6 A;  3DAG A;  3ABM C;  3NG1 A;  1ZU5 A;  2Y3G A;  3EGX A;  3KH2 A;  4PFO A;  2I8B A;  4FWV A;  1SZI A;  4BJ5 C;  1QLE C;  1TWC A;  3LNR A;  1O87 A;  3QZC A;  4WJ0 A;  3VAY A;  1ZHY A;  2ZXP A;  3EGD A;  4E7S A;  2P6V A;  4U5B E;  2Y3B A;  4QDL A;  3DM5 A;  1FTS A;  2J7P A;  3L34 A;  3OEO A;  2YHS A;  3F47 A;  3PHF 2;  4Q5S F;  3SNH A;  4C3D A;  3EHN A;  3NKE A;  5L3V A;  3LEV A;  1D0Z A;  4U5C E;  4JUR I;  1KU2 A;  3EZH A;  3K33 A;  3K1H A;  4CS7 A;  3LAY A;  3W8I A;  3W8H A;  1OCZ C;  3ASN C;  3UMI A;  3LS1 A;  2PF4 E;  2Q9B A;  3ZVR A;  4E7Z A;  4EWC A;  2W4B A;  4GEH A;  2DYR C;  5E3C A;  2ZXO A;  2IXO A;  2VH3 A;  4HEA J;  4A2N B;  2J0X A;  4RDA A;  2IXM A;  4K7B A;  2C03 A;  2JD3 A;  2X51 A;  4KBL A;  2Y3D A;  3VYW A;  3DAF A;  3O39 A;  4ANJ A;  1FMW A;  2IXP A;  4B6I A;  4LLC A;  4OIR F;  5KYY B;  3N0T A;  2R7V A;  2ZPA A;  3MLG A;  1VYK A;  4H4K C;  2DGJ A;  1OCC C;  3ZSU A;  2A68 F;  4XWJ A;  3AG4 C;  2H7V C;  3ECS A;  4P6I C;  4ZLD A;  4N06 A;  1ZYR F;  5DVW A;  2R7R A;  2L9J A;  2NUP B;  1LS1 A;  1M2O A;  5DS6 A;  4KI2 A;  2Q9A A;  2KJG A;  3ABK C;  3KMI A;  1ST6 A;  4YT4 A;  1G8X A;  4G0H A;  5T3T A;  3HTK C;  3AG1 C;  3RH3 A;  4CBE A;  4J30 B;  4HFK B;  2YZS A;  3O6X A;  4OD4 A;  4LLE A;  4M63 A;  2NUP A;  4MQ9 F;  3T4R A;  1TWG A;  3CQZ A;  5D92 A;  2ZXW C;  4KNW A;  1JPJ A;  2A6E F;  3FHD A;  3H65 A;  3PMR A;  4U5F E;  3EQL F;  4RBN A;  3S27 A;  4OD5 A;  5F5F A;  3DM9 B;  3W2W A;  3JCU Q;  3SZR A;  4JW1 A;  3EGD B;  3KKB A;  2W4M A;  1D1B A;  2E87 A;  5B1B C;  4HFF B;  1OCR C;  3DD7 A;  3B0P A;  2IXN A;  4C3E A;  3DMD A;  4K0D A;  2V26 A;  2G3K A;  3I4U A;  3FVY A;  5B1A C;  2YEV A;  2CW0 F;  2IOQ A;  3AQC A;  3Q7L A;  4BJ1 A;  4FX5 A;  3EG9 A;  1BR4 A;  2PX3 A;  2Q3T A;  2CDQ A;  4C3B A;  4CS8 C;  4OIO F;  4JVS A;  2C04 A;  2KW3 C;  3B0U X;  1FFH A;  1O5H A;  4U5G A;  3OWT A;  4CIH A;  4IJJ A;  3GAN A;  1RJ9 B;  4O7G A;  4AE4 A;  1LVK A;  5T1D B;  3X1O A;  3EH1 A;  1VMA A;  3K1I C;  1ZHX A;  2MYS A;  2CNW D;  3QMK A;  2EIM C;  3NKD A;  4AK9 A;  4CSA A;  1NG1 A;  2EIJ C;  3ITF A;  1MMN A;  2R7O A;  4J32 B;  3UMH A;  1V55 C;  4AX2 A;  2CNW A;  4I1M A;  1IW7 F;  3F46 A;  3K6B A;  3JSZ A;  2G3V A;  3WOD F;  3UR3 C;  3Q6M A;  4DVZ A;  1PCX A;  2A1D D;  3IEE A;  2B0J A;  2HV7 A;  2H7O A;  4QI2 A;  2R7W A;  2A69 F;  3RIP A;  5KYW B;  5DS5 A;  2J45 A;  1M56 C;  2DYS C;  4PFP A;  5E3A A;  5D91 A;  2WVN A;  5BUO A;  3MX3 A;  3AG3 C;  3V7O A;  4G7H F;  1ZHW A;  1D0Y A;  2J46 A;  2Z15 A;  1Z63 A;  3EZI A;  3DXJ F;  1FMV A;  1VOM A;  1PD1 A;  4CS9 C;  1FFT C;  2VAS A;  1J8Y F;  5DLJ A;  3FDQ A;  4PJJ A;  5KYW A;  2WB7 A;  4KNV A;  1MMA A;  3NYM A;  3TD7 A;  5DS4 A;  2W9Y A;  3EFO A;  3N24 A;  2EIK C;  2A6H F;  3KL4 A;  2W45 A;  2OG2 A;  2H7B A;  4FES A;  3SEO A;  1TWH A;  5T3W A;  4YT5 A;  3T6B A;  3NDB B;  1J8M F;  3X2Q C;  4U5H A;  4PJM A;  2XRH A;  2WL8 A;  3ASO C;  4BJT A;  4DBQ A;  2Y3H A;  1NZE A;  2ZXR A;  1D1A A;  4U5D E;  3UMK A;  4C7O A;  5KYX B;  1D1C A;  1M2V B;  4MND A;  2PFD A;  4Q4Z F;  3S29 A;  1QZX A;  4HE8 D;  3LJB A;  3LES A;  1VYI A;  4OIP F;  4W8K A;  2NUT B;  5KYU A;  5IY5 C;  3JYH A;  1BR2 A;  3FAJ A;  4AE4 B;  3UGO A;  1N1C A;  2NG1 A;  2FFH A;  5B3S C;  1W2W A;  4XLN F;  4YJW A;  3WG7 C;  4YT8 A;  2XXA B;  3DZA A;  1Z3I X;  4BJ6 A;  4O6Y A;  2NUT A;  2Y39 A;  3L0I A;  3OA1 A;  2IYL D;  3NYJ A;  4JJG A;  1MMD A;  3T6J A;  3I5P A;  1Z5Z A;  2BE5 F;  3AQB A;  1M57 C;  3Q7G A;  4X0R A;  4YWQ A;  2R7Q A;  4I1O B;  2XL4 A;  4BJ5 A;  3K66 A;  4KC9 A;  2PP4 A;  4JCH A;  3CSK A;  1IZM A;  4O6N A;  1MNE A;  3JT1 A;  4LAC B;  3ABL C;  3N2Z B;  2V3C C;  5KYN A;  4IRU A;  1ZU4 A;  4IWB A;  4U5E E;  3EHM A;  5HSW A;  4Q7C A;  3E9V A;  1ZHT A;  4I3M A;  1TR2 A;  2G62 A;  2WVO A;  4F4B A;  2MWQ A;  2PX0 A;  4PJN A;  2KQ9 A;  4G7O F;  4DOZ A;  1Z23 A;  3Q6N A;  2WZG A;  2EIN C;  3EH2 A;  4YN0 B;  3UNG C;  4GYT A;  3I5Q A;  5DQZ A;  5KYX A;  5CI9 A;  2P7V A;  4DVY P;  3B0V C;  2EIL C;  3S0X A;  1OKK A;  5F5H A;  2O9X A;  2Y69 C;  3LLK A;  1TKN A;  5KYU B;  3RFY A;  1D0X A;  3EPV A;  2XSE A;  2WZL A;  4NY3 A;  1V54 C;  2XXA A;  2OCC C;  2CGE A;  2GFH A;  2J7P D;  1ZHZ A;  4BJ6 C;  1BR1 A;  3EJN A;  5CI8 A;  3LLI A;  4CS8 A;  5EGY A;  4XTK A;  4DBR A;  5L3Q A;  4EBB A;  2L81 A;  1NU9 C;  1RJ9 A;  1JPN A;  4CS9 A;  1MMG A;  3SYN A;  4PJL A;  1MND A;  2Q9C A;  4C7O B;  3EGX B;  1M2V A;  3E70 C;  5FCL A;  1Z6A A;  2J9U A;  4OIQ F;  3DJN B;  5DQT A;  3LS0 A;  1SMY F;  2M4E A;  4IAO A;  3JRT A;  3RYL A;  2R7S A;  3GOD A;  2R7X A;  3NRH A;  2J9W A;  3ZG1 A;  3UGP A;  1SF8 A;  4CSA C;  3SP1 A;  4O79 A;  1S7Z A;  2KGO A;  1VK5 A;  3EG9 B;  4O6M A;  4RD9 A;  4ZLC A;  2J0W A;  3POV A;  3ZC4 A;  4BG0 A;  4JJF A;  2D5R B;  3W2V A;  4G7Z F;  1OCO C;  3ZIB A;  4ULW A;  2J9V A;  1PD0 A;  4QI0 A;  3HJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...