2KJGA

Solution structure of an archaeal protein sso6904 from hyperthermophilic sulfolobus solfataricus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
MSILEDPEFVKLRQFKGKVNFNLVMQILDEIELDLRGSDNIKTSIIYVYSSHLDEIRKNKEFYDMIAEILQRYYKKIGIENVNQLILTTIKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Archaeal protein SSO6904
publication title Solution structure and calcium binding of protein SSO6904 from the hyperthermophilic archaeon Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Metal binding protein
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18249 Ca_bind_SSO6904 Calcium binding protein SSO6904
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.970 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2kjgA00
2KJGA
chains in the Genus database with same CATH superfamily
4AL1A 4BJ5A 5JRAA 4Q5SF 1GM5A 4OD4A 1V4AA 2V26A 4DRJB 3SEOA 5L0JA 4A2NB 3DM9B 1M2VB 1S7ZA 1J8MF 1KNYA 3B9QA 5KYXA 4OD5A 2H8AA 2G3KA 2G62A 2P1AA 2XLMA 4KBLA 2Q9AA 3UMIA 1T6QA 2Q00A 3VM6A 1Z63A 2Q9BA 3NYLA 2F22A 5T3WA 5DQTA 2IYLD 4J7YA 3K1HA 2VH3A 1HMOA 4XLNF 3NKDA 5E2QA 4YT8A 2QNLA 4PK4A 1NSGB 3RVYA 1NFNA 2J0XA 2ZXPA 2NUPB 5T1DB 1AEPA 2RSEB 4EIYA 1HE9A 3GM3A 2M64A 4DVZA 2XLDA 5AC4A 2VCCA 2XXAB 5A69A 1F1MA 4GQHA 3GEIA 4U5DE 3AG2C 2Q9CA 4BJTA 5JT4A 3PHF2 2H7OA 2KYHA 2NG1A 2A6EF 3NMKA 3Q7LA 4Q4ZF 1KU2A 4JIOA 2HFIA 4H54A 1QPUA 1PV3A 1TQGA 2ETSA 3KPHA 4IWBA 4E7SA 3B0UX 4EHPA 1TWGA 3J06A 4CSAC 3ZG1A 3NMJA 1MMGA 5B3IA 3E70C 1OW6A 3JSZA 4YT4A 4IB4A 3S90A 1S05A 2NSFA 1ZYRF 2NUTB 1CGME 4JKVA 3WHNA 3EZHA 4CBEA 4BPMA 2HKVA 1LS1A 2PX0A 3LLIA 2KNHA 4CS9A 2X51A 3R7CA 3EFOA 3S9OA 2R7XA 2R7OA 3CEXA 2KK1A 1FMWA 2LCHA 3ZVRA 4U5GA 4G7OF 2A6HF 1I4YA 1Q0MA 3DWWA 4JEBA 2MHRA 3G4ZA 4PJMA 4ZLCA 1B68A 5BQHA 1O3UA 3JRTA 3H65A 3HNJA 1EQ1A 3K33A 1RKEB 5DVWA 2AVKA 1OCRC 2LD6A 3FOOA 2YL1A 1RJ9A 3DE8A 3G4XA 2Y3DA 1W2WA 2BE5F 4ER9A 4E7ZA 2P61A 4O6MA 1O87A 2R7UA 1D0ZA 4DRIB 3NMIA 2XLEA 2DGJA 4HEAJ 5GPGB 2Y39A 2CGEA 4CJGA 1T9KA 1Q0DA 2EIMC 4CDAA 256BA 1GGQA 2LQGA 2RD9A 3FMSA 1YYJA 3M15A 3O55A 3MLGA 3HNKA 5DLJA 3AG1C 3LS1A 3MBGA 4IRUA 2QLAA 3WG7C 4CS9C 3FDQA 4N4WA 5KYXB 1D1AA 1G8XA 2LP4A 3IHUA 4MS2A 3S0XA 1T01A 3F47A 3GEEA 2XLVA 2YEVA 2EINC 4YT5A 4NTBA 2CCYA 4MVRA 1ZU5A 2NSGA 4MVOA 4XWJA 3S29A 3U2MA 3TJ5A 4AK9A 2AWYA 5HSWA 4NY3A 1VYIA 3LEOA 3DKAA 4DBRA 4DBQA 1JR8A 4IAQA 3BRJA 5JUAA 4XTKA 4P6IC 1T6UA 3SYNA 4CDYA 3K1IA 3ABLC 2WL8A 3K7DA 2WB7A 3ATPA 4LDQA 4RBNA 1V55C 3W8IA 1YARO 2R02A 4FWVA 1K05A 4R32A 3DAGA 2D5RB 2EIJC 4BJ6A 4YN0B 3NG1A 4CS7A 5CI9A 1WN0A 5JVEA 1HY5A 2NPUA 2ZD9A 2HMZA 2ZXRA 3AJMA 3JZ0A 2P0NA 3EGDA 3I5QA 3RH3A 3VAYA 1H9TA 3US6A 3JSEO 3KKBA 4N06A 3TJ6A 2A68F 3JYYA 4XEFA 3O10A 3B0VC 3W2VA 5CIVA 4KNWA 1QLEC 4C3BA 3M4CA 1A7EA 5KYNA 2XM0A 1MQVA 2LSEA 4WGYA 2B0HA 3IQ5A 3K66A 4J32B 3K1IC 3S27A 2CW0F 4N6CA 3ZDLA 4BEMJ 5HV9A 1QVXA 3EFOB 3T6BA 1LKXA 2CDQA 2M4EA 3T4RA 3HLZA 4CIPA 3DJUB 1AUEA 1U6HA 1C02A 2BC5A 2EIKC 1JAFA 2VC9A 1OCZC 1QSPA 3FAPB 3LJBA 3LNRA 4HFKB 1ORYA 4BJ6C 3EG9A 3GWLA 5E33A 2XL6A 2P6VA 3GM2A 1WATA 2AU5A 1UFBA 1ZHYA 2KW3C 2VCAA 3C7JA 2X0CA 5BUOA 1SYQA 1M57C 1RJ9B 3Q6NA 3U2LA 2H7BA 2A69F 3EHNA 4EBBA 2J7PD 2LFFA 3EPVA 3ZWIA 2FFHA 2L6GA 2Z15A 1YVIA 3JT1A 4CSAA 4GYTA 1MNDA 4U5HA 1APCA 2LK4A 3KYJA 1I4ZA 1YDIA 2WZGA 1XZQA 3ITFA 4PFPA 5COFA 2WZLA 3AOUA 1VYKA 2WVQA 3ASOC 3QW1A 4N6HA 4A4AA 1E84A 3HKKA 2Y3GA 4AE4B 3SNHA 2OKUA 1BZ4A 4PJLA 3SXMA 1O5HA 4QI2A 1ZZPA 3WAQA 1NU9C 3EGXA 4MVSA 3ZC4A 3RIPA 2J9VA 2XSEA 4EUKB 3I5PA 3T6JA 3GEHA 5E3CA 1FR0A 5CI8A 1ZU4A 2QE9A 2YZSA 1D1CA 4BJ5C 5DS4A 3DAFA 1T6IA 3L1MA 2HJ3A 1NU7D 3FAJA 3Q7GA 1VB5A 4F4BA 5KYYA 1UG7A 1U89A 2VCBA 3RQFA 1TFOB 4P9TA 4G7HF 3HNIA 3LLKA 3HJCA 3L8IA 4ULWA 3V5YA 1RCPA 2XLHA 1VOMA 1K40A 4L6RA 3ASNC 2ZXWC 4Z9JA 5D92A 2QTVA 3C63A 1VK5A 1OKKD 2AP3A 2PNOA 3EGDB 3M1CB 3V7OA 1R4TA 2Q4FA 3L34A 3AQBA 5T3TA 4J7TA 3U3BA 3MX3A 4Z9IA 5JS5A 3FHDA 4X0RA 3U3FA 3DI5A 5EK0A 5KYUA 3S28A 4ZLDA 1WOLA 4YL3A 1Z5ZA 1M6TA 3N2ZB 4C3DA 3DE9A 2R7TA 4HE8D 3A9CA 4PJNA 2JD3A 4JCZA 4EKWA 3KMIA 4YL0A 2Y3HA 5D91A 2XLOA 4W8KA 4B6IA 1YYXA 1H6GA 4LACB 1DOWA 3ECSA 4U5CE 4WJ0A 2OCCC 3DM5A 1OXBA 4MVUA 2GDCA 3LNMB 1Y4CA 3C8ZA 3QVZA 3OEOA 4OIPF 3L0IA 1ZHZA 1U0BB 2J8WA 4JCHA 3O6XA 3SXKA 5F5FA 2Y69C 4JW1A 3C8GD 3GORA 4H4KC 4DRHB 4MVMA 2E87A 4MW3A 1MMNA 5A6BD 3I4UA 1FFHA 3FXHA 2BL2A 4BEJA 1EA8A 1TR2A 1LIHA 1PD0A 1NZEA 3VF0A 1M2OA 4G0HA 5JSLA 2R7WA 4JC7A 2YLIA 5DS6A 4G7ZF 1Q0FA 2A1DD 1IZMA 1GQAA 1OR3A 4KC9A 2YL0A 2EPNA 3H2UA 2L6FA 1C17M 4D4XA 3NDBB 4DJ9A 2PF4E 1GS9A 1NG1A 1YA7O 2G3VA 3CQZA 2XRHA 4U9EA 3SXZA 3QVYA 5B3SC 4C7OA 4WABA 1ZW3A 2KSFA 3EGXB 2D4UA 3TOLA 5L0FA 4BG0A 4KNVA 2WZFA 4JEAA 2V3CC 2KC3A 2XS1A 2KGOA 1QQ3A 3QZCA 4JTAB 1VTMP 3U9JA 3UGPA 2TMVP 1VLTA 3MFNA 1MMAA 3B29A 3O39A 5BQIA 3EZIA 4O6NA 5IY5C 2NUPA 1NFOA 3OA1A 3RW0A 2KQ9A 2Q3TA 2R7QA 3W8HA 4KI2A 1A0BA 1CPQA 1YJGA 2W4BA 1OQCA 1OW8A 2MYSA 1ORSC 4O79A 4XQ1A 1R5ID 5JP7A 1C03A 4O7GA 2W4MA 3VYWA 5KYYB 2H7VC 3L8JA 3Q6MA 4MTOA 1ZW2A 4DXWA 2R7SA 2PFDA 4PR9A 2OJQA 5A6KA 2OOCA 3DD7A 4I44A 4I3MA 2ICWG 4IAOA 4P9FA 1M56C 2W9YA 1XWJA 3UMHA 5B1BC 3NYJA 2J7PA 4ULVA 4GEHA 5L0HA 4IARA 4FAPB 2L9JA 3W4YA 1T5OA 3K6BA 5DQZA 2DYSC 1KTMA 4UDVA 1D1BA 5KYUB 2R03A 4NTAA 4U5EE 3QTHA 5L3VA 4OIOF 1ZVZA 3OWTA 2PX3A 1BR4A 5L3QA 4XEVA 4E0IA 2JPUA 1Z7Qc 3BEHA 1TWHA 4LERA 1TWCA 2XL8A 2HSQA 3G50A 1J8YF 3RQGA 3TQOA 4XPWA 3T9OA 5FCLA 4PJJA 4AX2A 2A0BA 3IQ6A 2WVNA 4JJFA 3E9VA 3DXJF 3N24A 2YLGA 2DYRC 1D0XA 2YLDA 4AL0A 3EQLF 1RKEA 3KH2A 2FGYA 3QMKA 3EH2A 3IEEA 2L7AA 1ORJA 2YRFA 3GANA 3JRMO 4LDRA 4Z9HA 5KYWA 3X2QC 1JPNA 1TWAA 4RD9A 3AG3C 2YKZA 3FVYA 1WTYA 1LVKA 3W2WA 4C3EA 1BR2A 1E86A 1EKYA 3DJNB 1H9GA 4NTFA 2R7VA 2XL4A 2R9RB 5F5HA 4LDKA 3U9MA 4OINF 2QY9A 5JLIA 1RMVA 2OG2A 1SMYF 2IM8A 3NYMA 2LFDA 3UNGC 1FNTc 1OKKA 2EPMX 3V5ZA 1ZHXA 1PCXA 2L6HA 2B0JA 3RF3A 3B71A 3U8PA 2O9XA 3MYFA 3X1OA 1Z6AA 4E17A 1L3PA 3EHMA 3IQCA 2R05A 1DOVA 4PFOA 1MNEA 3NRHA 4C7OB 2CNWD 1TKNA 1YAUO 2J45A 2ZXOA 4BJ1A 2XM4A 1A41A 4MQ9F 4DOZA 5EHHA 4XLPF 3SXYA 2EPKX 5F28E 2OEXA 1JRAA 1CGNA 2YL3A 4JRZA 4JZAA 4I1MA 2OEVA 1VLSA 4I1OB 3JYHA 3V5XA 2J9WA 1OCCC 4FESA 2MWQA 2J0WA 3S84A 4CJOA 2LIGA 3EH1A 2HS5A 5COGA 3LEVA 4O6YA 3JTLO 5K0IA 2YL7A 2R7RA 1ZHWA 2I8BA 3VRCA 3IPMO 1JOGA 1OR2A 3WODF 3HNLA 1BR1A 4JJGA 3TK0A 1H7IA 2HSBA 3H2VA 3B0PA 4G78A 4RDAA 2KJGA 3C8GA 4YJWA 2VASA 5E3AA 2EILC 1HE1A 3TULA 1YA9A 2W45A 1E83A 1SR2A 1MMDA 1WASA 3KL4A 5A6BA 5TJ5E 1YZAA 4W8PA 1QKRA 3A11A 1CPRA 1EI7A 1L7CA 3PCVA 4QDLA 3TOMA 4MVQA 1JMWA 1QZXA 1A7DA 3KYIA 1IW7F 1HMDA 3EG9B 2HJMA 1CGOA 5B1AC 2EPOA 1LS4A 3U5SA 4EBJA 1HW2A 2A0UA 2QUPA 5BQGA 3ZIBA 4JTDB 4EBKA 4EWCA 2P7VA 3NKEA 4U5FE 1A7VA 1I5NA 4OIRF 2Q7RA 2IXOA 3CZ6A 3GM1A 2JX0A 3UMKA 5L0DA 4LLEA 3POVA 2GWWA 1V74B 3RYLA 2GAQA 1FFTC 1YLMA 2GA0A 4M63A 4IGGA 1OW7A 5L0CA 3ZTZA 1E85A 1AVOB 1D0YA 2IXPA 1OXKA 1V54C 1K04A 2UUHA 3M4BA 4J30B 3ZQYA 1LI7A 4E18A 5KYWB 4OIQF 1FTSA 4ANJA 4HFFB 2EPLX 3SZRA 1LI5A 5AC5A 4LLCA 3ABMC 4MTFA 2FAPB 4Q7CA 4K1OA 1M2VA 1NLXA 1G4US 5L0GA 3F46A 2HV6A 2J46A 5L0IA 2PBEA 4JVSA 1G5ZA 1LE2A 2HUJA 2DB4A 4JTCB 1ST6A 2HZ8A 2OQMA 4FX5A 1LPEA 5FZTA 3EJNA 4YWQA 1Y6DA 4XPXA 1BDJB 1WGWA 2J9BA 4U9DA 4AE4A 2YHSA 3T6GB 2XS8A 3LESA 3M79A 3UR3C 2WVOA 3LAYA 2PP4A 3HTKC 1SF8A 2ZPAA 4XPYA 1OCOC 1VMAA 2OU6A 2YVKA 3ABKC 3AG4C 1N1CA 2YQYA 3LS0A 2XXAA 4WGZA 3UGOA 4YK5A 3RQEA 4CX9A 1RXQA 1E2XA 4IJJA 2R25A 3DMDA 1WWPA 3DZAA 2GFHA 2UUIA 4K0DA 3RFYA 2CYDA 1ZHTA 4CS8A 4E0HA 1Z23A 2VB6A 3N0TA 4DVYP 2ASRA 3PMRA 1HW1A 1Z3IX 4YL1A 3IQTA 1XZPA 1LM3B 3AGUA 4MNDA 5COMA 3CAXA 2YWAA 5DS5A 4MVZA 3RKOF 1TFKB 2L81A 2XLWA 1YZCA 2NUTA 4D4NA 1LE4A 4MTGA 3C8GB 1FAPB 2C03A 4NQFA 3CSKA 3R2PA 3TD7A 3U8VA 5A6AA 3GWNA 4QI0A 2Y3BA 2IXNA 1Q0KA 2I15A 4MW8A 3U0CA 4XEKA 3SP1A 3C62A 3ZTMA 3FOPA 4CIHA 1Q0GA 3GODA 3ZSUA 2IBFA 1PD1A 4NCQA 5EGYA 3LUTB 2C04A 4NC3A 1G4WR 4CS8C 4YT2A 2HMQA 1BBHA 3C18A 2CNWA 1NBBA 2J9UA 4U5BE 4PACA 3AQCA 4K7BA 2DI3A 4JURI 3PDMP 3RVZA 2OJED 2HV7A 2IXMA 3AGTA 3MYIA 4ONSA 3JCUQ 3QW0A 1JPJA 1RKCA 2AWCA 2IOQA 4CDVA 1SZIA 5A6JA 4JE9A 1FMVA 3ZQVA 5AGFA
chains in the Genus database with same CATH topology
4Q5SF 4BJ5A 4OD4A 2V26A 3SEOA 4A2NB 3DM9B 1M2VB 1S7ZA 1J8MF 3B9QA 5KYXA 4OD5A 2G3KA 2G62A 4KBLA 2Q9AA 3UMIA 1Z63A 2Q9BA 3NYLA 5T3WA 5DQTA 2IYLD 3K1HA 2VH3A 4XLNF 3NKDA 5E2QA 4YT8A 4PK4A 2J0XA 2ZXPA 2NUPB 5T1DB 4DVZA 2XXAB 4U5DE 3AG2C 2Q9CA 4BJTA 3PHF2 2H7OA 3Q7LA 2NG1A 2A6EF 4Q4ZF 1KU2A 4IWBA 4E7SA 3B0UX 1TWGA 4CSAC 3ZG1A 1MMGA 3E70C 3JSZA 4YT4A 1ZYRF 2NUTB 3EZHA 4CBEA 1LS1A 2PX0A 3LLIA 2KNHA 4CS9A 2X51A 3EFOA 2R7XA 2R7OA 1FMWA 3ZVRA 4U5GA 2A6HF 4PJMA 4ZLCA 3JRTA 3H65A 3K33A 5DVWA 1OCRC 4PJLA 4E7ZA 1RJ9A 2Y3DA 1W2WA 2BE5F 4O6MA 1O87A 2R7UA 1D0ZA 2DGJA 4HEAJ 2Y39A 2CGEA 2EIMC 3MLGA 5DLJA 3AG1C 3LS1A 4IRUA 3WG7C 4CS9C 3FDQA 5KYXB 1D1AA 1G8XA 3S0XA 3F47A 2YEVA 2EINC 4YT5A 1ZU5A 4XWJA 3S29A 4AK9A 4NY3A 1VYIA 4DBRA 4DBQA 4XTKA 4P6IC 3SYNA 3ABLC 2WL8A 3K7DA 2WB7A 4RBNA 1V55C 3W8IA 4FWVA 3DAGA 2D5RB 2EIJC 4BJ6A 4YN0B 3NG1A 4CS7A 5CI9A 2ZXRA 3EGDA 3I5QA 3RH3A 3VAYA 4N06A 3KKBA 2A68F 3B0VC 3W2VA 4KNWA 1QLEC 4C3BA 5KYNA 2LSEA 3K66A 4J32B 3K1IC 3S27A 2CW0F 3EFOB 3T6BA 1LKXA 2CDQA 2M4EA 3T4RA 3HLZA 3DJUB 2EIKC 3LJBA 1OCZC 3LNRA 4BJ6C 4HFKB 3EG9A 5E33A 2P6VA 1ZHYA 2KW3C 5BUOA 1M57C 1RJ9B 3Q6NA 2H7BA 2A69F 3EHNA 4EBBA 2J7PD 3EPVA 2FFHA 2Z15A 3JT1A 4GYTA 1MNDA 4U5HA 2WZGA 3ITFA 4PFPA 2WZLA 1VYKA 2WVQA 3ASOC 2Y3GA 4AE4B 3SNHA 1O5HA 4QI2A 1NU9C 3EGXA 3ZC4A 3RIPA 2J9VA 2XSEA 3I5PA 3T6JA 5E3CA 5CI8A 1ZU4A 2YZSA 1D1CA 4BJ5C 5DS4A 3DAFA 1NU7D 3FAJA 3Q7GA 4F4BA 5KYYA 4G7HF 3LLKA 3HJCA 4ULWA 1VOMA 3ASNC 2ZXWC 5D92A 2QTVA 1VK5A 1OKKD 3V7OA 3EGDB 3M1CB 3L34A 3AQBA 5T3TA 3MX3A 3FHDA 4X0RA 5KYUA 3S28A 4ZLDA 1Z5ZA 3N2ZB 2R7TA 4C3DA 4HE8D 4PJNA 2JD3A 3KMIA 2Y3HA 5D91A 4W8KA 4B6IA 4LACB 4U5CE 3ECSA 4WJ0A 2OCCC 3DM5A 3OEOA 4OIPF 3L0IA 1ZHZA 4JCHA 3O6XA 5F5FA 2Y69C 4JW1A 4H4KC 2E87A 1MMNA 3I4UA 1FFHA 4BEJA 1TR2A 1PD0A 1NZEA 1M2OA 4G0HA 2R7WA 5DS6A 4G7ZF 2A1DD 1IZMA 4KC9A 3NDBB 2PF4E 2G3VA 1NG1A 3CQZA 5B3SC 2XRHA 4C7OA 3EGXB 4BG0A 4KNVA 2WZFA 2V3CC 3QZCA 2KGOA 3UGPA 1MMAA 3O39A 3EZIA 4O6NA 5IY5C 2NUPA 4G7OF 3OA1A 2KQ9A 2Q3TA 2R7QA 3W8HA 4KI2A 2W4BA 2MYSA 4O79A 3VYWA 5KYYB 4O7GA 2W4MA 2H7VC 3Q6MA 2R7SA 2PFDA 3DD7A 4I44A 4I3MA 4IAOA 1M56C 2W9YA 3UMHA 5B1BC 3NYJA 2J7PA 4GEHA 2L9JA 3K6BA 5DQZA 2DYSC 1D1BA 5KYUB 4U5EE 5L3VA 4OIOF 3OWTA 2PX3A 1BR4A 5L3QA 1TWHA 4LERA 1TWCA 1J8YF 5FCLA 4PJJA 4AX2A 2WVNA 4JJFA 3E9VA 3DXJF 3N24A 2DYRC 1D0XA 3EQLF 3KH2A 2FGYA 3QMKA 3EH2A 3IEEA 5KYWA 3GANA 3X2QC 1JPNA 1TWAA 4RD9A 3AG3C 3FVYA 4C3EA 1LVKA 3W2WA 1BR2A 3DJNB 2R7VA 2XL4A 5F5HA 4OINF 2QY9A 2OG2A 1SMYF 3NYMA 3UNGC 1OKKA 1ZHXA 1PCXA 3X1OA 2B0JA 2O9XA 1Z6AA 3EHMA 4PFOA 1MNEA 3NRHA 4C7OB 2CNWD 1TKNA 2J45A 2ZXOA 4DOZA 4BJ1A 4CSAA 4MQ9F 5EHHA 4XLPF 4OIQF 4JZAA 4I1MA 4I1OB 3JYHA 2J9WA 1OCCC 4FESA 2MWQA 2J0WA 3EH1A 3LEVA 4O6YA 2R7RA 1ZHWA 2I8BA 3WODF 1BR1A 4JJGA 3B0PA 4RDAA 2KJGA 4YJWA 2VASA 5E3AA 2EILC 2W45A 1MMDA 3KL4A 4QDLA 1QZXA 1IW7F 3EG9B 5B1AC 3ZIBA 4EWCA 2P7VA 3NKEA 4U5FE 4OIRF 3UMKA 3POVA 2IXOA 3CZ6A 4LLEA 3RYLA 1FFTC 4M63A 1D0YA 2IXPA 4J30B 1V54C 5HSWA 5KYWB 1FTSA 4ANJA 4HFFB 3SZRA 4LLCA 3ABMC 4Q7CA 1M2VA 3F46A 2HV6A 2J46A 4JVSA 1ST6A 4FX5A 3EJNA 4YWQA 1WGWA 4AE4A 2YHSA 3LESA 3UR3C 2WVOA 3LAYA 2PP4A 3HTKC 1SF8A 2ZPAA 1OCOC 1VMAA 3ABKC 3AG4C 3LS0A 1N1CA 2XXAA 3UGOA 4IJJA 3DMDA 3DZAA 2GFHA 4K0DA 3RFYA 1ZHTA 4CS8A 1Z23A 2VB6A 3N0TA 4DVYP 3PMRA 1Z3IX 5DS5A 4MNDA 3RKOF 2L81A 2NUTA 2C03A 3CSKA 3TD7A 4QI0A 2Y3BA 2IXNA 3SP1A 4CIHA 3GODA 3ZSUA 1PD1A 5EGYA 2C04A 4CS8C 4YT2A 2CNWA 2J9UA 4U5BE 3AQCA 4K7BA 4JURI 2HV7A 2IXMA 3JCUQ 1JPJA 2IOQA 1SZIA 1FMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KJG A; 
#chains in the Genus database with same CATH topology
 4AL1 A;  4BJ5 A;  5JRA A;  4Q5S F;  1GM5 A;  4OD4 A;  1V4A A;  2V26 A;  4DRJ B;  3SEO A;  5L0J A;  4A2N B;  3DM9 B;  1M2V B;  1S7Z A;  1J8M F;  1KNY A;  3B9Q A;  5KYX A;  4OD5 A;  2H8A A;  2G3K A;  2G62 A;  2P1A A;  2XLM A;  4KBL A;  2Q9A A;  3UMI A;  1T6Q A;  2Q00 A;  3VM6 A;  1Z63 A;  2Q9B A;  3NYL A;  2F22 A;  5T3W A;  5DQT A;  2IYL D;  4J7Y A;  3K1H A;  2VH3 A;  1HMO A;  4XLN F;  3NKD A;  5E2Q A;  4YT8 A;  2QNL A;  4PK4 A;  1NSG B;  3RVY A;  1NFN A;  2J0X A;  2ZXP A;  2NUP B;  5T1D B;  1AEP A;  2RSE B;  4EIY A;  1HE9 A;  3GM3 A;  2M64 A;  4DVZ A;  2XLD A;  5AC4 A;  2VCC A;  2XXA B;  5A69 A;  1F1M A;  4GQH A;  3GEI A;  4U5D E;  3AG2 C;  2Q9C A;  4BJT A;  5JT4 A;  3PHF 2;  2H7O A;  2KYH A;  2NG1 A;  2A6E F;  3NMK A;  3Q7L A;  4Q4Z F;  1KU2 A;  4JIO A;  2HFI A;  4H54 A;  1QPU A;  1PV3 A;  1TQG A;  2ETS A;  3KPH A;  4IWB A;  4E7S A;  3B0U X;  4EHP A;  1TWG A;  3J06 A;  4CSA C;  3ZG1 A;  3NMJ A;  1MMG A;  5B3I A;  3E70 C;  1OW6 A;  3JSZ A;  4YT4 A;  4IB4 A;  3S90 A;  1S05 A;  2NSF A;  1ZYR F;  2NUT B;  1CGM E;  4JKV A;  3WHN A;  3EZH A;  4CBE A;  4BPM A;  2HKV A;  1LS1 A;  2PX0 A;  3LLI A;  2KNH A;  4CS9 A;  2X51 A;  3R7C A;  3EFO A;  3S9O A;  2R7X A;  2R7O A;  3CEX A;  2KK1 A;  1FMW A;  2LCH A;  3ZVR A;  4U5G A;  4G7O F;  2A6H F;  1I4Y A;  1Q0M A;  3DWW A;  4JEB A;  2MHR A;  3G4Z A;  4PJM A;  4ZLC A;  1B68 A;  5BQH A;  1O3U A;  3JRT A;  3H65 A;  3HNJ A;  1EQ1 A;  3K33 A;  1RKE B;  5DVW A;  2AVK A;  1OCR C;  2LD6 A;  3FOO A;  2YL1 A;  1RJ9 A;  3DE8 A;  3G4X A;  2Y3D A;  1W2W A;  2BE5 F;  4ER9 A;  4E7Z A;  2P61 A;  4O6M A;  1O87 A;  2R7U A;  1D0Z A;  4DRI B;  3NMI A;  2XLE A;  2DGJ A;  4HEA J;  5GPG B;  2Y39 A;  2CGE A;  4CJG A;  1T9K A;  1Q0D A;  2EIM C;  4CDA A;  256B A;  1GGQ A;  2LQG A;  2RD9 A;  3FMS A;  1YYJ A;  3M15 A;  3O55 A;  3MLG A;  3HNK A;  5DLJ A;  3AG1 C;  3LS1 A;  3MBG A;  4IRU A;  2QLA A;  3WG7 C;  4CS9 C;  3FDQ A;  4N4W A;  5KYX B;  1D1A A;  1G8X A;  2LP4 A;  3IHU A;  4MS2 A;  3S0X A;  1T01 A;  3F47 A;  3GEE A;  2XLV A;  2YEV A;  2EIN C;  4YT5 A;  4NTB A;  2CCY A;  4MVR A;  1ZU5 A;  2NSG A;  4MVO A;  4XWJ A;  3S29 A;  3U2M A;  3TJ5 A;  4AK9 A;  2AWY A;  5HSW A;  4NY3 A;  1VYI A;  3LEO A;  3DKA A;  4DBR A;  4DBQ A;  1JR8 A;  4IAQ A;  3BRJ A;  5JUA A;  4XTK A;  4P6I C;  1T6U A;  3SYN A;  4CDY A;  3K1I A;  3ABL C;  2WL8 A;  3K7D A;  2WB7 A;  3ATP A;  4LDQ A;  4RBN A;  1V55 C;  3W8I A;  1YAR O;  2R02 A;  4FWV A;  1K05 A;  4R32 A;  3DAG A;  2D5R B;  2EIJ C;  4BJ6 A;  4YN0 B;  3NG1 A;  4CS7 A;  5CI9 A;  1WN0 A;  5JVE A;  1HY5 A;  2NPU A;  2ZD9 A;  2HMZ A;  2ZXR A;  3AJM A;  3JZ0 A;  2P0N A;  3EGD A;  3I5Q A;  3RH3 A;  3VAY A;  1H9T A;  3US6 A;  3JSE O;  3KKB A;  4N06 A;  3TJ6 A;  2A68 F;  3JYY A;  4XEF A;  3O10 A;  3B0V C;  3W2V A;  5CIV A;  4KNW A;  1QLE C;  4C3B A;  3M4C A;  1A7E A;  5KYN A;  2XM0 A;  1MQV A;  2LSE A;  4WGY A;  2B0H A;  3IQ5 A;  3K66 A;  4J32 B;  3K1I C;  3S27 A;  2CW0 F;  4N6C A;  3ZDL A;  4BEM J;  5HV9 A;  1QVX A;  3EFO B;  3T6B A;  1LKX A;  2CDQ A;  2M4E A;  3T4R A;  3HLZ A;  4CIP A;  3DJU B;  1AUE A;  1U6H A;  1C02 A;  2BC5 A;  2EIK C;  1JAF A;  2VC9 A;  1OCZ C;  1QSP A;  3FAP B;  3LJB A;  3LNR A;  4HFK B;  1ORY A;  4BJ6 C;  3EG9 A;  3GWL A;  5E33 A;  2XL6 A;  2P6V A;  3GM2 A;  1WAT A;  2AU5 A;  1UFB A;  1ZHY A;  2KW3 C;  2VCA A;  3C7J A;  2X0C A;  5BUO A;  1SYQ A;  1M57 C;  1RJ9 B;  3Q6N A;  3U2L A;  2H7B A;  2A69 F;  3EHN A;  4EBB A;  2J7P D;  2LFF A;  3EPV A;  3ZWI A;  2FFH A;  2L6G A;  2Z15 A;  1YVI A;  3JT1 A;  4CSA A;  4GYT A;  1MND A;  4U5H A;  1APC A;  2LK4 A;  3KYJ A;  1I4Z A;  1YDI A;  2WZG A;  1XZQ A;  3ITF A;  4PFP A;  5COF A;  2WZL A;  3AOU A;  1VYK A;  2WVQ A;  3ASO C;  3QW1 A;  4N6H A;  4A4A A;  1E84 A;  3HKK A;  2Y3G A;  4AE4 B;  3SNH A;  2OKU A;  1BZ4 A;  4PJL A;  3SXM A;  1O5H A;  4QI2 A;  1ZZP A;  3WAQ A;  1NU9 C;  3EGX A;  4MVS A;  3ZC4 A;  3RIP A;  2J9V A;  2XSE A;  4EUK B;  3I5P A;  3T6J A;  3GEH A;  5E3C A;  1FR0 A;  5CI8 A;  1ZU4 A;  2QE9 A;  2YZS A;  1D1C A;  4BJ5 C;  5DS4 A;  3DAF A;  1T6I A;  3L1M A;  2HJ3 A;  1NU7 D;  3FAJ A;  3Q7G A;  1VB5 A;  4F4B A;  5KYY A;  1UG7 A;  1U89 A;  2VCB A;  3RQF A;  1TFO B;  4P9T A;  4G7H F;  3HNI A;  3LLK A;  3HJC A;  3L8I A;  4ULW A;  3V5Y A;  1RCP A;  2XLH A;  1VOM A;  1K40 A;  4L6R A;  3ASN C;  2ZXW C;  4Z9J A;  5D92 A;  2QTV A;  3C63 A;  1VK5 A;  1OKK D;  2AP3 A;  2PNO A;  3EGD B;  3M1C B;  3V7O A;  1R4T A;  2Q4F A;  3L34 A;  3AQB A;  5T3T A;  4J7T A;  3U3B A;  3MX3 A;  4Z9I A;  5JS5 A;  3FHD A;  4X0R A;  3U3F A;  3DI5 A;  5EK0 A;  5KYU A;  3S28 A;  4ZLD A;  1WOL A;  4YL3 A;  1Z5Z A;  1M6T A;  3N2Z B;  4C3D A;  3DE9 A;  2R7T A;  4HE8 D;  3A9C A;  4PJN A;  2JD3 A;  4JCZ A;  4EKW A;  3KMI A;  4YL0 A;  2Y3H A;  5D91 A;  2XLO A;  4W8K A;  4B6I A;  1YYX A;  1H6G A;  4LAC B;  1DOW A;  3ECS A;  4U5C E;  4WJ0 A;  2OCC C;  3DM5 A;  1OXB A;  4MVU A;  2GDC A;  3LNM B;  1Y4C A;  3C8Z A;  3QVZ A;  3OEO A;  4OIP F;  3L0I A;  1ZHZ A;  1U0B B;  2J8W A;  4JCH A;  3O6X A;  3SXK A;  5F5F A;  2Y69 C;  4JW1 A;  3C8G D;  3GOR A;  4H4K C;  4DRH B;  4MVM A;  2E87 A;  4MW3 A;  1MMN A;  5A6B D;  3I4U A;  1FFH A;  3FXH A;  2BL2 A;  4BEJ A;  1EA8 A;  1TR2 A;  1LIH A;  1PD0 A;  1NZE A;  3VF0 A;  1M2O A;  4G0H A;  5JSL A;  2R7W A;  4JC7 A;  2YLI A;  5DS6 A;  4G7Z F;  1Q0F A;  2A1D D;  1IZM A;  1GQA A;  1OR3 A;  4KC9 A;  2YL0 A;  2EPN A;  3H2U A;  2L6F A;  1C17 M;  4D4X A;  3NDB B;  4DJ9 A;  2PF4 E;  1GS9 A;  1NG1 A;  1YA7 O;  2G3V A;  3CQZ A;  2XRH A;  4U9E A;  3SXZ A;  3QVY A;  5B3S C;  4C7O A;  4WAB A;  1ZW3 A;  2KSF A;  3EGX B;  2D4U A;  3TOL A;  5L0F A;  4BG0 A;  4KNV A;  2WZF A;  4JEA A;  2V3C C;  2KC3 A;  2XS1 A;  2KGO A;  1QQ3 A;  3QZC A;  4JTA B;  1VTM P;  3U9J A;  3UGP A;  2TMV P;  1VLT A;  3MFN A;  1MMA A;  3B29 A;  3O39 A;  5BQI A;  3EZI A;  4O6N A;  5IY5 C;  2NUP A;  1NFO A;  3OA1 A;  3RW0 A;  2KQ9 A;  2Q3T A;  2R7Q A;  3W8H A;  4KI2 A;  1A0B A;  1CPQ A;  1YJG A;  2W4B A;  1OQC A;  1OW8 A;  2MYS A;  1ORS C;  4O79 A;  4XQ1 A;  1R5I D;  5JP7 A;  1C03 A;  4O7G A;  2W4M A;  3VYW A;  5KYY B;  2H7V C;  3L8J A;  3Q6M A;  4MTO A;  1ZW2 A;  4DXW A;  2R7S A;  2PFD A;  4PR9 A;  2OJQ A;  5A6K A;  2OOC A;  3DD7 A;  4I44 A;  4I3M A;  2ICW G;  4IAO A;  4P9F A;  1M56 C;  2W9Y A;  1XWJ A;  3UMH A;  5B1B C;  3NYJ A;  2J7P A;  4ULV A;  4GEH A;  5L0H A;  4IAR A;  4FAP B;  2L9J A;  3W4Y A;  1T5O A;  3K6B A;  5DQZ A;  2DYS C;  1KTM A;  4UDV A;  1D1B A;  5KYU B;  2R03 A;  4NTA A;  4U5E E;  3QTH A;  5L3V A;  4OIO F;  1ZVZ A;  3OWT A;  2PX3 A;  1BR4 A;  5L3Q A;  4XEV A;  4E0I A;  2JPU A;  1Z7Q c;  3BEH A;  1TWH A;  4LER A;  1TWC A;  2XL8 A;  2HSQ A;  3G50 A;  1J8Y F;  3RQG A;  3TQO A;  4XPW A;  3T9O A;  5FCL A;  4PJJ A;  4AX2 A;  2A0B A;  3IQ6 A;  2WVN A;  4JJF A;  3E9V A;  3DXJ F;  3N24 A;  2YLG A;  2DYR C;  1D0X A;  2YLD A;  4AL0 A;  3EQL F;  1RKE A;  3KH2 A;  2FGY A;  3QMK A;  3EH2 A;  3IEE A;  2L7A A;  1ORJ A;  2YRF A;  3GAN A;  3JRM O;  4LDR A;  4Z9H A;  5KYW A;  3X2Q C;  1JPN A;  1TWA A;  4RD9 A;  3AG3 C;  2YKZ A;  3FVY A;  1WTY A;  1LVK A;  3W2W A;  4C3E A;  1BR2 A;  1E86 A;  1EKY A;  3DJN B;  1H9G A;  4NTF A;  2R7V A;  2XL4 A;  2R9R B;  5F5H A;  4LDK A;  3U9M A;  4OIN F;  2QY9 A;  5JLI A;  1RMV A;  2OG2 A;  1SMY F;  2IM8 A;  3NYM A;  2LFD A;  3UNG C;  1FNT c;  1OKK A;  2EPM X;  3V5Z A;  1ZHX A;  1PCX A;  2L6H A;  2B0J A;  3RF3 A;  3B71 A;  3U8P A;  2O9X A;  3MYF A;  3X1O A;  1Z6A A;  4E17 A;  1L3P A;  3EHM A;  3IQC A;  2R05 A;  1DOV A;  4PFO A;  1MNE A;  3NRH A;  4C7O B;  2CNW D;  1TKN A;  1YAU O;  2J45 A;  2ZXO A;  4BJ1 A;  2XM4 A;  1A41 A;  4MQ9 F;  4DOZ A;  5EHH A;  4XLP F;  3SXY A;  2EPK X;  5F28 E;  2OEX A;  1JRA A;  1CGN A;  2YL3 A;  4JRZ A;  4JZA A;  4I1M A;  2OEV A;  1VLS A;  4I1O B;  3JYH A;  3V5X A;  2J9W A;  1OCC C;  4FES A;  2MWQ A;  2J0W A;  3S84 A;  4CJO A;  2LIG A;  3EH1 A;  2HS5 A;  5COG A;  3LEV A;  4O6Y A;  3JTL O;  5K0I A;  2YL7 A;  2R7R A;  1ZHW A;  2I8B A;  3VRC A;  3IPM O;  1JOG A;  1OR2 A;  3WOD F;  3HNL A;  1BR1 A;  4JJG A;  3TK0 A;  1H7I A;  2HSB A;  3H2V A;  3B0P A;  4G78 A;  4RDA A;  2KJG A;  3C8G A;  4YJW A;  2VAS A;  5E3A A;  2EIL C;  1HE1 A;  3TUL A;  1YA9 A;  2W45 A;  1E83 A;  1SR2 A;  1MMD A;  1WAS A;  3KL4 A;  5A6B A;  5TJ5 E;  1YZA A;  4W8P A;  1QKR A;  3A11 A;  1CPR A;  1EI7 A;  1L7C A;  3PCV A;  4QDL A;  3TOM A;  4MVQ A;  1JMW A;  1QZX A;  1A7D A;  3KYI A;  1IW7 F;  1HMD A;  3EG9 B;  2HJM A;  1CGO A;  5B1A C;  2EPO A;  1LS4 A;  3U5S A;  4EBJ A;  1HW2 A;  2A0U A;  2QUP A;  5BQG A;  3ZIB A;  4JTD B;  4EBK A;  4EWC A;  2P7V A;  3NKE A;  4U5F E;  1A7V A;  1I5N A;  4OIR F;  2Q7R A;  2IXO A;  3CZ6 A;  3GM1 A;  2JX0 A;  3UMK A;  5L0D A;  4LLE A;  3POV A;  2GWW A;  1V74 B;  3RYL A;  2GAQ A;  1FFT C;  1YLM A;  2GA0 A;  4M63 A;  4IGG A;  1OW7 A;  5L0C A;  3ZTZ A;  1E85 A;  1AVO B;  1D0Y A;  2IXP A;  1OXK A;  1V54 C;  1K04 A;  2UUH A;  3M4B A;  4J30 B;  3ZQY A;  1LI7 A;  4E18 A;  5KYW B;  4OIQ F;  1FTS A;  4ANJ A;  4HFF B;  2EPL X;  3SZR A;  1LI5 A;  5AC5 A;  4LLC A;  3ABM C;  4MTF A;  2FAP B;  4Q7C A;  4K1O A;  1M2V A;  1NLX A;  1G4U S;  5L0G A;  3F46 A;  2HV6 A;  2J46 A;  5L0I A;  2PBE A;  4JVS A;  1G5Z A;  1LE2 A;  2HUJ A;  2DB4 A;  4JTC B;  1ST6 A;  2HZ8 A;  2OQM A;  4FX5 A;  1LPE A;  5FZT A;  3EJN A;  4YWQ A;  1Y6D A;  4XPX A;  1BDJ B;  1WGW A;  2J9B A;  4U9D A;  4AE4 A;  2YHS A;  3T6G B;  2XS8 A;  3LES A;  3M79 A;  3UR3 C;  2WVO A;  3LAY A;  2PP4 A;  3HTK C;  1SF8 A;  2ZPA A;  4XPY A;  1OCO C;  1VMA A;  2OU6 A;  2YVK A;  3ABK C;  3AG4 C;  1N1C A;  2YQY A;  3LS0 A;  2XXA A;  4WGZ A;  3UGO A;  4YK5 A;  3RQE A;  4CX9 A;  1RXQ A;  1E2X A;  4IJJ A;  2R25 A;  3DMD A;  1WWP A;  3DZA A;  2GFH A;  2UUI A;  4K0D A;  3RFY A;  2CYD A;  1ZHT A;  4CS8 A;  4E0H A;  1Z23 A;  2VB6 A;  3N0T A;  4DVY P;  2ASR A;  3PMR A;  1HW1 A;  1Z3I X;  4YL1 A;  3IQT A;  1XZP A;  1LM3 B;  3AGU A;  4MND A;  5COM A;  3CAX A;  2YWA A;  5DS5 A;  4MVZ A;  3RKO F;  1TFK B;  2L81 A;  2XLW A;  1YZC A;  2NUT A;  4D4N A;  1LE4 A;  4MTG A;  3C8G B;  1FAP B;  2C03 A;  4NQF A;  3CSK A;  3R2P A;  3TD7 A;  3U8V A;  5A6A A;  3GWN A;  4QI0 A;  2Y3B A;  2IXN A;  1Q0K A;  2I15 A;  4MW8 A;  3U0C A;  4XEK A;  3SP1 A;  3C62 A;  3ZTM A;  3FOP A;  4CIH A;  1Q0G A;  3GOD A;  3ZSU A;  2IBF A;  1PD1 A;  4NCQ A;  5EGY A;  3LUT B;  2C04 A;  4NC3 A;  1G4W R;  4CS8 C;  4YT2 A;  2HMQ A;  1BBH A;  3C18 A;  2CNW A;  1NBB A;  2J9U A;  4U5B E;  4PAC A;  3AQC A;  4K7B A;  2DI3 A;  4JUR I;  3PDM P;  3RVZ A;  2OJE D;  2HV7 A;  2IXM A;  3AGT A;  3MYI A;  4ONS A;  3JCU Q;  3QW0 A;  1JPJ A;  1RKC A;  2AWC A;  2IOQ A;  4CDV A;  1SZI A;  5A6J A;  4JE9 A;  1FMV A;  3ZQV A;  5AGF A; 
#chains in the Genus database with same CATH homology
 4Q5S F;  4BJ5 A;  4OD4 A;  2V26 A;  3SEO A;  4A2N B;  3DM9 B;  1M2V B;  1S7Z A;  1J8M F;  3B9Q A;  5KYX A;  4OD5 A;  2G3K A;  2G62 A;  4KBL A;  2Q9A A;  3UMI A;  1Z63 A;  2Q9B A;  3NYL A;  5T3W A;  5DQT A;  2IYL D;  3K1H A;  2VH3 A;  4XLN F;  3NKD A;  5E2Q A;  4YT8 A;  4PK4 A;  2J0X A;  2ZXP A;  2NUP B;  5T1D B;  4DVZ A;  2XXA B;  4U5D E;  3AG2 C;  2Q9C A;  4BJT A;  3PHF 2;  2H7O A;  3Q7L A;  2NG1 A;  2A6E F;  4Q4Z F;  1KU2 A;  4IWB A;  4E7S A;  3B0U X;  1TWG A;  4CSA C;  3ZG1 A;  1MMG A;  3E70 C;  3JSZ A;  4YT4 A;  1ZYR F;  2NUT B;  3EZH A;  4CBE A;  1LS1 A;  2PX0 A;  3LLI A;  2KNH A;  4CS9 A;  2X51 A;  3EFO A;  2R7X A;  2R7O A;  1FMW A;  3ZVR A;  4U5G A;  2A6H F;  4PJM A;  4ZLC A;  3JRT A;  3H65 A;  3K33 A;  5DVW A;  1OCR C;  4PJL A;  4E7Z A;  1RJ9 A;  2Y3D A;  1W2W A;  2BE5 F;  4O6M A;  1O87 A;  2R7U A;  1D0Z A;  2DGJ A;  4HEA J;  2Y39 A;  2CGE A;  2EIM C;  3MLG A;  5DLJ A;  3AG1 C;  3LS1 A;  4IRU A;  3WG7 C;  4CS9 C;  3FDQ A;  5KYX B;  1D1A A;  1G8X A;  3S0X A;  3F47 A;  2YEV A;  2EIN C;  4YT5 A;  1ZU5 A;  4XWJ A;  3S29 A;  4AK9 A;  4NY3 A;  1VYI A;  4DBR A;  4DBQ A;  4XTK A;  4P6I C;  3SYN A;  3ABL C;  2WL8 A;  3K7D A;  2WB7 A;  4RBN A;  1V55 C;  3W8I A;  4FWV A;  3DAG A;  2D5R B;  2EIJ C;  4BJ6 A;  4YN0 B;  3NG1 A;  4CS7 A;  5CI9 A;  2ZXR A;  3EGD A;  3I5Q A;  3RH3 A;  3VAY A;  4N06 A;  3KKB A;  2A68 F;  3B0V C;  3W2V A;  4KNW A;  1QLE C;  4C3B A;  5KYN A;  2LSE A;  3K66 A;  4J32 B;  3K1I C;  3S27 A;  2CW0 F;  3EFO B;  3T6B A;  1LKX A;  2CDQ A;  2M4E A;  3T4R A;  3HLZ A;  3DJU B;  2EIK C;  3LJB A;  1OCZ C;  3LNR A;  4BJ6 C;  4HFK B;  3EG9 A;  5E33 A;  2P6V A;  1ZHY A;  2KW3 C;  5BUO A;  1M57 C;  1RJ9 B;  3Q6N A;  2H7B A;  2A69 F;  3EHN A;  4EBB A;  2J7P D;  3EPV A;  2FFH A;  2Z15 A;  3JT1 A;  4GYT A;  1MND A;  4U5H A;  2WZG A;  3ITF A;  4PFP A;  2WZL A;  1VYK A;  2WVQ A;  3ASO C;  2Y3G A;  4AE4 B;  3SNH A;  1O5H A;  4QI2 A;  1NU9 C;  3EGX A;  3ZC4 A;  3RIP A;  2J9V A;  2XSE A;  3I5P A;  3T6J A;  5E3C A;  5CI8 A;  1ZU4 A;  2YZS A;  1D1C A;  4BJ5 C;  5DS4 A;  3DAF A;  1NU7 D;  3FAJ A;  3Q7G A;  4F4B A;  5KYY A;  4G7H F;  3LLK A;  3HJC A;  4ULW A;  1VOM A;  3ASN C;  2ZXW C;  5D92 A;  2QTV A;  1VK5 A;  1OKK D;  3V7O A;  3EGD B;  3M1C B;  3L34 A;  3AQB A;  5T3T A;  3MX3 A;  3FHD A;  4X0R A;  5KYU A;  3S28 A;  4ZLD A;  1Z5Z A;  3N2Z B;  2R7T A;  4C3D A;  4HE8 D;  4PJN A;  2JD3 A;  3KMI A;  2Y3H A;  5D91 A;  4W8K A;  4B6I A;  4LAC B;  4U5C E;  3ECS A;  4WJ0 A;  2OCC C;  3DM5 A;  3OEO A;  4OIP F;  3L0I A;  1ZHZ A;  4JCH A;  3O6X A;  5F5F A;  2Y69 C;  4JW1 A;  4H4K C;  2E87 A;  1MMN A;  3I4U A;  1FFH A;  4BEJ A;  1TR2 A;  1PD0 A;  1NZE A;  1M2O A;  4G0H A;  2R7W A;  5DS6 A;  4G7Z F;  2A1D D;  1IZM A;  4KC9 A;  3NDB B;  2PF4 E;  2G3V A;  1NG1 A;  3CQZ A;  5B3S C;  2XRH A;  4C7O A;  3EGX B;  4BG0 A;  4KNV A;  2WZF A;  2V3C C;  3QZC A;  2KGO A;  3UGP A;  1MMA A;  3O39 A;  3EZI A;  4O6N A;  5IY5 C;  2NUP A;  4G7O F;  3OA1 A;  2KQ9 A;  2Q3T A;  2R7Q A;  3W8H A;  4KI2 A;  2W4B A;  2MYS A;  4O79 A;  3VYW A;  5KYY B;  4O7G A;  2W4M A;  2H7V C;  3Q6M A;  2R7S A;  2PFD A;  3DD7 A;  4I44 A;  4I3M A;  4IAO A;  1M56 C;  2W9Y A;  3UMH A;  5B1B C;  3NYJ A;  2J7P A;  4GEH A;  2L9J A;  3K6B A;  5DQZ A;  2DYS C;  1D1B A;  5KYU B;  4U5E E;  5L3V A;  4OIO F;  3OWT A;  2PX3 A;  1BR4 A;  5L3Q A;  1TWH A;  4LER A;  1TWC A;  1J8Y F;  5FCL A;  4PJJ A;  4AX2 A;  2WVN A;  4JJF A;  3E9V A;  3DXJ F;  3N24 A;  2DYR C;  1D0X A;  3EQL F;  3KH2 A;  2FGY A;  3QMK A;  3EH2 A;  3IEE A;  5KYW A;  3GAN A;  3X2Q C;  1JPN A;  1TWA A;  4RD9 A;  3AG3 C;  3FVY A;  4C3E A;  1LVK A;  3W2W A;  1BR2 A;  3DJN B;  2R7V A;  2XL4 A;  5F5H A;  4OIN F;  2QY9 A;  2OG2 A;  1SMY F;  3NYM A;  3UNG C;  1OKK A;  1ZHX A;  1PCX A;  3X1O A;  2B0J A;  2O9X A;  1Z6A A;  3EHM A;  4PFO A;  1MNE A;  3NRH A;  4C7O B;  2CNW D;  1TKN A;  2J45 A;  2ZXO A;  4DOZ A;  4BJ1 A;  4CSA A;  4MQ9 F;  5EHH A;  4XLP F;  4OIQ F;  4JZA A;  4I1M A;  4I1O B;  3JYH A;  2J9W A;  1OCC C;  4FES A;  2MWQ A;  2J0W A;  3EH1 A;  3LEV A;  4O6Y A;  2R7R A;  1ZHW A;  2I8B A;  3WOD F;  1BR1 A;  4JJG A;  3B0P A;  4RDA A;  2KJG A;  4YJW A;  2VAS A;  5E3A A;  2EIL C;  2W45 A;  1MMD A;  3KL4 A;  4QDL A;  1QZX A;  1IW7 F;  3EG9 B;  5B1A C;  3ZIB A;  4EWC A;  2P7V A;  3NKE A;  4U5F E;  4OIR F;  3UMK A;  3POV A;  2IXO A;  3CZ6 A;  4LLE A;  3RYL A;  1FFT C;  4M63 A;  1D0Y A;  2IXP A;  4J30 B;  1V54 C;  5HSW A;  5KYW B;  1FTS A;  4ANJ A;  4HFF B;  3SZR A;  4LLC A;  3ABM C;  4Q7C A;  1M2V A;  3F46 A;  2HV6 A;  2J46 A;  4JVS A;  1ST6 A;  4FX5 A;  3EJN A;  4YWQ A;  1WGW A;  4AE4 A;  2YHS A;  3LES A;  3UR3 C;  2WVO A;  3LAY A;  2PP4 A;  3HTK C;  1SF8 A;  2ZPA A;  1OCO C;  1VMA A;  3ABK C;  3AG4 C;  3LS0 A;  1N1C A;  2XXA A;  3UGO A;  4IJJ A;  3DMD A;  3DZA A;  2GFH A;  4K0D A;  3RFY A;  1ZHT A;  4CS8 A;  1Z23 A;  2VB6 A;  3N0T A;  4DVY P;  3PMR A;  1Z3I X;  5DS5 A;  4MND A;  3RKO F;  2L81 A;  2NUT A;  2C03 A;  3CSK A;  3TD7 A;  4QI0 A;  2Y3B A;  2IXN A;  3SP1 A;  4CIH A;  3GOD A;  3ZSU A;  1PD1 A;  5EGY A;  2C04 A;  4CS8 C;  4YT2 A;  2CNW A;  2J9U A;  4U5B E;  3AQC A;  4K7B A;  4JUR I;  2HV7 A;  2IXM A;  3JCU Q;  1JPJ A;  2IOQ A;  1SZI A;  1FMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...