2KJGA

Solution structure of an archaeal protein sso6904 from hyperthermophilic sulfolobus solfataricus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
b'MSILEDPEFVKLRQFKGKVNFNLVMQILDEIELDLRGSDNIKTSIIYVYSSHLDEIRKNKEFYDMIAEILQRYYKKIGIENVNQLILTTIKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Archaeal protein SSO6904
publication title Solution structure and calcium binding of protein SSO6904 from the hyperthermophilic archaeon Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Metal binding protein
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18249 Ca_bind_SSO6904 Calcium binding protein SSO6904
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.970 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2kjgA00
2KJGA
chains in the Genus database with same CATH superfamily
3CAXA 1VYIA 1G4WR 1TFOB 1BBHA 5T1DB 2M4EA 4PFPA 1CGNA 3RW0A 3Q6MA 3C7JA 4PFOA 3ITFA 4XLPF 2EPLX 4EBJA 3ECSA 3FXHA 3G50A 2CCYA 1Q0GA 3G4XA 2DI3A 2OKUA 3TQOA 1T01A 4NTBA 3PDMP 2MWQA 3DE8A 2DB4A 256BA 2OOCA 1U0BB 3C8ZA 2X51A 3H2UA 1OCOC 4YT2A 3VM6A 3KYJA 2J0XA 4YK5A 3R7CA 4EWCA 2CW0F 1ZZPA 4O6NA 4OD4A 1U6HA 1PD1A 1VB5A 1TWAA 2YLIA 4PJNA 3W2VA 2V3CC 3ABKC 4CX9A 4PACA 2HZ8A 4C7OA 1FFHA 3B0PA 1K05A 4U5GA 2J9WA 1NFNA 1YYXA 4NTAA 3ZSUA 1QSPA 2VH3A 2XL8A 3AJMA 2YL1A 3EGDB 4HE8D 1H7IA 4PJMA 4YN0B 3SNHA 5T3TA 4AX2A 5KYYA 4IAQA 1YZAA 2GFHA 4YT4A 1APCA 4YJWA 3GWNA 1KU2A 2P61A 2R7VA 2VC9A 3DM9B 2A6EF 5DVWA 3H2VA 4ULVA 3O55A 4JZAA 2NG1A 1TWHA 3UMHA 1GGQA 3TULA 2LIGA 5E3CA 3ASNC 4MW8A 5TJ5E 2IXMA 2L6GA 4EUKB 3UGPA 1Y6DA 1S05A 3B71A 2L6FA 5KYXB 4O79A 3OWTA 1LS1A 2BL2A 1ZW2A 4BEMJ 1D1AA 5L0IA 3AOUA 1O3UA 2WZGA 2AWCA 1EA8A 2BE5F 2WVNA 3RIPA 4MVSA 4LLEA 3NYJA 3KKBA 3EG9A 3BRJA 3CSKA 2XM4A 3LEOA 3WG7C 4AL0A 4WGZA 2WVQA 3F47A 1Z6AA 2XLDA 3ATPA 4CDAA 1YZCA 4QI2A 1NU7D 4B6IA 5L0JA 4J7TA 1GQAA 1XZPA 4XPWA 2JD3A 1MNEA 1V55C 2ETSA 1NZEA 4IB4A 3SEOA 4RDAA 5DS5A 4D4XA 1QVXA 2XS8A 2GAQA 3GM3A 3NKEA 2HS5A 3A9CA 4DJ9A 2EPKX 3LS1A 3H65A 4KNVA 4EBBA 3AG2C 4YWQA 1YAUO 3DE9A 4ER9A 1G4US 2OEXA 3JCUQ 4K1OA 3TD7A 2RD9A 1Q0FA 2J9BA 3W8IA 4CS9A 4E18A 1MNDA 5EGYA 3SXZA 2R7XA 2HMZA 1WWPA 3FMSA 4GQHA 2QY9A 4FAPB 3S0XA 1VK5A 1JRAA 3SXYA 3KL4A 3AQBA 2CNWA 2OU6A 2LFFA 4DVZA 5L0DA 4G7HF 1BR2A 2J7PD 2KC3A 2ZXRA 4CSAA 1OKKA 4IGGA 4PK4A 2KQ9A 3HTKC 4JTCB 5BQHA 1MMAA 1FFTC 3DI5A 4I1OB 2Z15A 3U3FA 2YQYA 4JIOA 2G3VA 1DOWA 4EIYA 1I4YA 2PFDA 2YHSA 1I4ZA 3IQ6A 2VASA 2XLEA 4C3BA 4A2NB 4XEKA 1YA9A 1Z3IX 2CGEA 2ZXOA 4IARA 4I3MA 3ZG1A 3V7OA 1M56C 3T6BA 2GWWA 4I44A 3GWLA 1V4AA 1ZW3A 2B0HA 2HV6A 2ZPAA 3QMKA 1ZU5A 4BJ6A 4ANJA 5A6BD 2W4BA 2HJMA 3DMDA 2D4UA 4JTDB 4ULWA 3W4YA 5L3VA 2IBFA 1WOLA 5A6JA 2J0WA 1MMGA 2A0UA 2DYRC 3EHNA 2YL0A 3FHDA 3RH3A 4LDQA 4CSAC 2B0JA 3FDQA 2QE9A 1D1BA 3DAGA 2NPUA 1LPEA 3DJUB 4G7OF 3VRCA 1XZQA 2EILC 2PNOA 3ZQYA 4LDKA 3T4RA 1T6QA 1RCPA 3CEXA 2CYDA 4LLCA 4U5BE 3LLIA 1TQGA 2WZFA 3DM5A 4RD9A 2PX3A 1QPUA 2EPNA 3ABLC 4DVYP 1RKCA 1BZ4A 3HNIA 4G78A 2YL3A 1WATA 3R2PA 4YL3A 1H6GA 1RKEB 1Q0MA 3L8IA 1MQVA 2LSEA 2H7OA 5JSLA 1NLXA 1D1CA 1MMNA 3CZ6A 3N2ZB 3NRHA 4JRZA 2YL7A 4XPYA 4BJ6C 3U2LA 3Q7GA 1TKNA 1C03A 2XSEA 3FAJA 1M2VA 1Z5ZA 5A6AA 1EI7A 1K04A 1ORSC 1PV3A 1SYQA 3T6GB 4K0DA 3UR3C 3WODF 4MQ9F 3JRTA 2YEVA 3NYMA 3DKAA 4JCZA 5COGA 2KK1A 1SZIA 4MVQA 1QLEC 4NTFA 2QUPA 5KYWA 3VAYA 3TOMA 5COMA 1ST6A 3B0UX 1KNYA 2NUPB 2R7OA 2IM8A 3HNKA 1NBBA 3F46A 3ZTMA 2R25A 4AL1A 1R4TA 2IXNA 4J30B 4O6MA 4Z9HA 4CJGA 3LS0A 1LI7A 4P9FA 1ZHYA 1ZHWA 2XRHA 3L8JA 4KNWA 3QVZA 1VYKA 1M57C 1ORJA 3U8VA 1LI5A 5F5HA 3IEEA 3C62A 3PMRA 3N0TA 4N6CA 4NC3A 1RXQA 4P6IC 5COFA 3L34A 1JPJA 1C02A 5AC4A 1ZYRF 1OCZC 2OEVA 4U9DA 5E3AA 1ZVZA 1D0XA 2F22A 4YL1A 2IYLD 5KYUA 1RMVA 1C17M 1F1MA 2J9VA 2YKZA 1AEPA 2LK4A 3GODA 3ZDLA 3NYLA 2C03A 5A6KA 1A7VA 4MW3A 2D5RB 4H4KC 3NG1A 5D92A 4GEHA 3TJ6A 4DRHB 4YT8A 3K1HA 1D0YA 3AQCA 4IRUA 3JRMO 3JYYA 4PR9A 1A7EA 3GEHA 1Z63A 1OCCC 2EIMC 3ZC4A 1QZXA 4JKVA 3LNRA 4J7YA 3M4BA 3U9MA 3SYNA 1OXBA 3EFOB 3I4UA 3L1MA 3QW1A 5AGFA 1UFBA 1LKXA 3FVYA 4U5DE 4IAOA 2V26A 2ZXPA 2AVKA 1NSGB 2KJGA 4FWVA 4KC9A 1HW1A 3RYLA 1KTMA 2AU5A 3V5XA 5B3SC 5KYNA 3LLKA 3HJCA 3CQZA 4BG0A 4BEJA 3SZRA 2R7UA 1YA7O 4Z9IA 2CDQA 2Y3DA 1RJ9B 2WB7A 2PBEA 3RVYA 3KMIA 2E87A 3EGXA 1K40A 4NCQA 3T6JA 2J7PA 2KGOA 2A1DD 2IXOA 3K66A 4DOZA 5DLJA 2OJED 4CS8C 2HKVA 5L0CA 3HLZA 2P6VA 2R05A 3N24A 4EKWA 2YZSA 3I5PA 4Z9JA 3EHMA 4PJJA 4YL0A 5F5FA 2X0CA 3QVYA 4E0IA 1CGME 2XM0A 3ZVRA 3RF3A 3LEVA 1A41A 3TK0A 4XTKA 2WL8A 3J06A 5A6BA 2VCAA 3GORA 3ZTZA 3LNMB 4AE4A 4OIOF 4C7OB 1YJGA 2Y3GA 3M4CA 1JMWA 2XL6A 4MTFA 3TJ5A 3W2WA 3X1OA 4XEFA 2EPOA 3MYFA 2Q3TA 3SXKA 2Q9CA 2L7AA 3GM2A 2I8BA 1Q0KA 1XWJA 3QTHA 3FOPA 3W8HA 3T9OA 5KYYB 1SMYF 1WGWA 2KSFA 5IY5C 5FCLA 3GEEA 3A11A 4L6RA 4MVMA 4WGYA 4MTGA 2OQMA 1D0ZA 5JP7A 4CJOA 1Y4CA 4F4BA 2R7WA 1EQ1A 2IOQA 3KPHA 2NSFA 4JCHA 4GYTA 3UGOA 3B0VC 1O5HA 3NKDA 2ZXWC 1ORYA 4OIRF 3RVZA 2LP4A 2Y3HA 2EINC 3U8PA 2VB6A 3RKOF 3S90A 5B3IA 2QTVA 3NMJA 1G8XA 1LS4A 3MLGA 4IJJA 1O87A 3K33A 2J9UA 2KW3C 1T9KA 2EIKC 2HFIA 1LE2A 3AG4C 3HKKA 3JYHA 5JLIA 1V54C 5F28E 3EG9B 4U5FE 3C8GD 3M1CB 3DD7A 1HMOA 3S29A 1WASA 2J45A 2G62A 2C04A 3EJNA 1E2XA 3EGXB 4JTAB 4JEBA 3EPVA 3UNGC 5DQZA 4U5CE 5DQTA 1OR2A 2KYHA 5E33A 1A7DA 1ZHZA 1R5ID 2LD6A 3ASOC 3JSEO 1OXKA 3AGUA 4HFFB 5JRAA 2PP4A 3C18A 4JW1A 4FESA 1GS9A 3ZIBA 3IQCA 3O10A 2LFDA 4XQ1A 4BJ5C 3EGDA 4MVZA 3BEHA 1N1CA 2H7BA 4KBLA 5HV9A 2NUTA 4MVOA 4E7ZA 1E84A 3MBGA 3FAPB 3GANA 3TOLA 3UMIA 4WABA 1TR2A 2GDCA 4O6YA 3RFYA 1LM3B 4H54A 3Q7LA 4AE4B 1MMDA 1HMDA 2JPUA 2M64A 1OW8A 1T6IA 2A6HF 1YVIA 3QZCA 4N6HA 4XWJA 3ZWIA 3RQEA 3IQTA 2PX0A 2AWYA 4M63A 4PJLA 3S28A 5JUAA 1VTMP 4P9TA 5KYXA 4UDVA 5A69A 2RSEB 4OD5A 3EH2A 2R7SA 3KH2A 2A69F 2MHRA 3KYIA 3IHUA 2Q7RA 2R7QA 4CDVA 4X0RA 5DS6A 3PHF2 2W45A 4JE9A 2LCHA 4D4NA 2Y3BA 1QKRA 4O7GA 1WTYA 1W2WA 1AVOB 3M15A 4W8PA 4EBKA 2NSGA 3JT1A 2HMQA 3PCVA 1FNTc 1OQCA 1OW7A 3L0IA 1TFKB 4ZLCA 3SP1A 3V5YA 4C3DA 1L7CA 2L81A 2HSQA 1VOMA 5EHHA 4BJ1A 3E70C 4JVSA 1ZU4A 4U5HA 1LE4A 2KNHA 3VYWA 4CS8A 1WN0A 3JTLO 5EK0A 3RQFA 2XXAA 1ZHTA 1HE9A 4C3EA 4IWBA 4QI0A 2MYSA 3U3BA 2UUHA 3UMKA 2YRFA 3LESA 1YARO 1A0BA 4I1MA 4ZLDA 1CGOA 1E83A 3DJNB 3LUTB 2XLWA 1BR1A 2QNLA 4LERA 3HNLA 4CBEA 1I5NA 5K0IA 1M6TA 3MFNA 2R7RA 2J46A 2DYSC 2YLGA 3DXJF 3X2QC 3LJBA 4DRIB 2FGYA 1IW7F 1M2VB 5CI9A 4JJFA 2FFHA 3MYIA 2G3KA 4NY3A 2NUTB 1PCXA 4WJ0A 1LIHA 1H9TA 4ONSA 4Q5SF 4MVRA 1NFOA 2OG2A 3IPMO 3B29A 2Q00A 2XLVA 4CDYA 5L0FA 3RQGA 5KYWB 1FMVA 4A4AA 1FR0A 3SXMA 3WAQA 2YWAA 4JURI 1B68A 1VLTA 1JPNA 3AG1C 1HW2A 2HV7A 1BDJB 1OR3A 1VLSA 4G0HA 1GM5A 2VCCA 2OJQA 3NMKA 1E85A 2GA0A 2ICWG 2OCCC 4Q4ZF 3AGTA 3IQ5A 2Q9BA 2XL4A 3OEOA 5HSWA 4CIPA 3QW0A 1JR8A 4AK9A 1T6UA 2XLOA 3EZHA 4MVUA 4YT5A 1FAPB 3NMIA 1TWCA 2JX0A 3LAYA 4XPXA 5D91A 5BQIA 5JS5A 1EKYA 4E17A 2W9YA 1E86A 4DBRA 1U89A 4CIHA 2Y39A 1H9GA 4XLNF 3ABMC 1RKEA 3S9OA 2H8AA 4CS7A 4EHPA 1G5ZA 2P7VA 5KYUB 1JOGA 1L3PA 2EIJC 3C8GA 5BUOA 3JSZA 1S7ZA 3U5SA 1SF8A 1DOVA 2W4MA 2R02A 4K7BA 2Q4FA 3K1IA 4N06A 2XXAB 3DZAA 4LACB 3OA1A 3U2MA 1OCRC 1Q0DA 2P0NA 3US6A 3WHNA 4DXWA 3NDBB 1SR2A 3O39A 2YVKA 4FX5A 5CIVA 3HNJA 5L0HA 4JEAA 2A68F 2BC5A 2IXPA 2XLHA 4BJ5A 2R7TA 2P1AA 1Z7Qc 4JJGA 1YYJA 2WVOA 2TMVP 2XS1A 3S84A 3B9QA 3Q6NA 1JAFA 1BR4A 2NUPA 1IZMA 2FAPB 3GM1A 4HEAJ 2ASRA 4J32B 4XEVA 3O6XA 5B1AC 3VF0A 1FMWA 3AG3C 5E2QA 3POVA 2WZLA 4MNDA 2L6HA 4E7SA 1YDIA 3S27A 5L3QA 2HSBA 1YLMA 4G7ZF 1LVKA 5FZTA 3DAFA 4LDRA 5L0GA 3C63A 1QQ3A 3U9JA 1J8YF 1PD0A 2L9JA 2VCBA 2XLMA 4HFKB 4W8KA 1T5OA 5B1BC 4CS9C 3K1IC 1M2OA 2AP3A 2QLAA 3I5QA 3K6BA 2CNWD 2O9XA 4DRJB 5BQGA 1V74B 3DWWA 1CPRA 1J8MF 5T3WA 1HY5A 2YLDA 3V5ZA 3U0CA 3EQLF 1AUEA 1OKKD 2R03A 4QDLA 3K7DA 4MS2A 5AC5A 1CPQA 1NG1A 3EZIA 4U9EA 1VMAA 4KI2A 4JC7A 3E9VA 2DGJA 2A0BA 4OINF 2Q9AA 3G4ZA 2H7VC 4RBNA 4BPMA 4DBQA 2EPMX 1UG7A 4MTOA 1FTSA 5GPGB 4Q7CA 5CI8A 1HE1A 2UUIA 4BJTA 1ZHXA 5DS4A 3M79A 1OW6A 3EFOA 3MX3A 4NQFA 2J8WA 4R32A 2HJ3A 3ZQVA 5JT4A 5JVEA 4OIPF 4N4WA 2R9RB 3GEIA 4OIQF 2Y69C 2HUJA 1NU9C 2PF4E 1Z23A 4E0HA 3C8GB 3JZ0A 3FOOA 4U5EE 3EH1A 2LQGA 2I15A 1TWGA 2ZD9A 1RJ9A
chains in the Genus database with same CATH topology
1VYIA 5T1DB 2M4EA 4PFPA 3Q6MA 4XLPF 4PFOA 3ITFA 3ECSA 2MWQA 2X51A 1OCOC 4YT2A 2J0XA 4EWCA 2CW0F 4O6NA 4OD4A 3W2VA 1PD1A 1TWAA 2V3CC 3ABKC 4C7OA 1FFHA 3B0PA 4U5GA 2J9WA 3ZSUA 2VH3A 4HE8D 4YN0B 3EGDB 4PJMA 3SNHA 5KYYA 5T3TA 4AX2A 2GFHA 4YT4A 4YJWA 1KU2A 2R7VA 3DM9B 2A6EF 5DVWA 4JZAA 2NG1A 1TWHA 3UMHA 5E3CA 3ASNC 2IXMA 3UGPA 5KYXB 4O79A 3OWTA 1LS1A 1D1AA 2WZGA 2BE5F 2WVNA 3RIPA 4LLEA 3NYJA 3KKBA 3EG9A 3CSKA 3WG7C 2WVQA 3F47A 1Z6AA 4QI2A 1NU7D 4B6IA 2JD3A 1MNEA 1V55C 1NZEA 3SEOA 4RDAA 5DS5A 3NKEA 4YWQA 3LS1A 4KNVA 3H65A 4EBBA 3AG2C 3JCUQ 3TD7A 3W8IA 4CS9A 5EGYA 1MNDA 2R7XA 2QY9A 3S0XA 1VK5A 3KL4A 3AQBA 2CNWA 4DVZA 4G7HF 1BR2A 2J7PD 2ZXRA 4CSAA 1OKKA 4PK4A 2KQ9A 3HTKC 1MMAA 1FFTC 4I1OB 2Z15A 2G3VA 2PFDA 2YHSA 2VASA 4C3BA 4A2NB 1Z3IX 2CGEA 2ZXOA 3ZG1A 4I3MA 3V7OA 1M56C 3T6BA 4I44A 3QMKA 2ZPAA 4BJ6A 2HV6A 4ANJA 1ZU5A 2W4BA 3DMDA 4ULWA 5L3VA 2J0WA 1MMGA 2DYRC 3EHNA 3FHDA 3RH3A 4CSAC 2B0JA 3FDQA 1D1BA 3DAGA 3DJUB 4G7OF 2EILC 3T4RA 4LLCA 4U5BE 3LLIA 2WZFA 3DM5A 4RD9A 2PX3A 4DVYP 3ABLC 2LSEA 2H7OA 1D1CA 1MMNA 3CZ6A 3N2ZB 3NRHA 4BJ6C 3Q7GA 1TKNA 2XSEA 3FAJA 1M2VA 1Z5ZA 4K0DA 3UR3C 3WODF 4MQ9F 3JRTA 2YEVA 3NYMA 1SZIA 1QLEC 5KYWA 3VAYA 1ST6A 3B0UX 2NUPB 2R7OA 3F46A 2IXNA 4J30B 4O6MA 3LS0A 1ZHYA 1ZHWA 2XRHA 4KNWA 1VYKA 1M57C 5F5HA 3IEEA 3PMRA 3N0TA 4P6IC 3L34A 1JPJA 1ZYRF 1OCZC 5E3AA 1D0XA 2IYLD 5KYUA 3GODA 2J9VA 3NYLA 2C03A 2D5RB 4H4KC 3NG1A 5D92A 4GEHA 4YT8A 3K1HA 1D0YA 3AQCA 4IRUA 1Z63A 1OCCC 2EIMC 3ZC4A 1QZXA 3LNRA 3SYNA 3EFOB 3I4UA 3FVYA 1LKXA 4U5DE 4IAOA 2V26A 2ZXPA 2KJGA 3RYLA 4FWVA 4KC9A 5B3SC 5KYNA 3LLKA 3HJCA 3CQZA 4BG0A 4BEJA 3SZRA 2R7UA 2CDQA 2Y3DA 1RJ9B 2WB7A 3KMIA 2E87A 3EGXA 3T6JA 2J7PA 2KGOA 2A1DD 2IXOA 3K66A 4DOZA 5DLJA 4CS8C 3HLZA 2P6VA 3N24A 2YZSA 3I5PA 3EHMA 4PJJA 5F5FA 3ZVRA 3LEVA 4XTKA 2WL8A 4AE4A 4OIOF 4C7OB 2Y3GA 3W2WA 3X1OA 2Q3TA 2Q9CA 2I8BA 3W8HA 5KYYB 1SMYF 1WGWA 5IY5C 5FCLA 2R7WA 1D0ZA 4F4BA 2IOQA 4JCHA 4GYTA 3UGOA 3B0VC 1O5HA 3NKDA 2ZXWC 4OIRF 2Y3HA 2EINC 2VB6A 3RKOF 2QTVA 1G8XA 3MLGA 4IJJA 1O87A 3K33A 2J9UA 2KW3C 2EIKC 3AG4C 3JYHA 1V54C 3EG9B 4U5FE 3M1CB 3DD7A 3S29A 2J45A 2G62A 2C04A 3EJNA 3EGXB 3EPVA 3UNGC 5DQZA 4U5CE 5DQTA 5E33A 1ZHZA 3ASOC 4HFFB 2PP4A 4JW1A 4FESA 3ZIBA 4BJ5C 3EGDA 1N1CA 2H7BA 4KBLA 2NUTA 4E7ZA 3GANA 3UMIA 1TR2A 4O6YA 3RFYA 4AE4B 3Q7LA 1MMDA 2A6HF 3QZCA 4XWJA 4M63A 2PX0A 4PJLA 3S28A 5KYXA 2R7SA 4OD5A 3EH2A 3KH2A 2A69F 2R7QA 4X0RA 5DS6A 3PHF2 2W45A 2Y3BA 4O7GA 1W2WA 3JT1A 3L0IA 4ZLCA 3SP1A 4C3DA 2L81A 1VOMA 5EHHA 4BJ1A 3E70C 4JVSA 1ZU4A 4U5HA 2KNHA 3VYWA 4CS8A 2XXAA 1ZHTA 4C3EA 4IWBA 4QI0A 2MYSA 3UMKA 3LESA 4I1MA 4ZLDA 3DJNB 1BR1A 4LERA 4CBEA 2R7RA 2J46A 2DYSC 3DXJF 3X2QC 3LJBA 2FGYA 1IW7F 1M2VB 5CI9A 4JJFA 2FFHA 4WJ0A 2G3KA 4NY3A 2NUTB 1PCXA 4Q5SF 2OG2A 5KYWB 1FMVA 4JURI 3AG1C 1JPNA 2HV7A 4G0HA 4Q4ZF 2OCCC 2Q9BA 2XL4A 3OEOA 5HSWA 4AK9A 3EZHA 4YT5A 1TWCA 3LAYA 5D91A 2W9YA 4DBRA 4CIHA 2Y39A 4XLNF 3ABMC 4CS7A 2P7VA 5KYUB 2EIJC 5BUOA 3JSZA 1S7ZA 1SF8A 2W4MA 4K7BA 4N06A 2XXAB 3DZAA 4LACB 3OA1A 1OCRC 3NDBB 3O39A 4FX5A 2A68F 2IXPA 4BJ5A 2R7TA 4JJGA 2WVOA 3B9QA 3Q6NA 2NUPA 1BR4A 4HEAJ 1IZMA 4J32B 3O6XA 5B1AC 1FMWA 3AG3C 5E2QA 3POVA 2WZLA 4MNDA 4E7SA 3S27A 5L3QA 1LVKA 3DAFA 1J8YF 1PD0A 2L9JA 4W8KA 4HFKB 5B1BC 4CS9C 3K1IC 1M2OA 3I5QA 3K6BA 2CNWD 2O9XA 4G7ZF 1J8MF 5T3WA 3EQLF 1OKKD 4QDLA 3K7DA 1NG1A 3EZIA 4KI2A 1VMAA 3E9VA 2DGJA 4OINF 2Q9AA 2H7VC 4RBNA 4DBQA 1FTSA 4Q7CA 5CI8A 4BJTA 1ZHXA 5DS4A 3EFOA 3MX3A 4OIPF 4OIQF 2Y69C 1NU9C 2PF4E 1Z23A 4U5EE 3EH1A 1TWGA 4PJNA 1RJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KJG A; 
#chains in the Genus database with same CATH topology
 3CAX A;  1VYI A;  1G4W R;  1TFO B;  1BBH A;  5T1D B;  2M4E A;  4PFP A;  1CGN A;  3RW0 A;  3Q6M A;  3C7J A;  4PFO A;  3ITF A;  4XLP F;  2EPL X;  4EBJ A;  3ECS A;  3FXH A;  3G50 A;  2CCY A;  1Q0G A;  3G4X A;  2DI3 A;  2OKU A;  3TQO A;  1T01 A;  4NTB A;  3PDM P;  2MWQ A;  3DE8 A;  2DB4 A;  256B A;  2OOC A;  1U0B B;  3C8Z A;  2X51 A;  3H2U A;  1OCO C;  4YT2 A;  3VM6 A;  3KYJ A;  2J0X A;  4YK5 A;  3R7C A;  4EWC A;  2CW0 F;  1ZZP A;  4O6N A;  4OD4 A;  1U6H A;  1PD1 A;  1VB5 A;  1TWA A;  2YLI A;  4PJN A;  3W2V A;  2V3C C;  3ABK C;  4CX9 A;  4PAC A;  2HZ8 A;  4C7O A;  1FFH A;  3B0P A;  1K05 A;  4U5G A;  2J9W A;  1NFN A;  1YYX A;  4NTA A;  3ZSU A;  1QSP A;  2VH3 A;  2XL8 A;  3AJM A;  2YL1 A;  3EGD B;  4HE8 D;  1H7I A;  4PJM A;  4YN0 B;  3SNH A;  5T3T A;  4AX2 A;  5KYY A;  4IAQ A;  1YZA A;  2GFH A;  4YT4 A;  1APC A;  4YJW A;  3GWN A;  1KU2 A;  2P61 A;  2R7V A;  2VC9 A;  3DM9 B;  2A6E F;  5DVW A;  3H2V A;  4ULV A;  3O55 A;  4JZA A;  2NG1 A;  1TWH A;  3UMH A;  1GGQ A;  3TUL A;  2LIG A;  5E3C A;  3ASN C;  4MW8 A;  5TJ5 E;  2IXM A;  2L6G A;  4EUK B;  3UGP A;  1Y6D A;  1S05 A;  3B71 A;  2L6F A;  5KYX B;  4O79 A;  3OWT A;  1LS1 A;  2BL2 A;  1ZW2 A;  4BEM J;  1D1A A;  5L0I A;  3AOU A;  1O3U A;  2WZG A;  2AWC A;  1EA8 A;  2BE5 F;  2WVN A;  3RIP A;  4MVS A;  4LLE A;  3NYJ A;  3KKB A;  3EG9 A;  3BRJ A;  3CSK A;  2XM4 A;  3LEO A;  3WG7 C;  4AL0 A;  4WGZ A;  2WVQ A;  3F47 A;  1Z6A A;  2XLD A;  3ATP A;  4CDA A;  1YZC A;  4QI2 A;  1NU7 D;  4B6I A;  5L0J A;  4J7T A;  1GQA A;  1XZP A;  4XPW A;  2JD3 A;  1MNE A;  1V55 C;  2ETS A;  1NZE A;  4IB4 A;  3SEO A;  4RDA A;  5DS5 A;  4D4X A;  1QVX A;  2XS8 A;  2GAQ A;  3GM3 A;  3NKE A;  2HS5 A;  3A9C A;  4DJ9 A;  2EPK X;  3LS1 A;  3H65 A;  4KNV A;  4EBB A;  3AG2 C;  4YWQ A;  1YAU O;  3DE9 A;  4ER9 A;  1G4U S;  2OEX A;  3JCU Q;  4K1O A;  3TD7 A;  2RD9 A;  1Q0F A;  2J9B A;  3W8I A;  4CS9 A;  4E18 A;  1MND A;  5EGY A;  3SXZ A;  2R7X A;  2HMZ A;  1WWP A;  3FMS A;  4GQH A;  2QY9 A;  4FAP B;  3S0X A;  1VK5 A;  1JRA A;  3SXY A;  3KL4 A;  3AQB A;  2CNW A;  2OU6 A;  2LFF A;  4DVZ A;  5L0D A;  4G7H F;  1BR2 A;  2J7P D;  2KC3 A;  2ZXR A;  4CSA A;  1OKK A;  4IGG A;  4PK4 A;  2KQ9 A;  3HTK C;  4JTC B;  5BQH A;  1MMA A;  1FFT C;  3DI5 A;  4I1O B;  2Z15 A;  3U3F A;  2YQY A;  4JIO A;  2G3V A;  1DOW A;  4EIY A;  1I4Y A;  2PFD A;  2YHS A;  1I4Z A;  3IQ6 A;  2VAS A;  2XLE A;  4C3B A;  4A2N B;  4XEK A;  1YA9 A;  1Z3I X;  2CGE A;  2ZXO A;  4IAR A;  4I3M A;  3ZG1 A;  3V7O A;  1M56 C;  3T6B A;  2GWW A;  4I44 A;  3GWL A;  1V4A A;  1ZW3 A;  2B0H A;  2HV6 A;  2ZPA A;  3QMK A;  1ZU5 A;  4BJ6 A;  4ANJ A;  5A6B D;  2W4B A;  2HJM A;  3DMD A;  2D4U A;  4JTD B;  4ULW A;  3W4Y A;  5L3V A;  2IBF A;  1WOL A;  5A6J A;  2J0W A;  1MMG A;  2A0U A;  2DYR C;  3EHN A;  2YL0 A;  3FHD A;  3RH3 A;  4LDQ A;  4CSA C;  2B0J A;  3FDQ A;  2QE9 A;  1D1B A;  3DAG A;  2NPU A;  1LPE A;  3DJU B;  4G7O F;  3VRC A;  1XZQ A;  2EIL C;  2PNO A;  3ZQY A;  4LDK A;  3T4R A;  1T6Q A;  1RCP A;  3CEX A;  2CYD A;  4LLC A;  4U5B E;  3LLI A;  1TQG A;  2WZF A;  3DM5 A;  4RD9 A;  2PX3 A;  1QPU A;  2EPN A;  3ABL C;  4DVY P;  1RKC A;  1BZ4 A;  3HNI A;  4G78 A;  2YL3 A;  1WAT A;  3R2P A;  4YL3 A;  1H6G A;  1RKE B;  1Q0M A;  3L8I A;  1MQV A;  2LSE A;  2H7O A;  5JSL A;  1NLX A;  1D1C A;  1MMN A;  3CZ6 A;  3N2Z B;  3NRH A;  4JRZ A;  2YL7 A;  4XPY A;  4BJ6 C;  3U2L A;  3Q7G A;  1TKN A;  1C03 A;  2XSE A;  3FAJ A;  1M2V A;  1Z5Z A;  5A6A A;  1EI7 A;  1K04 A;  1ORS C;  1PV3 A;  1SYQ A;  3T6G B;  4K0D A;  3UR3 C;  3WOD F;  4MQ9 F;  3JRT A;  2YEV A;  3NYM A;  3DKA A;  4JCZ A;  5COG A;  2KK1 A;  1SZI A;  4MVQ A;  1QLE C;  4NTF A;  2QUP A;  5KYW A;  3VAY A;  3TOM A;  5COM A;  1ST6 A;  3B0U X;  1KNY A;  2NUP B;  2R7O A;  2IM8 A;  3HNK A;  1NBB A;  3F46 A;  3ZTM A;  2R25 A;  4AL1 A;  1R4T A;  2IXN A;  4J30 B;  4O6M A;  4Z9H A;  4CJG A;  3LS0 A;  1LI7 A;  4P9F A;  1ZHY A;  1ZHW A;  2XRH A;  3L8J A;  4KNW A;  3QVZ A;  1VYK A;  1M57 C;  1ORJ A;  3U8V A;  1LI5 A;  5F5H A;  3IEE A;  3C62 A;  3PMR A;  3N0T A;  4N6C A;  4NC3 A;  1RXQ A;  4P6I C;  5COF A;  3L34 A;  1JPJ A;  1C02 A;  5AC4 A;  1ZYR F;  1OCZ C;  2OEV A;  4U9D A;  5E3A A;  1ZVZ A;  1D0X A;  2F22 A;  4YL1 A;  2IYL D;  5KYU A;  1RMV A;  1C17 M;  1F1M A;  2J9V A;  2YKZ A;  1AEP A;  2LK4 A;  3GOD A;  3ZDL A;  3NYL A;  2C03 A;  5A6K A;  1A7V A;  4MW3 A;  2D5R B;  4H4K C;  3NG1 A;  5D92 A;  4GEH A;  3TJ6 A;  4DRH B;  4YT8 A;  3K1H A;  1D0Y A;  3AQC A;  4IRU A;  3JRM O;  3JYY A;  4PR9 A;  1A7E A;  3GEH A;  1Z63 A;  1OCC C;  2EIM C;  3ZC4 A;  1QZX A;  4JKV A;  3LNR A;  4J7Y A;  3M4B A;  3U9M A;  3SYN A;  1OXB A;  3EFO B;  3I4U A;  3L1M A;  3QW1 A;  5AGF A;  1UFB A;  1LKX A;  3FVY A;  4U5D E;  4IAO A;  2V26 A;  2ZXP A;  2AVK A;  1NSG B;  2KJG A;  4FWV A;  4KC9 A;  1HW1 A;  3RYL A;  1KTM A;  2AU5 A;  3V5X A;  5B3S C;  5KYN A;  3LLK A;  3HJC A;  3CQZ A;  4BG0 A;  4BEJ A;  3SZR A;  2R7U A;  1YA7 O;  4Z9I A;  2CDQ A;  2Y3D A;  1RJ9 B;  2WB7 A;  2PBE A;  3RVY A;  3KMI A;  2E87 A;  3EGX A;  1K40 A;  4NCQ A;  3T6J A;  2J7P A;  2KGO A;  2A1D D;  2IXO A;  3K66 A;  4DOZ A;  5DLJ A;  2OJE D;  4CS8 C;  2HKV A;  5L0C A;  3HLZ A;  2P6V A;  2R05 A;  3N24 A;  4EKW A;  2YZS A;  3I5P A;  4Z9J A;  3EHM A;  4PJJ A;  4YL0 A;  5F5F A;  2X0C A;  3QVY A;  4E0I A;  1CGM E;  2XM0 A;  3ZVR A;  3RF3 A;  3LEV A;  1A41 A;  3TK0 A;  4XTK A;  2WL8 A;  3J06 A;  5A6B A;  2VCA A;  3GOR A;  3ZTZ A;  3LNM B;  4AE4 A;  4OIO F;  4C7O B;  1YJG A;  2Y3G A;  3M4C A;  1JMW A;  2XL6 A;  4MTF A;  3TJ5 A;  3W2W A;  3X1O A;  4XEF A;  2EPO A;  3MYF A;  2Q3T A;  3SXK A;  2Q9C A;  2L7A A;  3GM2 A;  2I8B A;  1Q0K A;  1XWJ A;  3QTH A;  3FOP A;  3W8H A;  3T9O A;  5KYY B;  1SMY F;  1WGW A;  2KSF A;  5IY5 C;  5FCL A;  3GEE A;  3A11 A;  4L6R A;  4MVM A;  4WGY A;  4MTG A;  2OQM A;  1D0Z A;  5JP7 A;  4CJO A;  1Y4C A;  4F4B A;  2R7W A;  1EQ1 A;  2IOQ A;  3KPH A;  2NSF A;  4JCH A;  4GYT A;  3UGO A;  3B0V C;  1O5H A;  3NKD A;  2ZXW C;  1ORY A;  4OIR F;  3RVZ A;  2LP4 A;  2Y3H A;  2EIN C;  3U8P A;  2VB6 A;  3RKO F;  3S90 A;  5B3I A;  2QTV A;  3NMJ A;  1G8X A;  1LS4 A;  3MLG A;  4IJJ A;  1O87 A;  3K33 A;  2J9U A;  2KW3 C;  1T9K A;  2EIK C;  2HFI A;  1LE2 A;  3AG4 C;  3HKK A;  3JYH A;  5JLI A;  1V54 C;  5F28 E;  3EG9 B;  4U5F E;  3C8G D;  3M1C B;  3DD7 A;  1HMO A;  3S29 A;  1WAS A;  2J45 A;  2G62 A;  2C04 A;  3EJN A;  1E2X A;  3EGX B;  4JTA B;  4JEB A;  3EPV A;  3UNG C;  5DQZ A;  4U5C E;  5DQT A;  1OR2 A;  2KYH A;  5E33 A;  1A7D A;  1ZHZ A;  1R5I D;  2LD6 A;  3ASO C;  3JSE O;  1OXK A;  3AGU A;  4HFF B;  5JRA A;  2PP4 A;  3C18 A;  4JW1 A;  4FES A;  1GS9 A;  3ZIB A;  3IQC A;  3O10 A;  2LFD A;  4XQ1 A;  4BJ5 C;  3EGD A;  4MVZ A;  3BEH A;  1N1C A;  2H7B A;  4KBL A;  5HV9 A;  2NUT A;  4MVO A;  4E7Z A;  1E84 A;  3MBG A;  3FAP B;  3GAN A;  3TOL A;  3UMI A;  4WAB A;  1TR2 A;  2GDC A;  4O6Y A;  3RFY A;  1LM3 B;  4H54 A;  3Q7L A;  4AE4 B;  1MMD A;  1HMD A;  2JPU A;  2M64 A;  1OW8 A;  1T6I A;  2A6H F;  1YVI A;  3QZC A;  4N6H A;  4XWJ A;  3ZWI A;  3RQE A;  3IQT A;  2PX0 A;  2AWY A;  4M63 A;  4PJL A;  3S28 A;  5JUA A;  1VTM P;  4P9T A;  5KYX A;  4UDV A;  5A69 A;  2RSE B;  4OD5 A;  3EH2 A;  2R7S A;  3KH2 A;  2A69 F;  2MHR A;  3KYI A;  3IHU A;  2Q7R A;  2R7Q A;  4CDV A;  4X0R A;  5DS6 A;  3PHF 2;  2W45 A;  4JE9 A;  2LCH A;  4D4N A;  2Y3B A;  1QKR A;  4O7G A;  1WTY A;  1W2W A;  1AVO B;  3M15 A;  4W8P A;  4EBK A;  2NSG A;  3JT1 A;  2HMQ A;  3PCV A;  1FNT c;  1OQC A;  1OW7 A;  3L0I A;  1TFK B;  4ZLC A;  3SP1 A;  3V5Y A;  4C3D A;  1L7C A;  2L81 A;  2HSQ A;  1VOM A;  5EHH A;  4BJ1 A;  3E70 C;  4JVS A;  1ZU4 A;  4U5H A;  1LE4 A;  2KNH A;  3VYW A;  4CS8 A;  1WN0 A;  3JTL O;  5EK0 A;  3RQF A;  2XXA A;  1ZHT A;  1HE9 A;  4C3E A;  4IWB A;  4QI0 A;  2MYS A;  3U3B A;  2UUH A;  3UMK A;  2YRF A;  3LES A;  1YAR O;  1A0B A;  4I1M A;  4ZLD A;  1CGO A;  1E83 A;  3DJN B;  3LUT B;  2XLW A;  1BR1 A;  2QNL A;  4LER A;  3HNL A;  4CBE A;  1I5N A;  5K0I A;  1M6T A;  3MFN A;  2R7R A;  2J46 A;  2DYS C;  2YLG A;  3DXJ F;  3X2Q C;  3LJB A;  4DRI B;  2FGY A;  1IW7 F;  1M2V B;  5CI9 A;  4JJF A;  2FFH A;  3MYI A;  2G3K A;  4NY3 A;  2NUT B;  1PCX A;  4WJ0 A;  1LIH A;  1H9T A;  4ONS A;  4Q5S F;  4MVR A;  1NFO A;  2OG2 A;  3IPM O;  3B29 A;  2Q00 A;  2XLV A;  4CDY A;  5L0F A;  3RQG A;  5KYW B;  1FMV A;  4A4A A;  1FR0 A;  3SXM A;  3WAQ A;  2YWA A;  4JUR I;  1B68 A;  1VLT A;  1JPN A;  3AG1 C;  1HW2 A;  2HV7 A;  1BDJ B;  1OR3 A;  1VLS A;  4G0H A;  1GM5 A;  2VCC A;  2OJQ A;  3NMK A;  1E85 A;  2GA0 A;  2ICW G;  2OCC C;  4Q4Z F;  3AGT A;  3IQ5 A;  2Q9B A;  2XL4 A;  3OEO A;  5HSW A;  4CIP A;  3QW0 A;  1JR8 A;  4AK9 A;  1T6U A;  2XLO A;  3EZH A;  4MVU A;  4YT5 A;  1FAP B;  3NMI A;  1TWC A;  2JX0 A;  3LAY A;  4XPX A;  5D91 A;  5BQI A;  5JS5 A;  1EKY A;  4E17 A;  2W9Y A;  1E86 A;  4DBR A;  1U89 A;  4CIH A;  2Y39 A;  1H9G A;  4XLN F;  3ABM C;  1RKE A;  3S9O A;  2H8A A;  4CS7 A;  4EHP A;  1G5Z A;  2P7V A;  5KYU B;  1JOG A;  1L3P A;  2EIJ C;  3C8G A;  5BUO A;  3JSZ A;  1S7Z A;  3U5S A;  1SF8 A;  1DOV A;  2W4M A;  2R02 A;  4K7B A;  2Q4F A;  3K1I A;  4N06 A;  2XXA B;  3DZA A;  4LAC B;  3OA1 A;  3U2M A;  1OCR C;  1Q0D A;  2P0N A;  3US6 A;  3WHN A;  4DXW A;  3NDB B;  1SR2 A;  3O39 A;  2YVK A;  4FX5 A;  5CIV A;  3HNJ A;  5L0H A;  4JEA A;  2A68 F;  2BC5 A;  2IXP A;  2XLH A;  4BJ5 A;  2R7T A;  2P1A A;  1Z7Q c;  4JJG A;  1YYJ A;  2WVO A;  2TMV P;  2XS1 A;  3S84 A;  3B9Q A;  3Q6N A;  1JAF A;  1BR4 A;  2NUP A;  1IZM A;  2FAP B;  3GM1 A;  4HEA J;  2ASR A;  4J32 B;  4XEV A;  3O6X A;  5B1A C;  3VF0 A;  1FMW A;  3AG3 C;  5E2Q A;  3POV A;  2WZL A;  4MND A;  2L6H A;  4E7S A;  1YDI A;  3S27 A;  5L3Q A;  2HSB A;  1YLM A;  4G7Z F;  1LVK A;  5FZT A;  3DAF A;  4LDR A;  5L0G A;  3C63 A;  1QQ3 A;  3U9J A;  1J8Y F;  1PD0 A;  2L9J A;  2VCB A;  2XLM A;  4HFK B;  4W8K A;  1T5O A;  5B1B C;  4CS9 C;  3K1I C;  1M2O A;  2AP3 A;  2QLA A;  3I5Q A;  3K6B A;  2CNW D;  2O9X A;  4DRJ B;  5BQG A;  1V74 B;  3DWW A;  1CPR A;  1J8M F;  5T3W A;  1HY5 A;  2YLD A;  3V5Z A;  3U0C A;  3EQL F;  1AUE A;  1OKK D;  2R03 A;  4QDL A;  3K7D A;  4MS2 A;  5AC5 A;  1CPQ A;  1NG1 A;  3EZI A;  4U9E A;  1VMA A;  4KI2 A;  4JC7 A;  3E9V A;  2DGJ A;  2A0B A;  4OIN F;  2Q9A A;  3G4Z A;  2H7V C;  4RBN A;  4BPM A;  4DBQ A;  2EPM X;  1UG7 A;  4MTO A;  1FTS A;  5GPG B;  4Q7C A;  5CI8 A;  1HE1 A;  2UUI A;  4BJT A;  1ZHX A;  5DS4 A;  3M79 A;  1OW6 A;  3EFO A;  3MX3 A;  4NQF A;  2J8W A;  4R32 A;  2HJ3 A;  3ZQV A;  5JT4 A;  5JVE A;  4OIP F;  4N4W A;  2R9R B;  3GEI A;  4OIQ F;  2Y69 C;  2HUJ A;  1NU9 C;  2PF4 E;  1Z23 A;  4E0H A;  3C8G B;  3JZ0 A;  3FOO A;  4U5E E;  3EH1 A;  2LQG A;  2I15 A;  1TWG A;  2ZD9 A;  1RJ9 A; 
#chains in the Genus database with same CATH homology
 1VYI A;  5T1D B;  2M4E A;  4PFP A;  3Q6M A;  4XLP F;  4PFO A;  3ITF A;  3ECS A;  2MWQ A;  2X51 A;  1OCO C;  4YT2 A;  2J0X A;  4EWC A;  2CW0 F;  4O6N A;  4OD4 A;  3W2V A;  1PD1 A;  1TWA A;  2V3C C;  3ABK C;  4C7O A;  1FFH A;  3B0P A;  4U5G A;  2J9W A;  3ZSU A;  2VH3 A;  4HE8 D;  4YN0 B;  3EGD B;  4PJM A;  3SNH A;  5KYY A;  5T3T A;  4AX2 A;  2GFH A;  4YT4 A;  4YJW A;  1KU2 A;  2R7V A;  3DM9 B;  2A6E F;  5DVW A;  4JZA A;  2NG1 A;  1TWH A;  3UMH A;  5E3C A;  3ASN C;  2IXM A;  3UGP A;  5KYX B;  4O79 A;  3OWT A;  1LS1 A;  1D1A A;  2WZG A;  2BE5 F;  2WVN A;  3RIP A;  4LLE A;  3NYJ A;  3KKB A;  3EG9 A;  3CSK A;  3WG7 C;  2WVQ A;  3F47 A;  1Z6A A;  4QI2 A;  1NU7 D;  4B6I A;  2JD3 A;  1MNE A;  1V55 C;  1NZE A;  3SEO A;  4RDA A;  5DS5 A;  3NKE A;  4YWQ A;  3LS1 A;  4KNV A;  3H65 A;  4EBB A;  3AG2 C;  3JCU Q;  3TD7 A;  3W8I A;  4CS9 A;  5EGY A;  1MND A;  2R7X A;  2QY9 A;  3S0X A;  1VK5 A;  3KL4 A;  3AQB A;  2CNW A;  4DVZ A;  4G7H F;  1BR2 A;  2J7P D;  2ZXR A;  4CSA A;  1OKK A;  4PK4 A;  2KQ9 A;  3HTK C;  1MMA A;  1FFT C;  4I1O B;  2Z15 A;  2G3V A;  2PFD A;  2YHS A;  2VAS A;  4C3B A;  4A2N B;  1Z3I X;  2CGE A;  2ZXO A;  3ZG1 A;  4I3M A;  3V7O A;  1M56 C;  3T6B A;  4I44 A;  3QMK A;  2ZPA A;  4BJ6 A;  2HV6 A;  4ANJ A;  1ZU5 A;  2W4B A;  3DMD A;  4ULW A;  5L3V A;  2J0W A;  1MMG A;  2DYR C;  3EHN A;  3FHD A;  3RH3 A;  4CSA C;  2B0J A;  3FDQ A;  1D1B A;  3DAG A;  3DJU B;  4G7O F;  2EIL C;  3T4R A;  4LLC A;  4U5B E;  3LLI A;  2WZF A;  3DM5 A;  4RD9 A;  2PX3 A;  4DVY P;  3ABL C;  2LSE A;  2H7O A;  1D1C A;  1MMN A;  3CZ6 A;  3N2Z B;  3NRH A;  4BJ6 C;  3Q7G A;  1TKN A;  2XSE A;  3FAJ A;  1M2V A;  1Z5Z A;  4K0D A;  3UR3 C;  3WOD F;  4MQ9 F;  3JRT A;  2YEV A;  3NYM A;  1SZI A;  1QLE C;  5KYW A;  3VAY A;  1ST6 A;  3B0U X;  2NUP B;  2R7O A;  3F46 A;  2IXN A;  4J30 B;  4O6M A;  3LS0 A;  1ZHY A;  1ZHW A;  2XRH A;  4KNW A;  1VYK A;  1M57 C;  5F5H A;  3IEE A;  3PMR A;  3N0T A;  4P6I C;  3L34 A;  1JPJ A;  1ZYR F;  1OCZ C;  5E3A A;  1D0X A;  2IYL D;  5KYU A;  3GOD A;  2J9V A;  3NYL A;  2C03 A;  2D5R B;  4H4K C;  3NG1 A;  5D92 A;  4GEH A;  4YT8 A;  3K1H A;  1D0Y A;  3AQC A;  4IRU A;  1Z63 A;  1OCC C;  2EIM C;  3ZC4 A;  1QZX A;  3LNR A;  3SYN A;  3EFO B;  3I4U A;  3FVY A;  1LKX A;  4U5D E;  4IAO A;  2V26 A;  2ZXP A;  2KJG A;  3RYL A;  4FWV A;  4KC9 A;  5B3S C;  5KYN A;  3LLK A;  3HJC A;  3CQZ A;  4BG0 A;  4BEJ A;  3SZR A;  2R7U A;  2CDQ A;  2Y3D A;  1RJ9 B;  2WB7 A;  3KMI A;  2E87 A;  3EGX A;  3T6J A;  2J7P A;  2KGO A;  2A1D D;  2IXO A;  3K66 A;  4DOZ A;  5DLJ A;  4CS8 C;  3HLZ A;  2P6V A;  3N24 A;  2YZS A;  3I5P A;  3EHM A;  4PJJ A;  5F5F A;  3ZVR A;  3LEV A;  4XTK A;  2WL8 A;  4AE4 A;  4OIO F;  4C7O B;  2Y3G A;  3W2W A;  3X1O A;  2Q3T A;  2Q9C A;  2I8B A;  3W8H A;  5KYY B;  1SMY F;  1WGW A;  5IY5 C;  5FCL A;  2R7W A;  1D0Z A;  4F4B A;  2IOQ A;  4JCH A;  4GYT A;  3UGO A;  3B0V C;  1O5H A;  3NKD A;  2ZXW C;  4OIR F;  2Y3H A;  2EIN C;  2VB6 A;  3RKO F;  2QTV A;  1G8X A;  3MLG A;  4IJJ A;  1O87 A;  3K33 A;  2J9U A;  2KW3 C;  2EIK C;  3AG4 C;  3JYH A;  1V54 C;  3EG9 B;  4U5F E;  3M1C B;  3DD7 A;  3S29 A;  2J45 A;  2G62 A;  2C04 A;  3EJN A;  3EGX B;  3EPV A;  3UNG C;  5DQZ A;  4U5C E;  5DQT A;  5E33 A;  1ZHZ A;  3ASO C;  4HFF B;  2PP4 A;  4JW1 A;  4FES A;  3ZIB A;  4BJ5 C;  3EGD A;  1N1C A;  2H7B A;  4KBL A;  2NUT A;  4E7Z A;  3GAN A;  3UMI A;  1TR2 A;  4O6Y A;  3RFY A;  4AE4 B;  3Q7L A;  1MMD A;  2A6H F;  3QZC A;  4XWJ A;  4M63 A;  2PX0 A;  4PJL A;  3S28 A;  5KYX A;  2R7S A;  4OD5 A;  3EH2 A;  3KH2 A;  2A69 F;  2R7Q A;  4X0R A;  5DS6 A;  3PHF 2;  2W45 A;  2Y3B A;  4O7G A;  1W2W A;  3JT1 A;  3L0I A;  4ZLC A;  3SP1 A;  4C3D A;  2L81 A;  1VOM A;  5EHH A;  4BJ1 A;  3E70 C;  4JVS A;  1ZU4 A;  4U5H A;  2KNH A;  3VYW A;  4CS8 A;  2XXA A;  1ZHT A;  4C3E A;  4IWB A;  4QI0 A;  2MYS A;  3UMK A;  3LES A;  4I1M A;  4ZLD A;  3DJN B;  1BR1 A;  4LER A;  4CBE A;  2R7R A;  2J46 A;  2DYS C;  3DXJ F;  3X2Q C;  3LJB A;  2FGY A;  1IW7 F;  1M2V B;  5CI9 A;  4JJF A;  2FFH A;  4WJ0 A;  2G3K A;  4NY3 A;  2NUT B;  1PCX A;  4Q5S F;  2OG2 A;  5KYW B;  1FMV A;  4JUR I;  3AG1 C;  1JPN A;  2HV7 A;  4G0H A;  4Q4Z F;  2OCC C;  2Q9B A;  2XL4 A;  3OEO A;  5HSW A;  4AK9 A;  3EZH A;  4YT5 A;  1TWC A;  3LAY A;  5D91 A;  2W9Y A;  4DBR A;  4CIH A;  2Y39 A;  4XLN F;  3ABM C;  4CS7 A;  2P7V A;  5KYU B;  2EIJ C;  5BUO A;  3JSZ A;  1S7Z A;  1SF8 A;  2W4M A;  4K7B A;  4N06 A;  2XXA B;  3DZA A;  4LAC B;  3OA1 A;  1OCR C;  3NDB B;  3O39 A;  4FX5 A;  2A68 F;  2IXP A;  4BJ5 A;  2R7T A;  4JJG A;  2WVO A;  3B9Q A;  3Q6N A;  2NUP A;  1BR4 A;  4HEA J;  1IZM A;  4J32 B;  3O6X A;  5B1A C;  1FMW A;  3AG3 C;  5E2Q A;  3POV A;  2WZL A;  4MND A;  4E7S A;  3S27 A;  5L3Q A;  1LVK A;  3DAF A;  1J8Y F;  1PD0 A;  2L9J A;  4W8K A;  4HFK B;  5B1B C;  4CS9 C;  3K1I C;  1M2O A;  3I5Q A;  3K6B A;  2CNW D;  2O9X A;  4G7Z F;  1J8M F;  5T3W A;  3EQL F;  1OKK D;  4QDL A;  3K7D A;  1NG1 A;  3EZI A;  4KI2 A;  1VMA A;  3E9V A;  2DGJ A;  4OIN F;  2Q9A A;  2H7V C;  4RBN A;  4DBQ A;  1FTS A;  4Q7C A;  5CI8 A;  4BJT A;  1ZHX A;  5DS4 A;  3EFO A;  3MX3 A;  4OIP F;  4OIQ F;  2Y69 C;  1NU9 C;  2PF4 E;  1Z23 A;  4U5E E;  3EH1 A;  1TWG A;  4PJN A;  1RJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...