2KJQA

Solution structure of protein nmb1076 from neisseria meningitidis. northeast structural genomics consortium target mr101b.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
149
structure length
149
Chain Sequence
b'MGHHHHHHSHMDYPSFDKFLGTENAELVYVLRHKHGQFIYVWGEEGAGKSHLLQAWVAQALEAGKNAAYIDAASMPLTDAAFEAEYLAVDQVEKLGNEEQALLFSIFNRFRNSGKGFLLLGSEYTPQQLVIREDLRTRMAYCLVYEVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaA-related protein
publication title Solution Structure Of Protein NMB1076 From Neisseria meningitidis. Northeast Structural Genomics Consortium Target MR101B.
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Replication
total genus 31
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2009-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2kjqA01
4OHZA 4CT4B 4D6PA 3JVUA 1ZYUA 2DYKA 2VHCA 1RW4A 5GJCA 3SBEA 2E87A 3OIYA 4RKEA 2IYXA 2MSDB 2RMKA 5FL7A 4PZZA 2MMCA 2EQBA 2WWIA 2VHUA 1FZQA 1QHSA 1W0JA 3PEWA 3VMFA 4JL6A 5TARA 4GT1A 3RS0A 4PZYA 3OEEA 2H16A 3VFDA 1UBFA 4NP6A 2QROA 1G3IA 4YMUA 1BS1A 3CRMA 4ARZA 4J0QA 1XCPA 2OSBA 1M74A 3CNNA 3EASA 4MKHA 1GKYA 4M1OA 4CIDA 1PUJA 2YJTD 2QE7D 2WOOA 3ZQ6A 3SJAA 1GKUB 2RGAA 3A37A 4BLQA 4WAUA 1ZVQA 4AK9A 1XDBA 3CLVA 1GILA 2PBRA 5EJEA 4EKDA 3QBTA 3I61A 4FINA 2Z43A 621PA 4C0HA 3FPAA 1HUQA 3WRYC 1VPLA 1IXZA 3CWZA 4HAXA 1YKSA 5FUYA 1FQKA 1R5BA 4YXWD 3D31A 1MABB 1FMJA 1G4UR 4DRZA 2Z4SA 1E9CA 2HEIA 3D3QA 4R2HA 4TLBA 5IHPA 4Q1AA 3Q7PA 1G7RA 4B3BA 4FMCB 2EFGA 3K70C 3CH4B 2WVJA 1G5RA 3U5ZB 1XD2B 4UJ5A 5KUTA 4GBMA 3QVVA 5EE3A 3QF7A 5KDLA 1TQ2A 3LD9A 2AR7A 2BOVA 4DCUA 5KTYA 5KU1A 2WJHA 2VP9A 3JZAA 4KHZA 1UKZA 4RFVA 1IN5A 1D9ZA 3IEUA 4B76A 4EAQA 4P33A 1R4AA 3K0AA 2QU8A 2AD5A 1QVAA 3FGNA 5IRCD 5FL7D 4Q1CA 1JEEA 5CIQA 1TU4A 4A0RA 1Q20A 2IK8A 3VKWA 1G17A 5FOVA 1Z8FA 1SVIA 1W0JD 3W34A 4ZKDA 1XNJA 3K9NA 3SHFA 4C0JA 4AKGA 2Z4RA 2QM7A 3KKPA 2YVUA 4KYUA 2FN4A 2ZIAA 3EZ2A 4XOIA 4B3CA 2OZEA 1ODFA 3QXJA 5BN3A 4LYHA 4QBHA 1F2UB 3BORA 1U0JA 3U3OA 4RSGA 4MYHA 2QMEA 3CB4A 2QAJA 4AI6A 3REFA 5FBWB 4Q4JA 4UJ3A 4GOXA 4ESHA 3VNUA 1VCNA 2F1IA 3LAWA 4B32A 2XNSA 3PR1A 1WQ1R 1EK0A 2O8BA 2AXPA 1AGPA 3AQ4A 1FP7A 3NC1C 5H1YA 1Z6XA 1GNRA 2C04A 3X2SA 1NI3A 2QMHA 3IPYA 3ZVRA 4UNPA 2H5EA 1VMAA 4HYYA 2W2XA 3EW9A 2FSGA 3KJHA 2DBYA 3BBPA 1ZCBA 2OAQ1 4ABYA 1EGAA 3CF2A 1W4BA 3K1JA 2HJVA 2B7CA 2ZVPX 1VG8A 1UKYA 2AK2A 5E7JA 4YQFA 4KYIB 2IXFA 2RGNA 1GFIA 2FEOA 2YWGA 3IQXA 4FMCF 1T8TA 4MRNA 5JRZA 1G291 4A2WA 1RJ9B 1KY3A 4B43A 4QJ5A 1HTWA 1TQ4A 1YR6A 2EFHB 2GNOA 2EWWA 4Q1FA 4RCZA 4FN5A 1Z83A 2ZRHA 4DLYA 3I8XA 1NVUQ 3THYB 4K8OA 4QC2A 3AKCA 5BYKA 3SHWA 1E99A 1OIVA 1XCMA 1VG1A 4BECA 2UVQA 4A0FA 1ZC3A 2C78A 2QP3A 3L0OA 4G5RA 4X8MA 5JFGA 4Z8XA 5H8WA 4BRWA 3W8RA 3EPHA 2G9NA 2RKOA 5UKDA 4TYYA 5J4YA 4OQNA 5EQTA 1N0VC 1HH4A 1KI8A 1JB1A 4KFUA 2OBLA 2ZI6A 1KK1A 3IHWA 3CPEA 4Q1EA 2FWRA 2QA5A 3AGPA 1VCIA 1NP6A 2CLSA 2QL6A 3KL4A 1XD2A 2PX3A 3MWKA 1UBEA 1AZTA 3FMIA 1KI7A 3NWJA 4ZI2A 2CDNA 1P7CA 2ZE8A 1FTSA 1XU4A 2R44A 3U6KA 2N46A 1H8EA 1Z06A 3I72A 4QNMA 4OHYA 4PQFA 5P21A 4BFWA 2VHTA 3DDCA 2VF8A 4JZKA 2V9PA 2CCKA 2ZJYA 4X8OA 5JWOA 3SQWA 2UKDA 3VHXA 5TXGA 4QL3A 2ZR9A 1CKEA 1OB2A 1ZBDA 2RCNA 3AGQA 1R0XA 4Q00A 1LV7A 3HR7A 1ZNYA 2FA9A 3W3ZB 1F2UA 1HYQA 4LY6A 4B71A 4D2IA 5KPJA 4H1UA 3F0TA 3U2QA 1KKLA 1CULC 4RZ2A 3BXZA 4EPVA 4M1SA 3CBQA 3TGPA 3KXKA 2FJUA 2XGJA 2FFBA 3QY0A 2IHYA 3K53A 1N25A 3GLIB 1IAQA 4BFSA 4BQSA 4PX9A 3AP3A 5KHOC 3C7KA 2QSYA 3RABA 3PFIA 1E2LA 1G6HA 2FDCA 1LVGA 4XTRA 3T06B 5JJKA 1Q3HA 4WA7A 1FW6A 4ZDJA 3U3RA 3WNCA 2J45A 4IW3B 4ITRC 1W7AA 3FFBA 5DE3A 5LB2A 2BBWA 2P2LA 3SZRA 5FPKA 4WZBE 2IYSA 1HQYE 1CEEA 4IOKA 3OIUA 2IA5A 1CP2A 2BBOA 3EIHA 2ZSDA 4NE2A 4Q9JA 3I62A 5FI0B 5FOUA 1T3SA 1Z47A 3TR0A 3V4FA 3THXA 4EJSB 1SKYE 4UNQA 2VYFA 4N3NA 4B75A 3B85A 2E9SA 2ORWA 1JPNA 1H8ED 2ORIA 1DAMA 2NO0A 4C0AC 3BWDD 2ZUBA 3U60B 2CJWB 2ONKA 4P4UA 4RFSB 5DI3A 2H92A 3MFYA 1SVLA 2Q6TA 1AM4D 2XTZA 4KO8A 1YRAA 4LJ6A 5JRJA 2O8FB 5LD2B 4M21A 1DE0A 1WDTA 1WBBA 3CZPA 4TL9A 2GZHA 3T1TA 4D0LB 1RYHA 4HAVA 4A8JB 2DY1A 1X6VA 1P2TA 2WTUA 1Z07A 4DCVA 2PLFA 3THWB 1OFTA 2AN9A 3U7FB 2G88A 1NN5A 1PUIA 2VP5A 1UPTA 2V54A 2FPMA 1G3MA 3BFVA 2F55A 4A1FA 1FX0B 5C1BA 1GAJA 4B3FX 4DB4A 5FTKA 1VHLA 1V43A 2O0JA 4NYJQ 4HZUA 1E69A 2ZROA 2OCPA 3UG6A 1YVDA 2HUPA 4D0NA 3AVPA 1BYUA 4JSYA 4QBIA 3HPQA 1FQJA 1UKEA 1MOZA 1GRQA 4LPKA 1J7KA 5FOWA 4UXIA 1NBMA 1SVOA 2ZRAA 521PA 4BEJA 1S2MA 4HB0A 1E9SA 2PZFA 3K8YA 4BZXA 1JI0A 3BGWA 3X1XA 4OQFA 2F9LA 4DDWA 2QPOA 4PR0A 3Q72A 5SZIA 4F92B 2ZQ5A 3GLIA 3NBYC 1CJKC 1VCMA 1NRJB 2HYDA 2TMKA 4NCNA 3NH9A 3AVWA 5EP3A 2V6JA 4BRUA 4MKIA 1C1YA 1YHNA 4RZUA 3E1SA 4G5GA 1E0SA 4FWTA 2H57A 2O8DB 2ERYA 1KO1A 1M1YE 4QBFA 4PAMA 4UQOA 3SJCA 2B21A 4RD3A 2WOJA 5EUMA 4GRAA 5F98A 5EE9A 4TMWA 1KNQA 1E2FA 1FUKA 4IDHA 4YMTA 2GJAA 4XVUA 2GRJA 1OH7A 1W48A 4G1UC 2YOFA 2QT1A 1HEIA 1E0JA 1MT0A 3B60A 4NYIQ 1E2QA 3O8RA 1JJ7A 4CYMA 1G8FA 1AS2A 5FPHA 3MCAA 2RGGA 4U02A 5K8IA 4M1TA 1N6OA 4YDHB 1W5SA 1P4SA 1VG0B 3GLHB 3LRPA 3KTAB 4RFSA 2WWYA 1XZQA 1ZM3A 3SQXA 2QQ0A 2J0QA 3K09A 4ILEA 3Q9LA 1NBMD 3QJYA 4O2LA 1MRSA 2QY9A 1MRNA 2PLRA 4MUBA 4B2LA 2O8FA 4AKIA 1T8UA 1OH5A 4LYAA 2RGNC 5JS8A 2AFHE 2BJVA 1Q57A 3P27A 3SDZA 3HDTA 1G5TA 1ZIOA 2E1RA 3THWA 5G53C 5K8TA 3LA6A 2X1VA 1ZIPA 2YZ2A 3KKOA 4C0LA 3W3AA 4M4SA 1QZXA 2QMOA 3QI2A 2O0HA 4BFTA 1U8AA 3T35A 2ZE5A 1LFDB 2PEYA 4LJ5A 1U94A 2FE4A 1S1CA 3TVDA 5F3WB 3OE7A 1VG9B 2ZRPA 3IQWA 3PEUA 2YC4C 5EP2A 4LHWA 2IEYA 3X1WA 4AC9A 1DS6A 4IOMA 3VR4A 4E5UA 3DOFA 5L3SB 2JLRA 2RGXA 4URUR 1IN4A 3PQCA 5JJIA 2QORA 4KFSA 2AKAB 4DEXA 3SYNA 3TH5A 3CNLA 3TE6A 3LWNA 2JIZD 1OT3A 1OKKA 2JATA 4QXAA 5DYIA 4DLUA 2QRNA 2WJJA 1XRJA 2QTVB 1WMSA 4CEJB 3GEEA 2DHRA 3NEJA 3FMOB 2PZEA 3OEHA 1GG2A 2HCBA 5JEEA 4ZI3A 1LY1A 1ZMXA 2FNAA 2ORVA 3DM5A 2DCUA 3PG5A 4XSGA 4M1YA 5JCZA 4HUQB 1QHHA 3PUWA 4MRVA 2O8DA 1SXJB 1DG3A 2WIBA 5J4KA 4QM7A 4IFEA 1KIMA 2ZI7A 4PZLA 4WOPA 2WPDA 3LFUA 4BZQA 4QM6A 3O47A 4BASA 2F1JA 2IUTA 1W4CA 3D6TB 1W44A 5LB4A 3R7WB 4A0HA 2R8RA 4A15A 3K0EA 1L4UA 4NCIA 1D5CA 2NIPA 4DJTA 1AS0A 1P73A 3I5YA 2ZR0A 3DMNA 2CMKA 1Z22A 1AK2A 3CF6R 1J8YF 4LV6A 4TQAA 4AURA 3J81k 3OE7D 5DLQC 1UBCA 1UEJA 3ZIAD 2FV8A 4Q9IA 3GLHA 3MD0A 3A1TA 1LS1A 3T34A 1XMVA 2CL7X 5CM9C 1N5LA 2IW3A 5FTLA 4EPRA 3O8BA 4JYCA 2Z5FA 3VU9B 3A1VA 2ANBA 4L4UA 3BRWD 3RWOA 4WW0A 3ZVMA 1EXMA 3IUYA 4A9AA 3MWYW 2IXGA 3AKYA 4NH0A 3CR7A 1U2RA 2OLJA 3TMKA 3AH8A 2V6IA 2PCJA 2NO1A 5SZHB 1KK3A 3KQHA 1SGWA 2K5UA 4HLQB 4WZ6A 1DAHA 3OEHD 2XB2A 1Z63A 3AB3A 3QKSB 2G0NA 1F5NA 4IDOA 2Q9AA 1BYIA 1RVDA 1P60A 1R10A 2P67A 2VSOA 3SYLA 2V7QA 1R5OA 4KCGA 3RS4A 1CRPA 2H1LA 1RRFA 1RFLA 4NDZA 4Z8YA 3WMFA 2PJRA 5TVKA 2FFHA 2XEXA 1YZKA 4IOJA 5SZKB 3NDPA 821PA 3Q7QA 1PJRA 2O5VA 3ASYA 4ACAA 4BFXA 3SEAA 1JNYA 3ADDA 1Q12A 3AVQA 3UANA 2OAP1 1IN6A 1S9DA 2XNDA 3KUDA 2GZDA 1DG1G 5IK2A 1Q1ZA 1XXHB 4KSBA 3QPVA 3NEYA 4JLPA 1T5LA 1MO6A 1ESMA 1C4OA 2V55B 2X2EA 1F48A 1JPJA 1T4GA 1U90A 1Z6TA 4NCHA 4NU0A 1T0HB 1GM5A 3T15A 4N0EA 4O2RA 3MWLA 3K0SA 4C7OB 2EWVA 2GAAA 5EE5B 1EFUA 4HUQA 2FX3A 2D06A 1E79A 1NLZA 1Z29A 2C96A 4LV5B 3TAUA 4RD2A 3PIRA 1QHGA 2AD1A 2GK7A 2GETA 2IYRA 1IJEA 4HAWA 4M53A 1KO8A 2IS6A 2DPXA 1H65A 2BBTA 2GEDA 2ZITA 3MAAC 4PPFA 5DI9A 3U7HB 1XEXB 2JLQA 1U0LA 1N6HA 5JHGB 2XZPA 2QGNA 3R7WA 4M9SA 1E2GA 5KSYA 1YR8A 2I1VB 2JLZA 2V7QD 1II8B 4FMBB 1RE0A 4KAXA 3KXLA 2IC5A 3DL0A 3GLFE 4LX0A 1G41A 1OPXA 5KSOA 2IBMA 4N1AA 1KY2A 3KX2A 4DVGA 4WBSA 3QSYA 4LJ9A 4G5QA 2GILA 2VQSA 2G3YA 4US1R 5SZJA 3K9LA 2MSCB 3GJ0A 2W58A 4AKEA 1RZ3A 4BFZA 3QKTA 5D3MA 2XNDD 3JZMA 3R9IA 3TVTA 4ZDKA 5FBVB 5CM8B 1OXVA 2W6IA 5IK2D 1X1SA 2VP2A 1G7CA 3TUIC 2KB0A 3U7EB 3T1OA 2WMNB 2BMJA 4RZ3A 2QUZA 3QXSA 1NN0A 5K8LA 3B1XA 4X8HA 2G1JA 2NQ2C 1N3BA 1MH1A 4IVPA 4KITB 3QKSA 4H1VA 5FBQB 2IUUA 2HV8A 4A4DA 2ZAOA 3I8SA 4OJQA 1ZP6A 1JALA 2BMEA 1CJUC 1E79D 2DWQA 2OXCA 1QF9A 3E70C 4HATA 1XPRA 3K09C 1IN8A 1SXJD 2OCBA 4HAZA 4LBYA 2GBLA 4RVCA 2IYWA 4OJKA 2P5SA 3WP1B 2FG5A 5M04A 5HTKA 5TY0A 4B3DA 4HUTA 3U44B 3RS3A 2A78A 1NLYA 2HT1A 4R71A 2VRWA 4QHTA 2D4HA 3CO5A 3X1YA 1OJLA 2P6NA 2WWXA 2BJWA 4QJ3A 1E9AA 2YINC 2D2EA 2HT6A 4PSAA 1WBDA 2V8OA 3WYGA 1HT2E 1IQPA 1A2BA 2CNWA 1NVVQ 2ZI3A 2ZU6A 4KLNA 3TQFA 2DFTA 4C9BA 4Q48A 1KAGA 3B1VA 1P9WA 1GOTA 4C7OA 4JLVA 4HDOB 1N0UA 4US0R 1KNXA 1OFIA 4TSFA 3M6AA 4FMDB 2W6ID 1KMHB 5JECA 1KSHA 1E4VA 3GQBA 5FUWA 1ZU5A 1CJMA 4RD4A 3BD9A 1UJ2A 2PL3A 4I99A 3SYKA 1E98A 4OQMA 3LO5A 1EG7A 5EP1A 4B74A 2D7CA 3B9QA 4ZCLA 1ESNA 1M34E 3UMFA 3A6PC 2RGBA 3GMTA 1NG9A 1II8A 2CE2X 1A7JA 3K0FA 1L2TA 4ESVA 3DM9B 3Q8XB 4FCWA 3EZFA 4Q1BA 1L8QA 4E22A 4OQXA 2ATVA 2EW1A 4TQ9A 3MMPA 5JCPA 1ZRHA 4LOAA 3QBVA 1OLOA 2WIAA 4HLCA 3VR2A 1H8HA 4LGMA 3W5JA 2GCOA 2R9VA 1XBTA 3P20A 3NDBB 1Z0DA 2C99A 2MMGA 5CB6A 3P1JA 1TQ6A 4BGDA 5HCIA 4I1UA 3G82C 3MG9A 1N6IA 4TLDA 2CNWD 3CZQA 1JR3A 4ZKEA 1Q1BA 1NNEA 3SR0A 2Q3HA 3W90A 2W0SA 4HB4A 3EWAA 2HDNB 3C15C 5BN4A 5DYGA 1W4AA 3PUZA 4PPGA 1X8KA 3CPHA 3VQTA 3E5HA 1E0AA 2YWFA 1TL7C 2X2FA 4TSFD 1N6KA 1S9HA 4BWYA 4FW9A 3RHFA 1KO7A 4D26A 1IN7A 1FUUA 3EWSA 2ASEA 3PUVA 2UZ3A 5FR1A 4PTLA 3DZ8A 4UXHA 2JLSA 4DCSA 2D3WA 4NHOA 3RVBA 2B6HA 1KJYA 1I2MA 3SS8A 3U44A 4M22A 1NJGA 2C2HA 4KFRA 1I4TD 5FOSA 4YMVA 2ZXUA 1P62B 4KVGA 2G77B 2ZREA 4C2UA 2IYLD 1SVWA 1Z3IX 1A5TA 1TEXA 3GJ6A 4CVNA 2QI9C 2ZAMA 4QG7A 1FMLA 1UAAA 4DC9A 2ZR7A 2R6FA 2JASA 1YE8A 5E95A 4C4PA 5KSPA 2Q9CA 4CEHB 4QGFA 3NBZC 3WNDA 1W36B 1LNZA 2A3RA 4KU4A 5E3HA 3R8FA 2OHFA 1ZD8A 4XJXA 3V9PA 1Q3TA 1H8HD 3EG5A 2FEMA 2NO9A 1R0ZA 3VR5A 1U8YA 2W2VA 2O52A 4Y0VA 3BIFA 1KMHA 2IYQA 2ZYUX 4Q47A 5ANRB 1LTQA 2AXNA 4I4LA 1JQJC 4WXRA 1X1RA 1MABA 3GJ5A 3EAQA 1NN3A 2ZRCA 1N2CE 3GJ4A 2VF7A 1FL9A 3VAAA 1JR3D 4V0NA 1OIXA 1U0HC 3GD7A 3U61B 2RB4A 1OYWA 3JVVA 4EUNA 4OHWA 1S3SA 1NSFA 5A4JA 2B8TA 4KI0A 2NZJA 4LJ8A 4US2R 2CHGA 4PO1A 1ETUA 5DO9A 2PEZA 2R6GA 3RC8A 4LYFA 3GFOA 2P0EA 2KSQA 4DUGD 3B1ZA 3FB4A 3C5HA 5CDFA 3EPJA 3QQ5A 3RRZA 3ICQB 3NG1A 1AJEA 2GK6A 3RYTC 3DKPA 3VKHA 4LBVA 3UWOA 2ZETA 2W2TA 2QT0A 3B78A 2WJGA 4OYHA 3W9YA 2FH5B 4TQUS 1E3MA 1BMFA 4EFLA 2WICA 3P32A 4TL8A 2A5JA 4JLKA 3T12A 4D4MA 3QKUA 2DFKB 5EZ6B 2VA8A 2D7DA 3KKNA 4O25A 3UIEA 3SU8A 2GVZC 2IYUA 2XXAB 2XJ4A 4D4KA 2DB3A 1EFTA 3HPRA 1YR7A 4XVQA 4BE7B 5GADl 3EX7C 4DDUA 1EX6A 2R65A 1G19A 1FFHA 1LB1B 4JBWA 3W8NA 3KKQA 4I1VA 2LCFA 1RRCA 1Q22A 3RSOA 4L16A 5EXTA 4Q7JB 3LVQE 5JMTA 5LPNA 4KXFB 3S1AB 4U7DA 4Q4AB 4BFYA 2ZRNA 1ONBA 4LK2A 3VR6A 3IIMA 1HE1C 1GUAA 2BV3A 2QNRA 2AX4A 3E2IA 3KJEA 4M8NE 4CZ2A 2BKUA 2DFLA 4CDGA 4XWOA 4R7ZA 2ZM5A 4PXAA 2EFCB 4FXPA 2C03A 1RJ9A 1ZCAA 1ZUNB 2HLDA 4DLXA 3NHBA 2VO1A 2FSIA 4B6EA 4CEHA 4F93B 5H70A 4ZV4A 5BWMA 2ZRKA 1KKMA 2GBLC 4W7SA 3NVAA 3THYA 2GVDC 2ZSFA 4JIMA 4LI0A 1R0YA 3H4MA 1XMSA 2RH5A 1EFCA 1VYVA 4IDQA 2RGDA 1VYTA 1DAKA 2P6RA 2ZJOA 4JJKA 4UNRA 3BH0A 1NY6A 5FFMA 3W6OA 4Q7KA 3UXMA 3AVVA 1BMFD 4HLUA 3PEVA 1EX7A 3SJZA 3EZ9A 3U3KA 2GXSA 1FP6A 1XB2A 3BB4A 4BLTA 5FTNA 5CB8A 3HU1A 1G18A 3VHLB 4A92A 2Q9BA 3QXXA 3GCGA 3ZZ0A 4FWIB 5CITA 3LBHA 4IOLA 4DKXA 3DPUA 1KDRA 4MRRA 1S8FA 1UDWA 2YNMA 1SULA 1VIAA 4CGZA 1E32A 4URVR 3KB2A 4TLCA 1P9NA 5AR1A 4PC3A 5A5GA 4TZ6A 5KOYA 2C98A 1E94E 2OLKA 4G01B 3BJIC 3BC1A 3GFTA 4NBSA 2KE5A 1T3HA 1TEVA 1NVWQ 4AWXA 4LBWA 1K5DA 3UG7A 3ZZTA 3ASZA 1CRQA 1QVRA 3TBKA 1FNMA 4JMPA 1CR0A 1A2KC 1NJFA 2X77A 3RRNA 1MV5A 4OL0A 4F91B 2OFWA 4K46A 4JVSB 2O8EB 2VLIA 1Z6GA 5AJYA 5BYJA 1AS3A 2HLDD 3B82A 3NXSA 5GJWC 3FMFA 3SI7A 3GLGB 3ADCA 3QEJA 5G40A 4TLAA 4LWZA 2HF9A 1G8GA 4M9XA 3LX8A 1Z08A 1CR2A 3L8YA 4JLNA 1PV4A 3AVXA 4GI7A 1Z6AA 4XTCS 1G8HA 3U4QB 1X86B 2ZUCA 5AJWA 2WM9B 5FPSA 3N2EA 5JLJA 3KQLA 1XFAA 5FL3A 2WSMA 1LS6A 1ZM7A 3D7MA 1HT1E 3HP1A 2ZJBA 2VSFA 1S3GA 1G3UA 4JLMA 4ON9A 3EPLA 3T1VA 1DAIA 1AKEA 4AYWA 4EPYA 2VEDA 3GP8A 2JJ2D 3QPUA 4LYJA 5B64A 2OFOA 2OE2A 2IEZA 4URZR 1NF3A 1P6XA 2NGRA 3HYRA 3LLUA 3LVRE 1TMKA 1G5PA 2BM1A 1ZUIA 4EJSA 1UKVY 4W5WA 1GRNA 1KOFA 3BFKA 3LW8A 4JYBA 2JLVA 3FWYA 3C4JA 4DDVA 3L0IB 2JIZA 4RJLA 5JHHB 4EPTA 1LW7A 2ZRMA 1KI4A 5EE1A 2J1LA 1KDTA 3DKVA 5HE9A 3ZDQA 4LJAA 5CLLA 4S2EA 2CJWA 2H8KA 2PMDA 5FPTA 3DVLA 3RANA 1WP9A 1TPZA 2IYZA 3IEVA 2QRZA 2YWHA 4JL8A 2RHDA 2EVWX 1QHXA 2F1RA 4JLBA 5HCNA 3TW8B 3CX6A 4L9WA 1IY1A 1X8LA 1NBME 1WRBA 5DH9A 3WBJA 2FPKA 2IS2A 4A8JA 2BMDA 2BC9A 2KBFA 4KBFA 2FPLA 3CRVA 2OFXA 3LBIA 4MA4A 4P4SB 5E4FA 3VTKA 4DIDA 1DVRA 2WKQA 2CVFA 3T5DA 2WKRA 3LH5A 1NN1A 2G6BA 4UKDA 2J0UB 5EE0A 2GHIA 3T1QA 4EQ6B 2SHKA 2ZSAA 4B34A 1Q21A 2CLDX 1XD9A 3LNCA 2OV2A 3GLIE 3ZZUA 2WSSA 4FCTA 2A9KA 1F2TB 1FX0A 1KAOA 1VCOA 3PV0A 3A1SA 1DAFA 2XZLA 2F3TA 3GJXC 1D2MA 3AM1A 2ODWA 2PH1A 1XX6A 1TAGA 1R5NA 1TU3A 1IJFA 2BBSA 3ZIAA 4QFMA 4LHXA 2CL6X 2C9OA 3F8TA 3B6EA 3RRMA 1O87A 3MRSA 2P5TB 721PA 2BCJQ 1AIPA 1DADA 3R20A 3ADKA 1UEIA 3NIBA 4Q1DA 4CRWB 1XTKA 2GWHA 5B2ZA 1NLFA 5E7IA 2VPPA 1SKQA 3FHCB 2FF7A 4TN1A 2BDTA 3KUCA 1N0WA 2O8EA 3RLFA 1DTSA 1OW3B 2J7KA 4EIWA 3C16C 3GLGA 3UMRA 1D6JA 1G8YA 2WJIA 2X8AA 4TMXA 4LHVA 1LF0A 4BLRA 3EIQA 3AF1A 4DCTA 4HB2A 3CM0A 5G3ZA 4R9UC 1ZNXA 4DB2A 1DO2A 4JT2A 2L0XA 1KMQA 3BH7A 3LXRA 2GCPA 4YMSA 4BFVA 2ZSEA 3QOFA 4JVNA 1E9RA 3L2OB 4Z51A 4HZIA 4ZDWA 4TWZA 4LC0A 3CW2A 3TAHA 1TF7A 2C95A 3X1DA 3ZJYA 1XTQA 2XZOA 2ZEJA 4MH0R 4LSGA 4JS0A 4DLVA 5GJBA 3FOZA 3VKGA 4RZXA 2OEPA 4C0BA 4BPBA 4IDNA 1WB9A 4Q5IA 4RCYA 1HY3A 2GEUA 2IS1A 3EA5A 1SHKA 2VP4A 1S96A 3AVYA 4MGIR 1S4QA 1VTKA 5J47A 1KI3A 2WSSD 4I81A 4Q19A 3TKLA 2WBLC 1M7HA 2RAPA 1TUEA 4IXNA 4Q9KA 1G20E 5DHFA 3PXGA 3I1FA 3OAAA 1G1MA 4M9QA 2A5FA 3VR3A 4PHHA 3L0PA 3HJNA 3M4YA 4TMKA 5FTJA 4MDEA 5F9HA 4D4JA 1VIYA 4MYUA 3TR5A 2OG2A 3KTAA 5AUQA 4EFNA 4B73A 1JBKA 1P5ZB 1UBGA 1Y3AA 2BHRA 1G21E 2W83A 2ZTSA 1TX4B 3LQQA 2DFNA 3MJRA 4LHYA 2KJQA 1CIPA 4GOJA 2IYTA 1XD8A 4PQRA 4JBYA 1BO6A 2HF8A 5AWFC 3AF0A 4PC6A 3IGFA 4G0NA 1GKIA 3A4NA 3FE2A 4W9MC 1FPMA 2VH5R 3FHTA 3R8CA 3B1YA 2GESA 5JS7A 1ZM4A 1US8B 4MYCA 3QG1A 5J5CA 3HU3A 4MKGA 1Z0FA 4KV9A 3LV8A 2A7QA 4MRPA 4C30A 2EFEB 1F2TA 4E07A 4B2IA 2YC2C 5F9FA 5IT5A 4P4TA 1OB5A 1CXZA 1ZC4A 1KI6B 5AK0A 4XVRA 4B3GA 1U9IA 1E1QA 4AYTA 4DLZA 5AJVB 2O0KA 5KYKA 2QTFA 4YMWA 1OSNA 4BFUA 1XWIA 2ZRDA 3CWQA 4HLUC 2J0SA 2DWPA 5EUQB 5L3SA 5JI3E 2LWIA 1Z0IA 4MGKR 3Q85A 3QG5A 2VHJA 3L8ZA 1QG4A 2JCSA 1MO3A 1ZINA 2WHXA 1PLKA 1OE0A 3OAAD 4OI1A 1W2HA 3C14C 4AKHA 2YWEA 5HZKA 4ZCIA 1F6BA 1ZM2A 4CEJA 3QF4B 4JKYA 3AP1A 3LW7A 2NG1A 4NONA 4PANA 3U3MA 2J9RA 1IXRC 1E2HA 3GLHE 4D4LA 4LV8B 5DN6D 4C0KA 2WMOB 1OH6A 2CHVA 5AJZA 2PX0A 5AUOB 4DSUA 1SXJA 3UKDA 2F6RA 3W6NA 3ZVLA 1XPOA 4MQBA 5CYOA 4JVMA 3IPXA 2GXUA 3OFNA 5GVRA 1VKJA 3ZVNA 3WMEA 4L9SA 2REXB 4B47A 4I1OA 1NKTA 5KNBA 1RKBA 2NOAA 2J3EA 3FTQA 4R2IA 2CCGA 1YZUA 1BKDR 2ZVQX 4JLJA 1DOAA 1E2MA 1KHTA 1KK0A 2ODBA 1ZD1A 1AKYA 1AZSC 5J4HA 1E1QD 4QBGB 1QRAA 1OHHA 4JLAA 3V4RA 4MKFA 2IYYA 4MRSA 4MYTA 5FBRB 1KI9A 1CS4C 4GSYA 4OK6A 4Q7MB 3CONA 3AKDA 3M0EA 4RD1A 3CF0A 5A0FA 3ZD7A 4GZLA 4JBXA 2F3RA 1T91A 1BH2A 2Z0MA 4M1KA 3VU9A 1I2DA 2GJ9A 4MUAA 4D25A 4OBEA 3OIVA 4BZPA 2GTPA 1ELOA 5EP4A 3AVOA 4XWAA 3IKJA 4EJSC 1ANKA 1OFUX 1UDXA 2CVHA 4TYWA 1HURA 2PT7A 3I32A 4B6FA 2ZJZA 1US8A 1VYUA 1ZW6A 2RHMA 5IF9A 2JLWA 4RY2A 2ZUDA 3K0AB 2OCYC 3CIOA 2CEAA 3H84A 3HR8A 2ZI5A 4OI2A 4O0MA 1G7TA 3F5FA 2C77A 2ONJA 3KJGA 5JBQA 3CNOA 5BW8A 1Z0JA 1JQLB 1QHNA 1E2JA 4HB3A 4IRUB 4DT1B 2J5XA 4L15A 3P26A 1XF9A 4TL6A 5LD2C 1JEDA 1SXJE 1XCGB 4NYMR 1YZNA 3WBKA 1J2JA 2GF0A 3MJHA 3OFND 1KDOA 4LDJA 4A8JC 1XTSA 1TTTA 4JLOA 4A36A 3MGCA 2CCJA 2EFDB 3PJRA 3C5CA 4Q4JB 1YZQA 4D0GA 1SHZA 2I1QA 4Q18A 4ZIRB 3N2IA 3CX8A 3RS2A 1FNNA 1Z0KA 4GP7A 4U5XA 1XXHA 1MR3F 1Q1QA 3SBDA 4MGYR 5BN5A 3ZD6A 4GP6A 5L8VA 2ZYVX 1DAGA 4XH9B 1GSIA 5EXSA 4TZ0A 4NL4H 3EPKA 4GOKA 4PAOA 3RAPR 1OHHD 2ECKA 1E2DA 1B0UA 2VL7A 2H7VA 3QF4A 1N6RA 3A8TA 1AGRA 1MO4A 1VECA 1ZJ6A 3HYTA 3KJIA 5FH9A 1XMIA 1X3SA 1KO4A 2F43B 1OV4A 1IXSB 3PENA 3TJZA 3KFXA 3FKSA 1CLUA 2D74A 3I73A 5K8UA 1GL6A 4URXR 1J70A 1W47A 3B2EA 1OXXK 2VHQA 2ZJ8A 4EPWA 3RRYA 4AG6A 1KJWA 2ATXA 3KB1A 1G6OA 5FBLB 1Q1EA 2WWHA 1NIPA 1XEXA 3LXXA 1W1WA 3LY5A 3ND9A 3BS4A 2WWGA 2N42A 1GP2A 5FUVA 4AD8A 4ERNA 2W6JA 4NZYA 4Q4HB 4B48A 2KWIA 4DDTA 1FTNA 3ONWA 4QNRA 5BQ5A 2FOLA 1I4DD 3QNUA 4UXJA 4TYQA 2XB4A 2ZYTX 2JLUA 3I92A 2V1UA 2ZS9A 3I4LA 4TTQA 4QKQA 1R2QA 3OF5A 4B2PA 1N5JA 1P2VA 4BLOA 4G5SA 2CXXA 2ZPTX 3TSOA 2QAGB 1XPUA 3VR1A 1CR4A 3QUSA 3ZH9B 1W5TA 1GZSA 3RWMB 4CW7A 3WP0A 5HKKD 2FU5C 4C2TA 2BEKA 4BLSA 5GVSA 3C41J 1SKYB 5JJLA 3EZ7A 2VTKA 1NG1A 1XXHE 4DSNA 4ASUD 2ZRIA 1YZGA 4GZMA 2ODEA 1RIFA 2QQEA 4CEIB 2R6CA 4F4JA 2D2FA 3GJ3A 4M9ZA 421PA 1G3QA 3FKSD 1E96A 4UNNA 2A2ZA 3BFXA 1WA5A 3GJ8A 4IXMA 4OQLA 3T5GA 4E09A 4TYNA 3AEZA 1FOEB 5KDOA 3H86A 2ZJ5A 4DT1A 4F38A 1M7GA 2GXQA 2IF2A 3OEED 3IILA 1TF2A 1P2SA 3KDSE 1M6NA 2GJKA 3DO6A 4I1SA 3G5UA 4PHGA 4DUGA 1QHYA 1E2EA 2XITA 3QXCA 1W4RA 2ZSBA 4FMDF 1NMXA 2Q21A 1EFRA 2WAYA 2WAXA 3WMGA 2X19A 2FGKA 1NSTA 3Q3JB 1Z2CA 2W6JD 4LZZA 4ZIRA 2GJSA 5FOTA 2IWRA 5AJXA 1OFHA 2ZANA 3IIJA 1YQTA 3CRW1 3LLMA 3EIEA 3DZDA 1P9RA 3LQRA 4P32A 4QOSA 5TDHA 3N70A 4M0LA 3BB3A 4LBZA 1W0KA 4AG5A 2HJGA 2HXYA 1U9IC 1UFQA 4IJMA 1U8ZA 3CX7A 2XOKA 4KBGA 2WZQA 4M1MA 4CF7A 4F4CA 2F43A 2PT5A 2C9YA 2IHBA 1CF4A 2AKYA 1E9EA 1ZM9A 1KYIA 1G3RA 1JAIA 2QEQA 1RYFA 1GITA 3ECCA 3M1IA 4TLEA 2R62A 3IO3A 5CK5A 1IY0A 2ZE6A 3THOA 4CT5A 2Q3FA 3QVUA 1LF5A 1WCV1 3THXB 3PUXA 3IHLA 4HDQB 3SN6A 3FMPB 4WXPA 2GCNA 3IO5A 4PC7A 4GNKA 1GIAA 5HR5A 4HLDA 1JR3E 2A30A 4Q4HA 1XZPA 2D62A 5C4GB 3OESA 4PPQA 4PQYA 1IOZA 5DI3B 1XEFA 4L8GA 4HAUA 1S0UA 1RC8A 2YKGA 2ZRGA 1U98A 4C0SA 3HWSA 3A36A 1C9KA 4DHEA 5AUNB 5KNCA 2J7PA 2OCAA 1SXJC 4OK5A 3B7GA 3VNVA 2QAGA 1EFRD 1V5WA 3OHMA 1OYYA 2IX3A 3GJ7A 2N1BA 3H1TA 2WKPA 1TUIA 3A4MA 1VDZA 4FI3C 4JKIA 2F1HA 3RS5A 4Q9HA 1Z5ZA 1OXTA 3QXHA 1ZNZA 3WNBA 4P0TA 1W0KD 5L3VA 1GNQA 3KZ1E 1AA9A 4E03A 4H9GA 4CEIA 1YRBA 1WE2A 4IEEA 2XOKD 2XTNA 3B5JA 4IFBA 2VBCA 4HZUB 1GL9B 1GDDA 5KDDA 4XD7A 4AY2A 4TMTA 3WY9A 1NMZA 5B30A 5F2EA 1X8JA 2HXSA 5TB5A 5B57C 1SQ5A 4Q21A 2GEVA 4D80A 2R6DA 1COWA 2NO7A 3U7GA 1RRGA 1KSGA 2REOA 1J99A 2Q3MA 3V00A 5JSZB 2NZ8A 5B58C 4DLSA 3I5XA 4MDFA 4HI0E 1NVXQ 3ZGXA 2G83A 1G16A 1SZPA 3TNFA 1PVOA 3NBFA 2KBEA 4JJZA 1UF9A 3HU2A 4Q01A 4GL2A 4A0GA 1R8SA 2WJVA 1MKYA 5C18A 2VP6A 2H17A 1Z2AA 4W5HA 1D9XA 2J7PD 3NC0C 2F9MA 5D3QA 2Y8EA 1XJCA 3FFAA 4NPHA 4YONB 2B92A 3BB1A 2ZRLA 5CJ2A 4OI4A 1P2UA 2QZ4A 4LJ4A 3SNHA 2JDIA 2ZS7A 3IIKA 2YHSA 5C46F 5CDFE 2G1KA 1AQYA 3TSZA 1KK2A 1YJ5A 3W5IA 2QP4A 3PCRB 3ICEA 4GFDA 5EXXA 3SFZA 4IVRA 1NVVR 2IS4A 2J87A 4F7WA 1N6NA 3GEIA 2AWNA 3KKMA 4NCKA 1NY5A 3NTUA 1D8TA 4PO8A 4Q66C 4A6XA 2P65A 1B23P 2C9CA 2JJ2A 3A1UA 2FSFA 1E9DA 3N5CA 3TLXA 4JL5A 3RC3A 3UK6A 2QBYB 1XTRA 3UMSA 4XD7D 1XEWY 4QGHA 2REBA 1GWNA 5DNYB 1OH8A 4BEBA 1ZUHA 4C3ZA 3L0SA 2R6AA 4WZAE 5CIWA 4DLTA 4G3XA 2XAUA 4KODA 5E7MA 4KLZA 1COWD 3O8CA 3BE4A 2R2AA 3EC1A 1J90A 1R8QA 1PLLA 3ADBA 1K5GA 2ODNA 1CU1A 2WWFA 1CJTC 2IXEA 4UNSA 4NKRA 4L5BA 3AF3A 2GJ8A 5L3RA 4A2QA 2HCJB 3UPUA 4B35A 2BMFA 2Z6VA 4QHYA 2NPFA 4Z1MA 3TIFA 1CJVC 3IDQA 3A58B 4R98A 3U3JA 4OHVA 1AN0A 2ZI9A 3EARA 3R9WA 5FI1B 1W36D 3QKRB 5HE8A 1UM8A 3KQKA 5KO2A 1F60A 1E6CA 2B7BA 1NL3A 3L43A 4M1WA 5C4MA 2Q0HA 5LBIA 3TUJC 1P72A 221PA 2JDID 2XXAA 4IEIA 2WWWA 3TQCA 3WHKA 3ZS9A 2OBMA 4V02A 2G0TA 3AKEA 4YDSA 3C8UA 3PUYA 2ZYWX 4LUCA 4Z54A 3K0CA 3RS7A 5FOXA 1Y63A 2DR3A 1Z28A 2KI5A 5JSZA 1QBKC 1W2GA 3B8HA 5GJVC 3S1AA 3TW4A 4Q4AA 2IWHA 2JLXA 2OO7A 4V0LA 4DCNA 2OILA 4DZZA 5J4LA 2FSHA 2VSXA 4V0MA 3UATA 2A5DA 3K70B 5JWRA 2RGEA 1GTVA 5LDDC 2JJ1A 4DLRA 1IM2A 2P3SA 3SJBA 3FYHA 3KFVA 4ACBA 1IHUA 2WJYA 1N5IA 1E1RA 4O3MA 1EWQA 1MO5A 4A2PA 4JT4A 2NMVA 2QN6A 1QHHB 1E9FA 4HSEA 3QEOA 4XSHA 1OXSC 4FD2A 4TL7A 5KSZA 5CK4A 3DMDA 1ZD9A 3CRQA 2CE7A 3IBGA 3VX3A 4LRWA 3WXMA 3ETLA 2CK3A 4W5JA 5EXPA 5C2JB 2YOGA 2PCLA 3L82B 2QTHA 1EFHA 3CPJB 2XSZA 1XTJA 2NO6A 3H2YA 1W49A 4Z1MD 4ZPXA 1E2NA 1F3OA 4Q02A 2J0VA 1N6LA 2ZI4A 1KSJA 4MITA 4DXAA 2FZ4A 4M2LA 1KO5A 2ZJAA 2OXRA 5J4VA 3AV0B 1XMJA 4DLWA 1JXMA 1OXUA 4DWJA 2QBYA 2YYZA 1HA3A 5KNDA 2CL0X 4G5OA 2CLCX 4N0DA 3B9PA 4PPNA 1P61B 2VP0A 2FZLA 2BCGY 2XTMA 2BEJA 2GXAA 3AVTA 4RD0A 3ZS8A 3I3SR 1DO0A 4LJ7A 1GRRA 2GF9A 1QDEA 4DBLC 3RDPA 4OI0A 1Z6YA 2J59A 2JJ8A 4JSTA 4PC1A 2EYQA 1P75A 3TUZC 1KZGB 4BUJA 1NMYA 4JVLA 3BH6A 2ZU0C 1E2PA 2JJ1D 1NIJA 4NYMQ 5CJPA 4V0ME 3RSLA 5L3QB 6Q21A 1E1RD 2FFQA 1A82A 1TF5A 1ZNWA 4F4IA 5BXQC 1UADA 2QG6A 3GLFB 3F3YA 1M8PA 3AUYA 4DSOA 1G9XA 3K9HA 1GNPA 4GPTA 2OESA 3EC2A 5J40A 4QJ4A 1KJZA 3NH6A 2ZRFA 3QKRA 4P3YA 1GL7A 4GMXA 4K81B 2CK3D 3B13B 2AK3A 1I4LD 3U4QA 5ELXA 2ERXA 4HAYA 2QAGC 2EYUA 3EA0A 2XSZD 4TYPA 3CUEF 121PA 1HE8B 2I4IA 2QENA 2CHQA 1OIWA 3GFPA 3KQNA 3X1ZA 1N6PA 1SVSA 1HQCA 4PC2A 4IDPA 2QP9X 4KSCA 1E2IA 2IUSA 5CLQA 4GDFA 1U81A 3SFVA 4EDHA 2BM0A 3CH5A 4QHSA 4LJYA 4V0KA 1J8MF 2AFIE 2IL1A 2FGJA 3VX4A 1KI2A 5HPYB 1DPFA 1E0KA 4PAQA 5IDVA 2GDJA 3KXIA 3ZLJA 2AHOA 2V3CC 2QMUA 3FDIA 3MLEA 4HDCA 4EPXA 3QIAA 1D2NA 4RD6A 1R6BX 1IBRA 1G64A 2FFAA 4QRHA 4QGGA 4AYXA 4NCJA 1T9HA 4KJZA 2YOHA 1KZ7B 2LKCA 1L7VC 1DELA 3NBXX 4II7A 4ZO4A 1P3JA 4YC7A 2RGCA 2ZRJA 2BWJA 5KPDA 4AIIA 3OIWA 1A1VA 2QPAA 2OBNA 2F7SA 3PVSA 4TMZA 4WIAA 1S1MA 3P4YA 4NTZA 5DN6A 3Q5DA 1G4AE 4IKEA 4B3XA 4KVAA 1YZTA 2JAQA 2GA8A 2H18A 2DWOA 3GPLA 1AQUA 4U00A 3NHAA 3BOSA 3SOPA 1EWRA 2FMXA 2GKSA 2OT3B 3PITA 5FPYA 1DAEA 1XTIA 1WF3A 4V03A 2XX3A 2ZS8A 3A1WA 2MSEB 4P4SA 2I3BA 3ZQJA 2O8CB 1Q0UA 1YU9A 5DISB 2HYIC 4HEJA 3GLGE 2ZRBA 3AP2A 1Q44A 3CRRA 2J0UA 4Y0AA 5FTMA 4EQ6A 1W36C 1JECA 3GEHA 3AUXA 4OK3A 3QE0A 4LPSA 4X8LA 2NTYC 4LC1A 4ZDIA 4POAA 1E4YA 4TTPA 1K8RA 4URWR 5D3MB 3H0KA 3WYAA 4QGAA 5DGXA 2IT1A 2JA1A 2IYVA 3IBYA 1XP8A 2ANCA 4A82A 1G8PA 3REGA 3SC3A 5G3YA 1OKKD 1DARA 5CYPA 2GZAA 3K70D 1JJVA 1TADA 2OM2A 1W46A 3EZ6A 2WV9A 4PHTA 2PZGA 5L3QA 2OUKA 3K9GA 3G0HA 3FVQA 4NYJR 1KDPA 1A4RA 4EFMA 3GLFA 3CKLA 5H68A 4GMDA 3NKVA 3MUFA 4B33A 5DHAA 3AF4A 3A4LA 3BERA 3CR8A 1U99A 5AUPB 4P31A 2WPDD 3UWKA 2XJ9A 1RPZA 2V1XA 5JWHA 4LCBA 1M2OB 1T5IA 1IONA 1R0WA 1SVKA 2C5LA 2AL7A 2LKDA 3ND8A 1JXOA 4PSVA 3SE0A 5TMPA 3LDAA 3EXAA 1JR6A 3QENA 4XIGS 4Q9LA 1PLJA 4S35A 4RKFA 4Q7LA 1RRPA 5DIFA 2PMKA 5DSZA 1D2EA 4TTRA 3FHOA 3QPWA 5FUXA 4ARZB 4D82A 2QM8A 4XWKA 4IHQA 3AVUA 4FCVA 3DOEA 1YR9A 3LX5A 4LHZA 4PO9A 4URYR 4ZCMA 1WXQA 2J41A 4TT3A 4V0OA 1K6MA 3W6PA 4PSKA 1R7RA 3WYFA 2GAOA 5HZHA 3PEYA 4OHXA 4DEYA 3OZXA 3T61A 1YZLA 2Z83A 5JZVA 1XJQA 3K0CC 3KQUA 3WHLA 2BVNA 1CBUA 1PZNA 2QPTA 1VHTA 5EZ5A 1II9A 1BIFA 4DSTA 8OHMA 2UZIR 1JAHA 1GVNB 4NMMA 2QGZA 4Q03A 5TV2A 2EU8A 2C8VA 2B8WA 4NYIR 1T6NA 1TQDA 2A5GA 2W0MA 3R9XA 3ZYCA 2JEOA 2JGNA 2PJZA 3K0FB 2QSZA 1KTVA 3LBNA 2BKEA 3TSWA 4DIEA 4D81A 2J46A 4OKSA 2O8CA 2V4ZA 1EESA 1T3LA 2VIIA 1KI1A 1OF1A 2YV5A 1KSFX 1Z0AA 2AWOA 1SVMA 3D8BA 3BAFA 3RNLA 4YLGA 2W00A 1QG2A 3MSXA 2QE7A 5JEDA 1ZU4A 2ZE7A 5G41A 3U6BA 1QHIA 4B44A 4IVQA 2A5YB 1TNDA 2GCOB 1KI6A 1XJ0A 1DBSA 3WRXC 5JI2E 1IY2A 2NPIA 1BOFA 1E9BA 1NKSA 3MWJA 1M7BA 3BK7A 2P6UA 4PFSA 3DHWC 3DEFA 1CTQA 1L4YA 4YXWA 1ZAKA 4KFTA 1E2KA 1T0JB 4MGZR 3TK1A 5FR2A 1XEWX 2CBZA 2JLYA 3AF2A 1G7SA 2ZJ2A 4C0QC 1CR1A 4TT3D 3Q5EA 1II0A 1O3YA 4PHFA 4Q4LA 1HV8A 4A6PA 3B1WA 3P4XA 2BIFA 1N5KA 2IF0A 3O8DA 5HKKA 4FIDA 1KGDA 4TMVA 4BLPA 4WVFA 2O8BB 1DEKA 4ASUA 4JLDA 3FKQA 3TRFA
chains in the Genus database with same CATH superfamily
3Q7TA 1S4MA 5TQVA 1IUPA 4QG3A 1RXYA 2CNLA 4ANFA 2DYKA 2VHCA 3LY7A 1C9DB 3OIYA 1NYTA 3I05A 4EW3A 2MMCA 4KZPA 3UA3A 1X7WA 2JEZA 4C4TA 3FNFA 4ED9A 2WWIA 2ZULA 5LQCA 4JVOA 3EXG1 1W0JA 2C3YA 3VO9A 5DBIA 1UP4A 3HLYA 1OLSA 3VMFA 4GT1A 3PZRA 4J2OA 2B69A 2XMZA 3PGKA 3KJNA 2MSKA 2XUPA 3GBVA 4V0QA 1DXQA 4G0UA 3VFDA 1UBFA 4YRKA 2QROA 1ZQ9A 3E6AA 2WFZA 1CUDA 2UUPA 3CNNA 3EASA 3PHCA 4YRQA 4XOUA 5AVSA 3N1UA 3P71T 1G66A 4M1OA 3STXA 7REQA 5EAIA 1JHPA 1TCVA 3ZQ6A 4OG2A 2O1WA 4JC0A 3BIOA 1GKUB 4Z0PA 3FSJX 2ZSJA 4ZT3A 1ZZGA 3D2BA 4YALA 4P0PB 2NUTA 3MWGA 4GVLA 4AIRA 4CIBA 2P4UA 1GILA 3BVPA 4ARBA 5IZCC 3GA5A 3CMMA 1FLDA 3FOCA 3QLEA 2CV1A 621PA 3FPAA 3KRTA 3KZMA 4OXIA 4RW0A 5DGCA 2YJNA 4LY0A 2XIQA 3U81A 2I2DA 2SCUB 1TYCA 1L5YA 1MABB 1MB2A 2ZIWB 4KMMA 1YFJA 1VHDA 4DRZA 3QELA 1JN0A 1GARA 4C6RA 3NGXA 5IHPA 1O9HA 4LTDA 5JSHA 1G7RA 4XXHA 3VU1A 4IIXA 2EFGA 3CH4B 5J2TF 4G26A 1NSYA 2IV2X 1UUFA 4R41A 3U5ZB 4OQEA 4E5PA 3QF7A 1TQ2A 4Q16A 2XVAA 4KC0A 1FQOA 2C92A 1AKRA 1ZK3A 2ATIA 2G1AA 3V1MA 1Z88A 2MSNA 3IEUA 4KEAA 4RV5A 4XCXA 4D9MA 1ZOPA 1CSEE 2AD5A 3MTAA 3FGNA 3D4OA 4WT7A 2XGMA 3NTLA 3IYLW 1T36B 2OGUA 4IQ8A 5FL7D 3RUEA 3GLUA 3W8EA 1Q20A 1L3CA 3EXHC 4BIMA 2VOJA 1V5EA 3KVVA 5FOVA 1Y81A 1Z8FA 1SVIA 2PGOA 2Z3VA 3W34A 3ZNOA 5J3JA 1IYZA 1F6DA 2RI0A 3F9CA 2VTVA 4C0JA 2PMFA 2Z4RA 3VHXB 3E81A 9ABPA 4DKJA 4BQNA 1XA0A 2C57A 4XOIA 4B3CA 1FBNA 4PCLA 1L8LA 4QOJA 5HF6A 5A71A 4B85A 5HVNA 3RAFC 3AETB 1ODFA 1H22A 3ZWXA 4LYHA 1F2UB 2AE1A 3EBLA 4RSGA 4BKOA 4MYHA 4JDPA 5LCXA 3WC4A 4OSPA 1SZCA 2GTHA 4AI6A 3B1JA 4R8SA 3DTVB 5E4YA 2ZR8A 3REFA 3IAM1 4Q4JA 3RK0A 3BK2A 1E92A 3JAKA 2JKZA 3K5HA 2HX1A 4DCOA 4ESHA 4UE6A 4B32A 3B70A 3NJRA 3PQ5A 1HORA 2XNSA 1XE3A 1I7SB 3BMCB 2VC2B 1GLVA 4YUYA 2FE1A 1B8UA 3AQ4A 3B1FA 3RF6A 5H1YA 1DAPA 1U3TA 1FMCA 3JSXA 3P96A 1CIJA 3NBUA 4RHYA 5LA6A 3WGGA 1NI3A 3X2SA 2ZATA 4FYYA 1IHXA 2CLKB 4XRGA 4TZKA 4U4AA 3W7BA 3IEIA 3K9WA 4FP9A 1REQB 4BLUA 5JU6A 4ABYA 3PXEA 1I4EB 2Z9DA 1ZH2A 4C6TA 5ABPA 2HJVA 3ABOB 2B7CA 2ZVPX 3GDWA 1ATZA 4RNDB 2AK2A 3KLOA 3VPFA 4PCUA 1MCZA 1GFIA 2YWRA 4W9NC 4EA9A 3IQXA 3QWFA 1G291 2VRNA 3IUMA 4E4RA 3DLIA 1RJ9B 4X24A 1ACJA 4XJSA 4B43A 5GONA 3U0BA 5JS6A 3CLKA 1J2EA 2NVUB 4ARUA 1UEXC 2QRLA 4UHCA 4RV9A 1L1FA 4COOA 4WNIA 3B36A 2X5OA 4FN5A 1XCLA 2Y66A 2ZRHA 4ND5A 4UD6A 1NVUQ 2EGGA 1C3EA 4OYLA 1AO3A 5CU7A 4IGIA 3S1LA 2I3ZA 5BYKA 3KE9A 1OIVA 1EXVA 3FOEC 4MVJI 1U02A 1RHQA 1VG1A 1Z13A 2HV9A 2PY6A 2UVQA 3FLEA 4X8MA 2YTZA 4ENUA 4WNCA 3UUFA 4Z8XA 3ZGYA 3H9BA 4Y98A 3W8RA 2G9NA 4BRWA 2XCTB 2RKOA 5H8WA 4K9DA 3UCFA 5KQSA 1KJ8A 1BH6A 1Y80A 3N2NA 1HH4A 5BN1A 3KBOA 2HHCA 1JB1A 2CSUA 2BEWA 1XCJA 2OBLA 2Q6IA 2SBTA 4FBMA 4KNWA 1SA0A 4PZEA 4A5SA 4UQLA 3IHWA 2WJ6A 3CPEA 4ZREA 2QA5A 1VCIA 4GQAA 4JKOA 4V2UA 4AUEA 1E63A 1QYVA 3N8IA 2PX3A 3P19A 2LZ0A 1VB3A 4FMPA 1AZTA 3FMIA 3A25A 1G2QA 5AHRA 2NYRA 4JCOA 5DFAA 2M6KA 2P0AA 4C05A 1J0BA 3E58A 3G17A 1J49A 1FTSA 3DXYA 4JQYA 4V39A 1XU4A 2WJZB 4FGLA 3U6KA 3U4HA 4E4TA 1H8EA 3K4HA 2ECFA 1Z2OX 1TO6A 4PQFA 1DX6A 3PNOA 1EUCB 3MERA 3GMSA 3QVGA 5H59A 2ZJYA 2CCKA 3GA7A 4BLVA 3SZOA 1AKTA 1ORTA 2F90A 1RNLA 2P11A 2YCBA 4ZQHA 2CJXA 4LN1A 3AGQA 5AI9A 4BDTA 1OA1A 1R0XA 3E84A 2ZRQA 5HZGA 1TFUA 2XE6A 2XMGA 3JVIA 3TM5A 2FA9A 3W3ZB 2O2DA 2O2YA 4YRMA 4H1UA 3P9QA 4H7EA 4RELA 1KKLA 1CULC 1IEXA 1OBCA 1T13A 4WDQA 4ZI7A 2OCLA 4M1SA 3FNQA 4XFDA 3DYVA 3WLTA 4F3KA 4P7JA 4RC9A 2FFBA 2PA0A 1ZGJA 1ZA2A 2NU7A 1QGOA 2V65A 1OGJA 2UAGA 3AP3A 1CUCA 3GUVA 4L78A 2WINI 1YSCA 4RDXA 4PV7A 1IVNA 4FONA 3RABA 2D5CA 2W6ZA 3HCFA 3ROPA 1IZ7A 1DQRA 2HSEA 1FSZA 2QLNA 2C5GA 2PV0A 3A6KA 5CP8A 1FW6A 4WLFA 3WNCA 4JBIA 4IW3B 1WPRA 1GFZA 4B81A 4DWWA 3D6MA 4KDEA 5BMOA 5DZSA 5LB2A 1WVGA 1FDOA 2P2LA 3WGUA 3PYMA 1YIOA 1GR0A 3QU2A 1V16A 4EENA 1S3FA 1CP2A 1P1HA 2BBOA 4KE8A 3ZBQA 2ZSDA 2EZ9A 4NE2A 3H5AA 4WGFA 3UY4A 2JFXA 1NURA 2HRCA 3THXA 1E8NA 2BFBB 1SKYE 2QRPA 2PH3A 1YZYA 4XARA 4R6XA 3GCZA 1PIWA 3NNDA 4B75A 5C5CA 5K0EA 2B34A 2CL5A 2E9SA 2ORWA 2PRYA 1F38A 2ORIA 3K3PA 4KTTE 3BTUA 3L7DA 5BSTA 3RVKA 1HYHA 1Z5GA 4CETA 2C1ZA 3H97A 3BWDD 3W7VA 3G5LA 2CJWB 2VP3A 5DI3A 5BVHA 1AG9A 3HJFA 1SVLA 1W0CA 2GTIA 1NVMB 1GRCA 2DUUA 3O1JC 5KBYA 3MQ2A 1ZMOA 1LPNA 3DAPA 3H5WA 5BR8B 2JGFA 3TDMA 3FDZB 4GIBA 2JARA 3ROMA 4HQRA 5JRJA 4KREA 4MUFA 4M21A 1RS0A 4BO0A 3CZPA 1JSRA 4IILA 5E4TA 3WTBA 1SB9A 1JHZA 3A4VA 4FKBA 1MAHA 2WWVD 4D0LB 4NBWA 3OWXA 3W2TA 1U11A 1UMBB 2OG1A 3DTVD 3IAS6 4V1CI 4O5OA 1P2TA 1Z07A 5I8ZA 1GSAA 4GZ5A 1OFTA 2HXGA 2PX2A 1OI2A 1YQUA 3F3SA 1RWPA 2G25A 3IEXA 2FPMA 4PHCA 4NQZA 4ZANA 4EO9A 2L42A 3CLHA 2VWQA 3OMXA 3HYCA 4A1FA 3M5DA 3MRXA 1ZFNA 1HSZA 2DH6A 2R1ZA 3FAKA 4C4YA 1VHLA 2RJOA 5KVCA 3B6JA 4DCJA 1V43A 1Q0RA 3N9IA 4P3XA 1Z56C 4PN7A 1N2JA 2QTMA 2VHVA 3ICWA 4N4AA 3NEAA 5IM5A 3ZX5A 2E82A 1CY0A 1E69A 1XDZA 1N2OA 3C1UA 4C6HA 4N7RA 5ETJA 3AVPA 2NLOA 4AN4A 3ZI4A 1A4XA 2RHOA 3DFKA 1FQJA 1KZ9A 1ACLA 1MOZA 4CM6A 1J7KA 1U9CA 4NENB 4ZVUA 3T3HA 4YRRA 1YZFA 2BFEA 4ZVPA 1SU7A 521PA 5HOQA 5I4BA 2GBPA 4BEJA 1KJIA 1S2MA 1GU0A 4JOCA 3RBVA 3QVOA 2OHXA 3NHUA 1JI0A 1R16A 2PL1A 4QYTA 2H9IA 3IQIX 1SBIA 1B0ZA 2F9LA 4DDWA 3V3KA 5JNVA 3H0EA 2CJYA 2BJHA 4PR0A 2CZQA 2O2IA 5SZIA 3ZE1B 1PG0A 3L6RA 3A3PA 1FFGA 5JRDS 3LIPA 1G5QA 2CMFA 5I9BA 2ZQ5A 4DREA 4YCSA 3AONB 3GLIA 3NBYC 1CJKC 1NRJB 2HYDA 2P0YA 4NY1A 1NXVA 4YQEA 5T3YA 2HJHA 3ZCSA 3UEOA 1UPUA 1JZQA 2XCOA 4CKXA 1FS5A 2EP5A 4EG1A 4HN4B 2V6JA 1J0EA 1O1YA 4PYLA 1IWOA 2CXTA 5AI6A 4FWTA 3CUYA 2H57A 3STHA 4XDYA 2O8DB 1KO1A 1LGYA 1M1YE 4QBFA 2C2WA 4U7PB 2B21A 4UTVA 6PFKA 5FX2A 3UENA 5EUMA 5T4EA 2NUPA 3PTZA 4GRAA 3X2EA 4WBNB 2XUAA 3HP4A 3M2PA 1MLDA 3VNSA 2Q5FA 2QD4A 4ZICA 2ETXA 1DTWB 5A5EA 3NVMB 1BC5A 1OZ0A 1U9ZA 4E32A 2QD5A 4EG5A 1QV7A 2QQFA 1E1NA 2YOFA 3TSYA 2QT1A 3KWLA 5F3RA 1DKUA 4DIOA 3OFSA 4QLAA 1QTQA 2H0AA 1HWYA 3H87A 1XDSA 3O8RA 4K2HA 3DONA 1SG0A 2WJAA 1G8FA 1Y3BE 4PBRA 4EHLA 1PKEA 2BR5A 4M1TA 1N6OA 3VDRA 2BGRA 4RIFA 1P4SA 3GLHB 1NUSA 4ID9A 3KTAB 1QE5A 3VR0A 1YD7A 1V8DA 2UV8A 3TF5A 3JPWA 4C3OB 4OFXA 3FUWA 1DJOA 3V6MA 1WDLA 4EA8A 5K0FA 3K09A 3IURA 3ZGVA 1XKTA 3QJYA 5KAMA 1PYOA 1H2YA 3ECAA 4X62B 2O8FA 4C06A 4UPVA 1D6MA 2P68A 3QJGA 1T8UA 5KYVA 4ZCQA 2DLDA 1C9NA 2QTTA 4RM2A 4OP2A 1SD1A 1C3LA 1ZXLA 4S12A 1P2BA 2E5WA 2OBXA 1SQ0A 2NYUA 5HGJA 4QFCA 5HK8A 2C07A 4JC8A 4D9FA 1QQ5A 1ECFA 2E1RA 3W6ZA 4M76B 4U7JA 1ZK2A 5LLSA 4J0GA 3DZCA 4MW6A 5ALOA 3B20A 1C0KA 1DC4A 3LA6A 2X1VA 1ZIPA 3KKOA 4FLMA 4FR2A 4L4RA 3FTNA 5DEIA 5ECYA 3W3AA 3MJ4A 2QKYA 1QZXA 3ILXA 1VXRA 3PPXA 2FMFA 3P0IA 3DL7A 3PDIA 3T35A 2PEYA 1CEQA 3JALA 1BKYA 1K8ZB 4BUCA 3FF4A 1PKXA 4FYHA 1U94A 5F3WB 1DIAA 2KQUA 2C9ZA 5LLTA 3PL1A 3KEQA 4ZO9A 4G0PA 3U49A 4BQIA 3QX8A 3X1WA 2VZ9A 1KE1A 1HDEA 3L0DA 3DOFA 1QFXA 3L1IA 2HK9A 2JLRA 5CW2A 1CY2A 4NCAA 1IN4A 2OXFA 3R5FA 4EEXA 2EX0A 1DT5A 4LS3A 4HK4A 3E2MA 1NRIA 1RADA 4HYTA 3CNLA 3SYNA 3B51X 4CHGA 4LRSB 4UEOA 1OT3A 1KYXA 4QXAA 4RQAA 1YMQA 2QRNA 2WJJA 4WJZA 1WMSA 1Q0LA 2QRKA 2DHRA 3FMOB 1CYEA 1LY1A 4M60A 2J30A 2FNAA 5CT5A 2EW2A 3DM5A 4XSGA 1G98A 1ITZA 2D7JA 2HQSA 5AMXA 5BSWA 5JCZA 4X41A 3MT7A 1QHHA 2W4MA 3PXDA 4BP3A 1MQAA 2MR5A 1HMPA 2WHPB 3EXEB 1U0FA 4HJRA 1U8XX 3CX4A 4P6VF 1OX4B 5MN6A 4BDSA 4F85A 2DJIA 1SCNE 2W7TA 3HMQA 4RAOA 2QLTA 2ZI7A 1CVLA 4PX5A 1VM6A 2HDOA 2WPDA 2CSXA 1KEEA 4BVFA 4BMYA 5FWXA 3O47A 1QPGA 4BASA 2X1MA 2D0IA 1Z15A 2YXPX 3C2QA 2PZ8A 4GWLA 1GZVA 2R8RA 1J9EA 4GGPA 4H77A 3T7KA 1I3LA 2E85A 4LECA 5REQB 3SFTA 4DQDA 4YACA 1L7OA 3FOWA 2PSSA 2XKBA 5IAKA 2QLBA 1S8OA 1TT5A 2CMKA 3DMNA 2CZCA 3JQAD 2H59A 2XTJA 4GI2A 4CMAA 4F6RB 5G02A 1FFCA 2YR0A 2B3TA 4DMGA 1KE2A 3DBLA 3OQPA 3OE7D 2FPRA 4X94A 3NWPA 3ZIAD 4GYYA 2EKQA 5KKCA 1BGWA 3A1TA 3W2FA 4DMCA 4P4GA 4UHFA 1XMVA 1F17A 3UOWA 2ET6A 3EGCA 4UMDA 3H6HA 2IW3A 2VRBA 4RCVA 5EZYB 2C7GA 3MPUA 3O8BA 2OKGA 3IIIA 2Z5FA 3OVMA 3EQ7A 2ANBA 4DJDC 5ICEA 3SWWA 4TM8A 2QXUA 2WVHA 1OWPA 2O1XA 4A0QA 3IUYA 3S8YA 2VJDA 2X3FA 2XBLA 4CWAA 5BUQA 5CLJA 3AKYA 2CLMB 2WIJA 2MSLA 3CR7A 4PX2A 3ULKA 1PNRA 3TMKA 1W4ZA 2VJMB 2NO1A 4QZVA 1YK0A 4BVJA 2ZT8A 3HB4X 4HX2A 3O3MB 5CEEA 3EFHA 3KQHA 2ETVA 2K5UA 1DAHA 2J4CA 4NV3A 1MB9A 4ZWNA 4HVCA 1Z63A 1CDZA 3AB3A 3KOYA 4ZT5A 2FUG6 2VJKA 4JK3A 2O8NA 1JEOA 3OJOA 4I1IA 3KR2A 3WK6A 1EXDA 1R5OA 1EDOA 3Q2OA 1P91A 4HYEA 1SUWA 3RS4A 3TQSA 4ZYVA 4IQGA 5KC8A 2I6SA 1ISIA 1O97C 3BM5A 1R5JA 1IB6A 2VEOA 4GGOA 4INPA 2NXCA 5TVKA 3WSWA 2FFHA 2XEXA 2XWBF 3OP4A 5SZKB 3UBTA 3NDPA 2IY7A 1A98A 1AY0A 1X7YB 2O5VA 3ASYA 1KZ6A 4N41A 3G85A 3B38A 1Z5UA 2A4KA 3V8VA 2RGUA 3B3JA 3ENKA 2V3WA 3SEAA 5K4GA 5LJLA 2AOTA 5DP2A 4P9NA 1NW3A 1PL0A 2XADA 4GBJA 4Y2VA 2BL4A 2R2GA 1XO1A 3LT4A 4X0EA 5IEJA 2IU3A 3IP6A 5D6OA 2OCIA 3EDQA 5C5DA 3AEKB 1XXHB 1L9KA 3G9QA 2JCBA 1NHGA 3K15A 5IASA 1ZJYA 5I7WA 5H82A 2VBIA 1D5WA 3F90A 4IG9A 1Z6TA 3FTFA 1GM5A 2FZWA 5I8PA 4FFWA 5CH8A 3RSSA 3K0SA 1RPAA 2GERA 5CH3A 2AG5A 3I37X 1V11A 1RAIA 2HA3A 2ON6A 5EE5B 5ICFA 3SX2A 3TGWA 2V4UA 3PC2A 1K89A 2I2AA 4X6XA 2OQIA 3CEPB 4E14A 2D06A 3BAZA 3D1LA 1M5TA 3IAS1 4RD2A 3DOJA 3SGLA 4LZPA 3P2JA 4EY7A 1A9OA 3S2ZA 2A1UA 4X44A 1KO8A 2Q4OA 5A02A 2Q5JA 1NW4A 2I8CA 4ADSG 1H65A 1D0VA 2ZYIA 4UHJA 1CPYA 1X15A 1ZISA 5K0ZA 1GAEO 2JVIA 5C4IA 4DUZB 2QW8A 2QGNA 2P78A 3JARB 5DLPA 3R7WA 2F48A 1GYPA 1SUBA 4JHXA 4L0CA 4ZA2A 2P79A 4KO1S 5FULA 1GZHB 2IYFA 2V7QD 4M0UA 3LTNC 1SKBA 5ES3A 3IAAA 2HSJA 3ZDZB 2WQZA 3SM9A 3E3LA 2C7PA 3GLFE 3OZAA 3C6QA 5KSOA 1U2PA 4DVGA 2CXRA 2TSYB 5T67A 3QSYA 4G5QA 2JFWA 1VL8A 2WYWA 2GILA 3MT9A 3S2YA 1TW3A 3I2KA 5JXJA 3BWYA 1B6RA 1C30B 2FUCA 2MSCB 2B4KA 1Q50A 4OBBA 3ZNQA 4BWGA 4NJEB 1PZGA 4MYDA 3QKTA 2XNDD 4ZDKA 1L7BA 1T9AA 2AN4A 3QU7A 1DC8A 5CM8B 1ZG3A 3TUIC 1JHDA 3HUEA 3VSAA 5ENVA 4G0OA 4Q6BA 3WL8A 2ZIXB 3L4SO 2BFCB 1NN0A 3D2LA 5K8LA 4BO1A 4C87A 5CDYA 2J3HA 1EHIA 2NQ2C 2X3YA 4MZDA 5B3LA 1N3BA 1MH1A 1OTXA 2Q9UA 1V95A 1UC8A 2EP7A 2CUNA 4NJOA 4DZRA 3FUVA 1ESEA 2BUCA 4KITB 4YMGA 3DKIA 5A9SA 4A4DA 2GFHA 4OJQA 1ZP6A 4W5NA 3K09C 1UAYA 4GVPA 4Z4QA 4K9SA 3O7WA 1C7EA 4JI5B 4RSHA 3M9WA 1XMQB 4OJKA 4M55A 3WP1B 3LYAA 4GM1A 4Y7CA 3UFXB 2G9QA 3WLEA 4ER5A 1X39A 5KNBD 1VL5A 3RS3A 3KPUA 2AUMA 2HT1A 4MJ3A 4ZHSA 4NWIA 4QHTA 4ZJZA 1IG0A 1JA9A 1UK7A 1VYHA 3AHHA 4Q3DA 1OJLA 2P6NA 4LRUA 5AKLA 2BJWA 5ERXA 4CIVA 3Q87B 5CB0A 3OTHA 2GOYA 1H94A 1EGVB 1G2OA 1T29A 1YQDA 2ABWA 2V8OA 2WFLA 3L92A 4AZVA 2A33A 1A2BA 1NVVQ 4C9BA 3ED1A 1L7XA 1TZKA 3IQGX 1P9WA 3O3CA 4MI3A 4C7OA 2I4OA 1PYDA 5FEMA 1Y6RA 3G2QA 1EFLA 4C03A 4KWCA 2ZSKA 3TXAA 1DEOA 5FJIA 1JR4A 4JQSA 3QJ5A 2GEKA 1OFIA 1MJNA 5ESRA 3M6AA 2QD3A 5JNSA 2RH9B 2CXUA 1AF7A 1MB0A 3GZ4A 4BV3A 4CM1A 1HOXA 3O5AA 2X58A 2WU4A 5FUWA 1X3LA 1FA9A 4I4TB 1UOPA 1JFLA 3ELWA 1XKQA 4RD4A 3WFIA 3T7CA 1E98A 1J1UA 2C7RA 2XPCA 1QORA 5I47A 4OQMA 2UZ4A 2DUNA 1SVUA 2YHAA 4Q12A 1DTEA 1C3XA 1C1XB 3CPSA 4JQZA 4Y6QA 5HIAA 3EGOA 2QUIA 4OJMX 3UMFA 4M8KA 4RDCA 2CE2X 1A7JA 4CM9A 4YPOA 4OGKA 2FW9A 3HB7A 3NLLA 2B30A 2PNJA 1SU4A 2Z2YA 1HG0A 4UM9B 1JMKC 2FETA 3KNZA 5BWOA 1WMDA 4E22A 4FZJA 4E3WA 2NP7A 1VBKA 3QEAZ 3BT7A 1DKMA 3LLSA 4LOAA 4WZBB 4TWIA 3BCRA 5E1OA 5THQA 3IMFA 3CJTA 2X9NA 4HLCA 4LXTA 3TW0A 4TLLB 3RVJA 4R01A 4R69A 3W5JA 1TJ3A 3NDBB 1Z0DA 2C99A 4RWZA 4TS4A 3P1JA 4LE1A 2JA2A 3NV9A 1MPXA 4OSOA 4J1NA 4CLOB 5HILA 4HAIA 3KCNA 5HCIA 1C1DA 3R3UA 4I1UA 3G82C 3MG9A 2Z58A 3I58A 2W4IA 4JASB 2GN8A 4TLDA 3CZQA 1YA6A 1RABA 2WG1A 3IJPA 2AF3C 5EFZA 2EP8A 4DN6A 2Q3HA 3I3OA 3TEMA 3HZOA 3C8MA 4F9FA 2IYPA 1SKAA 4F4DA 3CZ4A 3M4XA 5DASA 4DIKA 4WZAB 1W4AA 1A27A 1E3SA 3IR5A 5HQ3A 8MHTA 1F6WA 3U40A 2X2FA 3AY6A 4IINA 4JWKA 4R1QA 4FFVA 4TSFD 3WWCA 1ZQ1A 4BWYA 4CDNA 3RHFA 3EC7A 5LZ2A 4JX9A 1IN7A 1AE1A 1T0PA 2W98A 3EWSA 3ZDRA 2YZGA 4MP3A 2VH1A 2PKRA 2AB0A 3HVHA 3CIFA 2UZ3A 1UDCA 2B1IA 3OZVA 2VDOB 4PTLA 3DZ8A 2R47A 2JLSA 4LVUA 1FIUA 3G02A 1JVBA 2XQKA 3WKCA 5A62A 3D8NA 3DFFA 2IBTA 3RUFA 1WVMA 3C7AA 2X7HA 3L0CA 2ZBUA 3GJSA 3HDYA 4MR9B 4YMVA 3FZEA 3NHRA 4WY5A 2VPXA 3KVNA 2ZREA 4C2UA 2IYLD 2BI8A 1NDUA 1P0IA 3DO8A 1S2LA 1AZLA 2ZAMA 4MDYA 3DEKA 1FMLA 3EVAA 3ZK9A 1O54A 4X65B 4HNAA 1EK1A 1L7EA 1Z7WA 2WIDA 5DCWA 5C8VA 3DE5X 1MZVA 2EZ8A 1YI8A 3PXCX 4QFBA 3N8DA 3R5KA 1UZUA 1LNZA 4KQWA 1VKOA 3OCJA 5K99A 5E3HA 3R8FA 1ESCA 4MYRA 1TM2A 1RQLA 1TO1E 3DOHA 5FP0A 3V9PA 2ST1A 3BSWA 3C6KA 3RUDA 1JMYA 1VLLA 5HWSA 2EX1A 3VR5A 1U8YA 4OHRA 3RJ9A 3M70A 3STYA 4U2GA 2IP1A 2ZYUX 4LNAA 4Q47A 4Y67A 1LTQA 4I4LA 1VMDA 3VZDA 3G59A 4MAFA 3GJ5A 1BX3A 2WNSA 4BNWA 6ABPA 4UUAA 1JB9A 4JB0A 1NUTA 3WGLA 2FUG1 1FL9A 1NXXA 1JR3D 3MS2A 1HDIA 3AQIA 3HACA 3Q88A 4HWTA 1OIXA 4W6ZA 3V8QA 1BXGA 4UARA 2FP4A 3GAZA 1X7DA 4FT4A 3U61B 4DDMA 2C4UA 3IJRA 1BDHA 4OHWA 1KZYC 5IFKA 4NBKA 1NSFA 1DOZA 5A4JA 1GT91 4FDTA 1CRWG 2NZJA 4MPJA 4YFYA 5HEKA 4US2R 3HL4A 5AVVA 5FA8A 2R6GA 1XWWA 3UZUA 4V3CA 5HKLA 2IH2A 4ENWA 1JQ5A 4HGQA 3WGNA 2UZ1B 4LYFA 2R8YA 1T34A 3L9XA 1P8JA 3FB4A 3R4VA 4X00A 5JNRA 2RGRA 2D6FA 5K09A 4CU2A 1JZTA 3H05A 3WFJA 3RRZA 2H7YA 4G6ZA 2H1WA 2PL5A 3GGOA 3H1AA 3NG1A 3ICQB 4XR9A 2QX4A 4JC5A 3WGZA 2BR4A 4LBVA 4M7OA 1W85B 3DVRX 1JJBA 3B78A 4EZIA 1J42A 1JFFB 1KTIA 2WJGA 3DEIA 1SBYA 1MX3A 2G9ZA 2I6TA 3OZFA 1EUQA 4UTNA 2H1CA 1BGXT 1N9GA 3A70A 1YJAA 2IEGA 2QD2A 4TL8A 4I9HA 3A0RB 1I0ZA 1V1JA 2Q0SA 3PQEA 3V34A 2DFKB 2VAPA 3VPDA 4D4MA 3KKNA 2D7DA 1YJCA 1AA6A 1WPQA 1PAUA 2GVZC 4DY4A 1CQPA 3IUSA 2PHZA 3RUIA 3DLTA 3ZJ5A 3E1KA 8ABPA 2XXAB 4D4KA 1XKLA 1EFTA 2Y76A 2DB3A 5ESXA 3TINA 2Q28A 3KQSA 5L53A 2XWQA 3W5CA 1G19A 1RE1A 1LB1B 1V9SA 4X63A 5HBGA 4EX6A 2Q5CA 4I1VA 2LCFA 3M49A 4IWYA 1N75A 1Q0PA 4LRQA 2Q50A 1J09A 3RSOA 5CCEA 3M6WA 5LQSA 5JMTA 2SNIE 2ZWVA 3T94A 3U4MA 2ZTLA 5ER6A 4Q4AB 4BFYA 2ZRNA 3FCSB 1CUBA 4E13A 4WKBA 5ALIA 3NOOA 3KJEA 2AMYA 4EI7A 2AX4A 3DZHA 2WF7A 3HY6A 4F6CA 1KPIA 4Y2PA 4B3HA 3RSCA 2AEMA 3QW4B 4NG4A 4KLRA 3V5NA 4LOIA 5EIBC 2YVLA 3TR6A 4YROA 5ALNA 4UM9D 1RQRA 2EFCB 3R3YA 1ZZEA 4BL5A 1FEZA 4DLXA 1XZAA 3Q3IA 1HFWA 3NHBA 3EVCA 5IVKA 1RLMA 4M89A 1NX6A 3WZ2A 4G9EA 3ABZA 4TXLA 4X1KA 5H70A 4PLVA 5BWMA 2ZRKA 4ZOLF 1KKMA 4W7SA 4BO3A 5JAOA 3M33A 4TV8A 5M7EA 3THYA 1HFEL 1WULS 1XMSA 3D1JA 4XM0A 3WJ2A 5ICGA 1VYVA 1AHPA 2FPIB 1RKQA 2BKVA 1BX1A 1VYTA 3EMVA 2H2HA 5LWHA 3I28A 4HXEB 2PSHA 4OXYA 3THRA 2XVZA 2P6RA 4UNRA 3BH0A 1NY6A 3GGPA 3V8NA 4OX9B 4Q7KA 3UXMA 4ZAGA 3KSRA 3LU1A 3AVVA 4HLUA 4RTOA 1OI3A 1M1NB 3MMXA 3QU5A 3EZ9A 2DWUA 3EG9B 3X1KA 1KC3A 3E3OA 1C80A 1PD0A 2EJUA 3KPVA 3QVXA 5K6AA 2XI4A 3JR3A 3IL2A 1G18A 4BBJA 3VHLB 2W2QA 4A92A 3GCGA 4FWIB 5IC4A 1FTQA 5CITA 5LYJB 4YI5A 1OBVA 1LZLA 4RHUA 5BQFA 3FPJA 5F1PA 1OOEA 1KDRA 2Q6LA 1S8FA 2YNMA 1SULA 1VIAA 1E32A 3CLSD 3KB2A 4TLCA 2QR3A 1P9NA 2QN1A 1Q3KA 2ADMA 2J6BA 4JLUA 5BNTA 1XAGA 2C98A 2ZWOA 2A9VA 1E94E 2HL6A 2OLKA 4KX5A 3BJIC 3ID6C 3GFTA 1T3HA 5SY6A 1NONA 3UG7A 2QV7A 2X2PA 3VR6D 2YVAA 4LJSA 4MUHA 1FNMA 3CG0A 3B3GA 3O4VA 3OM1A 3RIEA 5KTTA 5KYUB 1I2ZA 3ZWAA 2ZBDA 2OO3A 3DDOA 2J9FA 3NHFA 2H07A 4QODA 1N8KA 1QYWA 2AJLI 3N05A 1NI4A 1PQYA 3QU4A 5AJYA 4BVKA 1TFRA 4WTOA 5JZMA 4JH0A 1IVYA 3SI7A 2ZB2A 4X7PA 2B9VA 3RI3A 2VWHA 3ZCPA 2PXAA 5CXXA 2HF9A 1G8GA 5JARA 3BREA 2QQGA 4R2LA 3REQB 1NMSA 1TLFA 1UJ5A 1YVPA 5GMOA 5HGXA 1Z6AA 4XTCS 2FXVA 3I2FA 1UXGA 4B9EA 3U4QB 1J56A 3WLSA 1PDWA 2AJCA 5JLJA 3FWNA 4TN5A 4ZT2A 1A9YA 3WADA 4EYOA 1T9GS 5GZ3A 4C4AA 5KWSA 1HT1E 3AUFA 1C81A 5NLLA 1UC4B 3UMCA 3NM5A 1GPH1 2K87A 3DDNA 2PX6A 3JTEA 3PHBE 4JLMA 3UJBA 4F8YA 3NR2A 4KX3A 2GR9A 2H1RA 3LTEA 1TJ4A 3QP9A 2I2WA 3LPNA 3MWDA 4W1SA 4X6YA 2IV3A 4YJGB 5B64A 3PTLA 1VL0A 1ZESA 2QAIA 3AB7A 3G2PA 3PUIA 1U6IA 4ILKA 3CZMA 1R4MB 1O0BA 1N78A 3UT6A 2NGRA 2IP2A 1FFBA 4Q7EA 4QSHA 2CNKA 2NUBA 4EHAA 4RIIA 2FDXA 3LVRE 2HIMA 2D2XA 1X0XA 4KQ6A 4N48A 4L27A 4EJSA 2ZZMA 1F12A 3F5QA 1ZUNA 4FHDA 1TJ5A 1ZDMA 4YO8A 1QFJA 5LYJF 4DOMA 1PZMA 4EPTA 1VKRA 1WTAA 1XTPA 4RHXA 4HPJB 5LXTA 2GVNA 3PFKA 2HHAA 1KDTA 3DKVA 5HE9A 3ZDQA 4LJAA 2PMDA 2TS1A 1XN1A 3QE3A 4O2AA 5CLFA 3ESRA 2HK8A 4F7DA 1ZL0A 3BA6A 5SY4A 5K8CA 1WP9A 3IE0A 3VVCA 2YWHA 4BKQA 4WJKB 3KJXA 1O58A 2WHRA 1SPXA 2F1RA 3L8HA 4M0DA 3TTUA 1U5AA 3CX6A 5TMBA 4L9WA 1IY1A 1NBME 1XZFA 2QIOA 3UCEA 1JSLA 4GI3A 2FPKA 5IH3A 2FEAA 1QDLB 4A8JA 4JI8B 5AKKA 2X6TA 3KPYA 1BW9A 1XI2A 2Y1EA 4IZHA 3QWBA 3WGIA 4WUTA 4KACA 2WKQA 2CVFA 4RFLA 3U13A 4ZVLA 4UKDA 3OQIA 2QM3A 1Q21A 3LNCA 2WSSA 2A9KA 3GLVA 1FX0A 2J3KA 3PV0A 3WJAA 2X1HA 4DAEA 5A1TA 1I2CA 1L7RA 2F3TA 1KBOA 1CS0B 1LQUA 3A6HA 1UQTA 2DUJA 2ODWA 2B1RA 2GZ3A 2FQWA 3DE3X 1T2AA 2PH1A 1TAGA 1MHPA 3MRTA 4ENRA 5ALVA 4QYWA 1IJFA 4YT4A 1YMVA 4FYXA 4LHXA 2C9OA 3DHYA 3H1PA 5FADA 1O87A 2BCJQ 2XMBA 1DADA 4G1EB 2C61A 3R20A 2OP1A 3VM6A 1XTKA 1X7ZA 1YI1A 2E55A 3WLRA 4DWVA 3WRVA 1RWBA 1VA4A 1AXGA 3D54D 3WTCA 1QHFA 1SKQA 3OZRA 2OK7A 4BAUA 1MT3A 1H2BA 3KUCA 1JQ3A 3SZMA 1C0EA 1IEVA 2X2OA 5JAQA 3ROQA 3RLFA 4M88A 1LCIA 2B37A 2CWDA 4GHWA 5LOVB 3LC2O 2GUGA 5AJHA 3O75A 2LDBA 1RZRA 4LHVA 3MBKA 4BLRA 1YBAA 2LR0A 2RK3A 1YQ9A 3AJ9A 3UKOA 3QHAA 3GVCA 1VL6A 3E7XA 3BH7A 3HY3A 4NZOA 4EKEA 3RNOA 3DNFA 3P9XA 5ALGA 4Z51A 5I7AA 4TWZA 3CW2A 3NM4A 1TF7A 3X1DA 1T9GR 4RK1A 3O1HB 1PR0A 4GEGA 2XZOA 3DULA 4DLLA 1K7YA 3WV5A 3KT0A 1VSBA 1DHRA 2HCTA 1LEHA 2BE7A 2VOEA 3FF1A 3KAPA 4HTFB 4REMA 3TIVA 1THTA 1AB6A 3BWBA 3WJ1A 4Q5IA 1L8XA 1H5UA 1ZN2A 2YIJA 4YCAA 3T0FA 2COEA 3EA5A 5D87A 1Y6FA 2IS1A 1SHKA 2JH3A 3AVYA 5B5SA 1XQYA 4MGIR 4EO7A 3H13A 4Q19A 3DBHB 1Q83A 2WBLC 1M7HA 2RAPA 2PGXA 3QEMB 1G6Q1 3PXGA 1E7SA 5K0JA 3I1FA 2PMWB 3LA8A 2RC6A 3VR3A 1NNUA 1X9HA 2X42A 3L0PA 1AQLA 1I13A 1LLQA 4PICA 1JHVA 2D0PB 3HLTA 4EELA 2XF8A 3GFVA 3H9GA 1MNQA 2XLCA 4ENPA 2VG8A 1R88A 4MYUA 3MC1A 4IS3A 4CDMA 5AUQA 3PGMA 1P5RA 4B73A 1P5ZB 1Y3AA 2GA9A 2XVYA 2G06A 4NFLA 2A9FA 4JCCA 4MZXA 2WU0A 2KJQA 4A6EA 3T8YA 2FWAA 4LZLA 1I4OA 4FR0A 1ADJA 4J0CA 5JFOA 4NCXA 4PC6A 4YJ2B 3VH2A 1A8SA 3IGFA 4J90A 4W9MC 3A4NA 3PIDA 2QUAA 2O9JA 2A86A 3B1YA 3IEPA 5EMNA 2D1RA 2PSFA 1RACA 4J2HA 5CB4F 2Q4EA 3GUHA 5KTNA 4WN9A 1E89A 4CF6A 1CIVA 1VKZA 1DV2A 3QG1A 4YFVA 5J5CA 3RFXA 3C45A 4MKGA 3EIWA 5LOVF 3BA1A 1Z0FA 2MJLA 1FMTA 4KV9A 3VYUB 1X9GA 1ZK1A 2H1IA 4HNSA 3RC1A 1Q92A 4K6KA