2KJQA

Solution structure of protein nmb1076 from neisseria meningitidis. northeast structural genomics consortium target mr101b.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
149
structure length
149
Chain Sequence
MGHHHHHHSHMDYPSFDKFLGTENAELVYVLRHKHGQFIYVWGEEGAGKSHLLQAWVAQALEAGKNAAYIDAASMPLTDAAFEAEYLAVDQVEKLGNEEQALLFSIFNRFRNSGKGFLLLGSEYTPQQLVIREDLRTRMAYCLVYEVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaA-related protein
publication title Solution Structure Of Protein NMB1076 From Neisseria meningitidis. Northeast Structural Genomics Consortium Target MR101B.
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Replication
total genus 31
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2009-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2kjqA01
2NOAA 3O8RA 1J7KA 4ZPXA 5CYPA 5JWRA 5JJLA 3HR8A 3UMFA 3U3MA 1KYIA 1W4AA 2VRWA 4DSTA 4JVSB 1KTVA 3TQFA 4OYHA 1Z6AA 2CK3A 3CF6R 3THXA 1BIFA 4M22A 1A5TA 3R8CA 4CVNA 2QT1A 5IDVA 1TF7A 2QMOA 4IDOA 4C0HA 1ZINA 3B1YA 4EQ6A 1A82A 1QHGA 1Z29A 3W5IA 2HDNB 3I72A 2WWXA 4HLDA 2X2FA 4U7DA 2CE7A 2F1JA 3AVOA 5J4HA 1QHIA 1XTIA 3BH7A 3AP3A 1A4RA 2FMXA 3FFBA 3LO5A 4NCJA 5CIQA 3T34A 2XITA 4DDWA 4D0LB 2ZS7A 4B3BA 1GUAA 2J7KA 3VHXA 1YHNA 1W47A 1NBME 2V7QD 1NRJB 4HYYA 3UIEA 5J4VA 4PX9A 2MSDB 2HF8A 3ZZ0A 3RAPR 2IX3A 4XWKA 1GVNB 1W36C 3SEAA 1W0JD 4YONB 3BB3A 3QXJA 4MKFA 4NYJR 4BLRA 1OHHD 2QTVB 4Q21A 5FI0B 5BWMA 2XAUA 4FI3C 2KSQA 3BB4A 4FMCF 4AURA 2H16A 5HR5A 2YOGA 3WRXC 4D6PA 3NC1C 4W5HA 1SKQA 1LS1A 1XFAA 1IXRC 3OESA 4V02A 1P72A 1TQDA 1UKEA 2W00A 1IBRA 1G291 5HKKD 3HP1A 4LJ5A 2OBNA 3AF2A 3I8XA 4JZKA 1L7VC 5TARA 3QJYA 4O25A 4XVUA 3OFND 2G0NA 2ODBA 3SNHA 5TDHA 4C0BA 2FFAA 3F3YA 3GMTA 4FN5A 4LV6A 4DEXA 1E94E 1G3IA 3QSYA 3U4QB 4PO8A 2AD5A 3K0AA 1II8A 3ND8A 4KLNA 5FBWB 3G82C 5G40A 3QKRA 2HLDA 1ANKA 2IS6A 2YWEA 121PA 1EESA 4PHFA 4UNNA 2FSFA 2QAGB 2FEOA 5DO9A 3V4RA 1ZMXA 3HR7A 1U8ZA 5JWHA 3NKVA 2ZJBA 3H4MA 3PUYA 1E2DA 4B34A 3QY0A 2XTNA 1YRBA 4FINA 3ZQ6A 3GJ4A 3PUWA 2PZGA 1FTSA 4EPYA 1ZNWA 3NVAA 3KQKA 1HV8A 3OEEA 1Z0IA 4HDOB 1RJ9A 4OQNA 2P5TB 4AK9A 1GIAA 1GRRA 2ZI9A 3SQXA 4V0KA 5DNYB 2ATVA 5GJWC 4A8JB 2QSZA 2ZJ5A 3NG1A 2GA8A 3B6EA 1O3YA 2QROA 4A82A 2WVJA 1JEDA 3ADCA 3HWSA 1GNRA 2RHDA 1ZM2A 3TR5A 3KB1A 3Q7QA 4NE2A 2WWYA 4A2WA 3MWJA 2F9MA 4BLPA 4A36A 2GK6A 2O8DB 2R62A 3MWYW 1GP2A 3T35A 2QUZA 5BW8A 2PLRA 2IS1A 4MA4A 4C2UA 1XJ0A 1MO4A 3KQLA 4G3XA 2JLWA 4LYJA 1SULA 1I4TD 4HB3A 1W1WA 3OF5A 2CXXA 5AWFC 1B0UA 4C0QC 5JRZA 2BBSA 2NO7A 2VP5A 4P4UA 4E09A 2OFXA 4QXAA 4CEIB 2ZSEA 1IN5A 2J45A 3DO6A 2XSZA 3W8RA 1OH5A 1FTNA 3OIWA 4ASUA 1Z47A 2F6RA 5LD2C 3JZAA 4JSTA 4MQBA 4RSGA 2ZI7A 1TNDA 4BE7B 1PUIA 3HPRA 1RRCA 4W5WA 4G5OA 2ZSBA 3Q7PA 3AVTA 2IWRA 5ELXA 1Q1EA 2RKOA 2CLDX 4PSVA 2FNAA 2VLIA 1CEEA 1OW3B 3EWAA 5EXPA 3PVSA 1CS4C 3CF0A 2OV2A 1KDOA 1KI6A 3P32A 4RY2A 4D4KA 1KMHB 1G8PA 3L2OB 1L2TA 3B1XA 2A5GA 4EDHA 5G3ZA 3CRMA 3A4NA 2XTMA 3TUJC 2Z4SA 5EE3A 3B82A 4TT3A 2OLJA 4XVRA 4PC6A 1KDPA 4JVNA 2NGRA 4QRHA 4X8LA 1EXMA 1H8HD 4DIDA 4ZDKA 5KSOA 3M0EA 1KO8A 3VR5A 3ZIAD 2GXUA 4JLVA 1VG1A 2C99A 1VHTA 4KFSA 2IUSA 4C0SA 3K09A 3ZD6A 1LNZA 1HTWA 1NKTA 2J59A 2ORWA 5DI9A 1DAFA 1XEXB 5EP2A 1RRGA 5SZKB 4BGDA 3B85A 1NVXQ 1Z2CA 4ZCIA 4B73A 2PX0A 1JAHA 3RS2A 1X3SA 4Q4HA 3QF7A 4Q5IA 5AUPB 521PA 2FSGA 4BFSA 2AK3A 3V4FA 1U99A 3L8ZA 2VPPA 1N6NA 2ODWA 4ITRC 2FPKA 1R8SA 3TH5A 2BEJA 4C7OB 1G5TA 4ZCMA 3I8SA 4HUQA 4YXWA 3T1VA 3B78A 3VU9B 2GAOA 2REXB 3E1SA 3H1TA 2NZJA 2FE4A 3AF0A 3REGA 1N2CE 1VCNA 1YZKA 2WOOA 5EZ5A 1IONA 5BN5A 3R20A 1VTKA 4QBFA 4U00A 5A0FA 4OK3A 3UPUA 1JXMA 3HPQA 4AYWA 3C4JA 3MSXA 1ZYUA 1LY1A 4KODA 5B64A 1ZM7A 2F3RA 3K0FB 1OXVA 1SKYB 4MRPA 1G4UR 2XNDA 3CPJB 5E95A 3UG6A 1OXTA 1X1SA 5B30A 2ZAMA 3K0EA 2NZ8A 1P7CA 4AYXA 3P4XA 1SHZA 1YU9A 2FWRA 3NH6A 1QBKC 3QBTA 3CWQA 5KDDA 3TKLA 5CDFA 4Z1MD 4PAOA 3SFZA 2GESA 1NIPA 2D2EA 4EPRA 5TB5A 3AH8A 4R7ZA 1AM4D 3CRVA 3PEYA 3NC0C 4I1UA 4LPKA 4M1YA 2GJ9A 5AUQA 2O8FB 4YMTA 4QNMA 2KJQA 1UEJA 2Z43A 3U3RA 4JLMA 2GDJA 2BC9A 2W0MA 3ETLA 2OXRA 2WIAA 1KSJA 3OHMA 3S1AA 1TU3A 1NLZA 3PUXA 2ZXUA 3LNCA 2A5YB 1WQ1R 2WJHA 3A58B 3AF1A 2H5EA 4GNKA 1WMSA 2PL3A 1Z0FA 3DHWC 1TPZA 2GCOB 4BZXA 1QZXA 1E9FA 2F1RA 3RWOA 2WIBA 2Z4RA 3IO5A 1T6NA 3W3AA 1SQ5A 4AI6A 4DRZA 3GLFA 3NHBA 4MGZR 2CJWA 1SVLA 1PLLA 2YJTD 4YC7A 4DJTA 3KUCA 4Q9KA 4LHZA 1OJLA 1E0AA 2EQBA 1GDDA 2R6GA 1QF9A 5TMPA 4LYHA 3D7MA 1GITA 4AG5A 1TEVA 5F98A 2AN9A 1E79D 2Z83A 1P9NA 1MT0A 3A37A 2J0QA 2AWNA 2G1JA 1OYWA 4DCNA 4WIAA 3PITA 3LXXA 1II0A 2OM2A 5FI1B 3IIJA 2ZI5A 4DB2A 1G3QA 1T0HB 4NCNA 1CJMA 3AVXA 3RS7A 2PMKA 2QQEA 4LY6A 1Q22A 4P4TA 3EC2A 1E9AA 2IYQA 2FH5B 2G6BA 1RKBA 1T8UA 1JPJA 1G5PA 3T61A 1Z6XA 3MWLA 1WCV1 4RD3A 4NYIR 4BWYA 2YWHA 1XX6A 2DFNA 3AP2A 5FOVA 2VHUA 4LJYA 2QY9A 4ZV4A 1Z06A 2GF9A 3K9HA 1Z28A 3AM1A 2C77A 4D2IA 2YINC 4PAQA 2J3EA 1ONBA 2ZE8A 4NHOA 2REOA 1N0VC 2H17A 2IYZA 2QT0A 5G3YA 3U7GA 4KITB 1XD2B 2X8AA 3VX4A 1W48A 4NCIA 4AY2A 1CF4A 4KAXA 3PEWA 1HEIA 2FJUA 1S1CA 2W2TA 1Z3IX 4LHWA 2R6AA 4MRSA 1R5NA 2GVZC 2FSIA 2RCNA 2O8EA 2OCAA 3B13B 2ZRGA 3KFXA 3R7WB 5CLQA 3SBEA 5HE8A 1IAQA 3HYRA 3AVQA 5AUOB 3AF4A 1P9WA 2EYQA 1P3JA 4R9UC 1H8EA 1XXHA 4M9ZA 2BV3A 4P0TA 1R10A 3B1ZA 2AK2A 2ERYA 4J0QA 1UKZA 2GF0A 4IHQA 2W83A 2ZE7A 3DM9B 3QF4A 4EJSC 1J2JA 3BRWD 3CH5A 4BECA 2J9RA 5JECA 3LW8A 4TZ0A 4IFEA 4D81A 1E2JA 1US8A 1PLKA 1QVAA 1FPMA 1TQ2A 5FPYA 3SDZA 4FWIB 3ZDQA 3QKSB 2E87A 3IGFA 3F5FA 4JL5A 2BM0A 3GLGB 1KAOA 1KHTA 1ZCBA 4BLQA 5CDFE 2XGJA 2ZRNA 4RZ3A 1CR4A 3U44B 3P1JA 1UEIA 1DPFA 3LBIA 3CM0A 4WW0A 5FL3A 4BPBA 3LBHA 1AS2A 2AFIE 2B92A 2GHIA 3ONWA 4JIMA 4UNRA 1S0UA 4OHXA 2QORA 5EXXA 1ZRHA 3KKOA 5DIFA 1AZTA 1U9IA 2BCJQ 2MMCA 1F60A 3E70C 4Q1EA 5EE5B 3VR6A 3WYFA 4UJ5A 4C3ZA 3IEVA 1VYTA 1YZLA 2TMKA 2BJVA 1II9A 4QL3A 2XXAB 1FL9A 4CRWB 4FMDF 2CMKA 3K9LA 2IYYA 4I1VA 1E4YA 3EG5A 2VL7A 3DPUA 1XPRA 2VHCA 1XPOA 2ZR9A 1RYHA 2C78A 3U7FB 2V3CC 1CLUA 3BJIC 1NLFA 1S9HA 4TWZA 2VHQA 3PV0A 1ZU4A 3GLFE 3WNDA 1UBGA 5EE1A 4KHZA 4NYMR 3X1YA 1R0YA 1XD9A 3GLHA 3IQWA 4NYJQ 2QTFA 3VX3A 4B75A 2JDIA 3HJNA 4JLNA 2KBEA 3RNLA 5D3MB 4Q9LA 4KSBA 2X1VA 3K0SA 2Q9CA 2WWFA 3OAAA 4YDHB 2XOKA 1JR6A 1GRNA 4K81B 4PHGA 5JMTA 1FX0A 1Z22A 2G0TA 1EK0A 3EWSA 4F93B 5FTJA 1V5WA 1ZJ6A 5TV2A 1CP2A 4PC3A 1TU4A 2Q3MA 3KL4A 4DLVA 1T5LA 2C04A 2WICA 2A5FA 2V54A 5FOTA 4C0AC 2OAP1 3ECCA 1UADA 3CLVA 4IKEA 3THOA 2W6ID 4Q9HA 1E32A 1N6IA 1QHYA 5G53C 3BIFA 1OH6A 1HYQA 1KI9A 2OAQ1 4FXPA 1K6MA 1N5LA 4HSEA 1MO3A 1KO4A 5DSZA 5JSZA 1JNYA 3A4MA 3PQCA 4KLZA 4BEJA 3A1SA 4L5BA 1OF1A 2QGZA 2QG6A 1E2LA 3G0HA 1PZNA 2WSMA 2P3SA 2IL1A 3KFVA 4A0RA 4BZPA 3ASZA 3CBQA 3MAAC 4U02A 1G41A 3QPVA 2HUPA 1FOEB 4NL4H 5KSYA 3U6KA 2BDTA 5DN6D 4DUGA 4GP7A 2GXQA 2ANCA 3PR1A 4KFTA 4RZUA 3LRPA 1XD8A 2V6IA 2ODNA 4JLJA 3W6PA 3DVLA 1S8FA 3BS4A 1MR3F 4LZZA 3QKUA 1I2DA 1XXHE 2JLQA 2ZRAA 4R2HA 5FR2A 3X1XA 3RYTC 3P27A 4RVCA 2F1IA 3K0CA 2QN6A 3WP1B 4DSUA 2R9VA 2CE2X 1KSHA 3ZS8A 2OSBA 4N1AA 1IN8A 2ZJAA 2IEYA 1COWA 2ECKA 2UVQA 4PZZA 3MUFA 3QEJA 2OUKA 4TLCA 5F9HA 1J8YF 4IOLA 2JJ8A 1HH4A 1ELOA 2QRNA 4IXMA 1OKKD 3EARA 2MMGA 3TAUA 3Q72A 3V00A 1J90A 1F2UB 4A15A 4Q4AB 1KZ7B 1P62B 1ZIPA 4TMXA 2MSEB 3O8BA 4G5RA 4QFMA 5KSPA 3SS8A 4DCUA 2ZU0C 3QPWA 1U81A 3VR3A 4EFMA 1XCMA 3QVUA 2UZ3A 4HAZA 5FTKA 1P9RA 2RB4A 4R2IA 1KK3A 3FE2A 1OPXA 1QG4A 3QG5A 3RANA 3I92A 2G83A 3IPXA 4IDPA 4IVRA 1COWD 2JIZD 3GQBA 2V9PA 4URWR 3L0OA 2J0UB 1HE1C 4ZI2A 3VAAA 1N5KA 2OESA 2ZS9A 1AS0A 2YC4C 2YHSA 721PA 2ZAOA 1KY2A 3THYB 3QEOA 3BFXA 4CZ2A 3WHKA 1DG3A 4Z8XA 4ABYA 5DH9A 2JLXA 2AFHE 2JJ1D 3FGNA 4IRUB 1L4YA 5ANRB 1NBMD 4G0NA 1OXXK 2B7BA 1IQPA 4AIIA 4U5XA 2CBZA 2CNWA 1F6BA 3FPAA 2ANBA 3IBYA 3GLHE 4LHVA 4PFSA 1W49A 2BIFA 2VQSA 2IYWA 5FPHA 3UKDA 3AB3A 3DZ8A 2D74A 2JGNA 4OKSA 1MKYA 1N6HA 4LV5B 1PJRA 4TTQA 1FW6A 1HUQA 1T3HA 3QE0A 3KB2A 2DBYA 1F2TA 2ZRJA 2KI5A 4QHTA 5H8WA 1XPUA 1CIPA 2PZFA 5HCIA 5GVRA 3FMPB 5J5CA 1P2SA 5FOWA 1DOAA 1TL7C 1U0LA 2H1LA 3AKEA 4JBWA 4JJKA 1AIPA 4M1SA 3CIOA 3C15C 3PEVA 3FOZA 4RD0A 4L4UA 1BMFD 1LTQA 1ZM9A 3DOEA 2G77B 4MYHA 4MRRA 1U8YA 2CCGA 2WJVA 2BBTA 1XZPA 4XWAA 3MMPA 5SZIA 4MGIR 1U90A 3Q9LA 4US0R 1J99A 2F43B 3UG7A 1T91A 2HJVA 3W6NA 2WJIA 5KNCA 2FEMA 2FGKA 4D4LA 3TNFA 5GJCA 3VKHA 2QP4A 4GOJA 1S3SA 3WY9A 2OBMA 4ZKDA 3GJ6A 2FN4A 1ZW6A 4TYQA 1XMSA 2KBFA 3ADKA 1NMXA 3A36A 1P5ZB 4N3NA 2W2XA 3GJXC 2G1KA 3CZQA 4XJXA 4RCZA 1DAEA 4QC2A 3M4YA 4RD4A 4WZAE 1KSGA 2ZE5A 4FD2A 3TR0A 3B8HA 4TQ9A 3IUYA 1VECA 4QBHA 1OH8A 1E9DA 1XP8A 2R65A 4M9QA 3K70D 3THWB 3K70B 4B3CA 2F1HA 1L4UA 1DS6A 1RZ3A 3TQCA 2V55B 2QM7A 2QPOA 4MKHA 4N0EA 2H8KA 3IQXA 4M9SA 1Q21A 2C96A 4LX0A 3MCAA 1W0KD 1G4AE 2GWHA 1OFHA 4GMDA 4QJ4A 3RS4A 5HCNA 4X8OA 3W9YA 4Z51A 3X1DA 1UAAA 5EE9A 1W44A 3FKSA 3D31A 1CR2A 3WRYC 4DKXA 3OE7A 4IDQA 1ZD9A 2ZJ8A 3RRYA 3CH4B 4LBYA 2N46A 2O5VA 4DLSA 3GFTA 1QDEA 3VQTA 3DDCA 3QENA 3W3ZB 2GJKA 4ARZB 4XWOA 2EU8A 1DAGA 3A1TA 2HJGA 3F8TA 2CK3D 1XEWY 4DDTA 2IYUA 1OFTA 1YE8A 3B2EA 2WJYA 4TTPA 3THXB 4E22A 2WWIA 5HZHA 1JAIA 1XMVA 1P73A 1YKSA 1IY1A 1OB2A 2ASEA 4EQ6B 4O0MA 2ZSFA 5FUVA 2B8WA 1ZD1A 3GFPA 4CEJA 3KDSE 5JS7A 2GTPA 4HAYA 4PR0A 1FNMA 3RSOA 1IN7A 4EKDA 2NTYC 1ZNXA 4NKRA 4LBZA 4NP6A 1NJFA 2D7DA 3LD9A 2IYRA 4FWTA 4LHYA 1Q20A 4FCTA 5KPJA 2FZ4A 3ICQB 3WYGA 2GCNA 4BFZA 1Q1ZA 4PAMA 4DLWA 3BGWA 2BBOA 2YYZA 2QRZA 4TSFA 5FL7A 1DVRA 1ETUA 1KMQA 2N1BA 1BOFA 5EUMA 4JLOA 4A4DA 1OIXA 4IDNA 1G3MA 2JAQA 1S3GA 1YQTA 5FBRB 4BLSA 4KXFB 4Q48A 1CR0A 3K8YA 4B47A 1IHUA 1SVWA 2J41A 4V0ME 1NNEA 1AKEA 4GRAA 4ESHA 3N70A 4FMCB 1DEKA 2QGNA 2XZPA 4D0GA 3VHLB 3MJRA 1W36D 1EG7A 4B2LA 2CCJA 1W36B 3DZDA 4YMVA 1JR3A 4NYIQ 2B6HA 5J4YA 5CM9C 1NY5A 1DAKA 2BCGY 1UBFA 1RVDA 1A7JA 1BYUA 1KNQA 4LBVA 3EIEA 3NXSA 2YVUA 1JB1A 2GBLC 4CYMA 2D3WA 2PT5A 3I61A 2ZQ5A 4KI0A 4ZIRA 2W6JA 2GBLA 4XTRA 4MYTA 3IBGA 5G41A 3T5DA 4DC9A 2QMUA 5JBQA 2IBMA 1TAGA 2FZLA 4UXJA 4I4LA 4ZDJA 3AVYA 2OEPA 3F0TA 3AQ4A 1VG0B 2HLDD 1II8B 4A8JA 2CEAA 3B1WA 3QKRB 1IY0A 2EFGA 4M53A 2OFOA 5L3VA 1OH7A 1WB9A 5LDDC 2GJAA 3B5JA 2EW1A 2RAPA 4M21A 1QG2A 4URVR 2O8DA 3LVQE 2IA5A 4DT1A 4ESVA 1Q3TA 5F2EA 2BMFA 3HU3A 4WXRA 1G21E 3GJ3A 2QZ4A 5UKDA 2HXYA 2JLSA 4O2RA 4UNQA 3UANA 4D82A 4DCVA 5A5GA 4O3MA 4P3YA 4D26A 4JJZA 4MDFA 2AD1A 5JEDA 3CKLA 2Q9AA 3OEED 3NBYC 4NBSA 5FH9A 4CEIA 4RD2A 4WZ6A 2D2FA 4P32A 1RJ9B 3BD9A 3CR7A 3GEHA 1QVRA 2JLYA 3DEFA 2Z0MA 4KFRA 3B9QA 5BYKA 4TLEA 3WXMA 5HPYB 4EPWA 4HAXA 2IYTA 3NWJA 3CX8A 1FUKA 1U98A 5BXQC 1GNQA 4URXR 4R71A 1D6JA 3JZMA 1HE8B 2JLRA 4C0LA 4PXAA 5C1BA 4XD7A 2K5UA 2PCJA 3LY5A 4DDUA 2BOVA 4IJMA 4US2R 1NVVR 2W0SA 3LH5A 2VP2A 4F38A 1LB1B 4GMXA 1GNPA 3EAQA 3KX2A 4XTCS 3RS3A 1SXJC 2VIIA 4QGFA 4PZYA 1KMHA 1XEWX 2GJSA 4RZXA 4DXAA 2XSZD 3VKGA 1SXJA 4TQAA 1NLYA 1C1YA 1GG2A 4BFWA 2QBYB 4ASUD 1E2GA 1WBBA 5KNBA 2IT1A 2C9YA 4UNPA 2GZHA 1KSFX 4LJ9A 1GL6A 1L8QA 4NYMQ 3TVTA 3BXZA 4TLBA 4OJKA 2YNMA 1C9KA 3GEIA 4XD7D 2JJ2A 2FOLA 1AZSC 5LD2B 5FUXA 1E2EA 3WNCA 3K09C 1Q12A 3U60B 3QKTA 4C0JA 3TAHA 2IWHA 1TUIA 1YZTA 3LV8A 2Z6VA 4B2IA 1TUEA 1Z0JA 1XEFA 2XEXA 1EWRA 3ZH9B 2ZI3A 4IEIA 1KI6B 1JI0A 1KGDA 1MH1A 4L15A 5JRJA 3WBKA 4BFYA 5AJWA 4TYYA 1RYFA 4BRWA 1HURA 1E2FA 3RWMB 4TT3D 1R4AA 4TYPA 5GADl 2DPXA 3GLIB 4UKDA 5KNDA 1JR3E 3EASA 2GVDC 4AD8A 1E1RA 2WM9B 2XZLA 4IXNA 2LCFA 3VU9A 3R8FA 3HYTA 1I4LD 4IW3B 4MRVA 3I1FA 1N5IA 4OK5A 2VH5R 1YR9A 4Y0AA 2ZYVX 3EXAA 1HY3A 4NONA 4NU0A 4WOPA 3SBDA 3BH6A 4JL8A 4AKIA 1OB5A 2ZJOA 2C5LA 4Q4HB 1JBKA 4M9XA 4PSKA 1OE0A 3H84A 3K0FA 1IY2A 2WKPA 4JYCA 1U0JA 1WBDA 5DYGA 3QI2A 1NF3A 4OI4A 1QHHA 4EFNA 3GJ8A 3IPYA 4OQFA 4YXWD 4TN1A 2QP9X 3SR0A 4HUQB 3K9NA 4PO1A 2ZU6A 1JXOA 1P61B 2GRJA 2IS2A 3QXCA 1KO7A 1VYUA 1YZQA 4O2LA 3ZLJA 5DLQC 1VCOA 4Q66C 5IK2A 3NHAA 1KO1A 1A2BA 1S9DA 4OQLA 4TL7A 3FVQA 3M1IA 2PH1A 4JMPA 1E98A 2O8FA 1DAHA 4P4SA 1HQYE 3N2IA 3U61B 1AGPA 5FFMA 4TL9A 3MJHA 4HAWA 1SVMA 2XNDD 1W46A 2YC2C 4RKFA 4BQSA 4ACAA 2VHJA 3B7GA 4D0NA 3NBZC 1P6XA 4GFDA 1SGWA 3D8BA 2WSSA 3QIAA 221PA 4QNRA 4HAUA 3E2IA 3C16C 1GKYA 1CJVC 5AK0A 1YR8A 3AVVA 1NN0A 3TBKA 3CWZA 5SZJA 1RIFA 2NO6A 3FB4A 5BYJA 2WAXA 2ZRBA 3K1JA 2WMNB 5B2ZA 4ZKEA 5AJZA 4QOSA 1E0JA 1XBTA 3ZVLA 1EFUA 3GD7A 4PPQA 2QMEA 5J4KA 2ORVA 3SJZA 1XRJA 3EPHA 4GOKA 2HT6A 4KFUA 1SXJE 3DOFA 4QGGA 2J7PA 3DKVA 3I3SR 4JT2A 3PUZA 3S1AB 2WPDA 2D4HA 2I1QA 2DHRA 2A5JA 2WSSD 2EFHB 2BWJA 1U2RA 1N5JA 2IUUA 2IYSA 3H0KA 1E1QA 4B44A 5JJKA 4CDGA 3G5UA 3A1VA 2P67A 3GLFB 1MRNA 3GPLA 2CJWB 2GNOA 2YWFA 5CLLA 1PVOA 3J81k 1X8LA 2GZDA 4RFSB 2JATA 3DM5A 3C14C 4JLDA 4TTRA 2DR3A 1N6PA 2HT1A 1W4CA 2WMOB 8OHMA 5FTLA 4FCWA 1KJYA 1U94A 1XD2A 3AKDA 1G3RA 4QG7A 2O8BB 3KJGA 4I1OA 2AKYA 3EZFA 1UKYA 2ZM5A 1IXZA 2OCYC 2CVFA 3U5ZB 1E3MA 2QAJA 3AKYA 3CZPA 4RZ2A 1QHSA 4ILEA 3M6AA 4YLGA 3CW2A 3P26A 4KJZA 1P75A 3FKQA 1K8RA 5CYOA 3QBVA 4N0DA 3FYHA 4B48A 3EPLA 1SVIA 3VNUA 2OO7A 4OI0A 1IM2A 2FF7A 5DYIA 1SVSA 3CRRA 4TLAA 3TSWA 5JLJA 2C98A 2GKSA 1E2NA 1ZIOA 2ZRLA 1MABB 1W2GA 1KOFA 1NJGA 3UWOA 1F48A 4QM6A 1KAGA 1TMKA 1GZSA 5CIWA 4GPTA 4PPNA 4B35A 4DSOA 1QHNA 1X6VA 1XCGB 4DVGA 3GLGA 3C5HA 1N6RA 2C8VA 3LWNA 4P33A 2ATXA 3VFDA 2VSFA 1ZAKA 3KUDA 3KTAA 4K46A 5GVSA 1E6CA 2REBA 1E9RA 1D5CA 3MWKA 1AS3A 4PHTA 5H68A 3TRFA 1H8ED 1E69A 2BKEA 1DTSA 2IXEA 3K9GA 3ADBA 2JLUA 1XXHB 2IYVA 3REFA 1ZU5A 1SHKA 2IK8A 1LV7A 1U9IC 3BFVA 3OIVA 4RKEA 4A2PA 2ZJZA 1AKYA 4S2EA 1DE0A 3L0SA 2KWIA 4G5GA 4LJ6A 4EJSB 1TX4B 2ZRKA 3O8CA 4L16A 2GJ8A 1AQUA 4II7A 4IDHA 2RGNC 5BN3A 2O8CA 3Q5DA 3O47A 1FMLA 3IO3A 2RGNA 4JVLA 3ZZTA 1F3OA 5EQTA 3BC1A 3KJIA 3NEJA 4AKEA 4Q19A 5JCZA 3WHLA 2PX3A 2AWOA 2A78A 3W34A 3V9PA 3OZXA 1JQLB 4I99A 1Z0DA 4Q1AA 4V0NA 1D2MA 3QUSA 2NIPA 3AF3A 4LYFA 4BLTA 2CHQA 2GAAA 1A2KC 3QNUA 4KBGA 1ZUIA 3MRSA 3OIYA 3CNNA 1YRAA 5EJEA 2P65A 1DO2A 1Q1BA 4Q7JB 3X1ZA 4PQYA 2HCJB 3NDBB 2GILA 2FG5A 3ZYCA 4MKIA 2BJWA 1GRQA 3N2EA 4HZUA 1O87A 1ODFA 1J8MF 1M7GA 3ADDA 4DIEA 4MGYR 4TZ6A 4CEHA 2NG1A 3IEUA 4AG6A 1Q1QA 2WWGA 4Q1CA 2RGEA 5JCPA 1E96A 2WWWA 3GFOA 1OIWA 1VHLA 2JDID 3GLHB 1FNNA 2VSXA 2ZUDA 3Q3JB 2OZEA 4QJ5A 1DARA 5E7JA 4DLYA 2KB0A 2EYUA 3OAAD 1YZUA 3QOFA 2XOKD 1E2MA 3VTKA 1IOZA 3CRQA 2PCLA 4IOMA 4I1SA 1CULC 3U7HB 3BFKA 3BWDD 2H92A 2PJRA 4UNSA 3EIQA 1KK2A 1NN3A 3JVVA 5L8VA 2I4IA 2UZIR 1N25A 2QENA 4GSYA 4EPTA 3SQWA 4IFBA 1IJEA 5IT5A 2ZI4A 2OCPA 3MGCA 4A9AA 2DWQA 1YR7A 3CNOA 2WZQA 2HF9A 4EIWA 2QM8A 4JLBA 4KV9A 2LKCA 3RS0A 3RS5A 4QJ3A 3CPHA 4F4CA 3GJ5A 4XOIA 1UBCA 5J4LA 4W7SA 5KU1A 1LVGA 4DLZA 3K0CC 2IHYA 5DHAA 2CLSA 3Q85A 4HB2A 1IN6A 5L3QB 2ZANA 1G7CA 3RLFA 3UWKA 2PLFA 2QP3A 4ZI3A 3A6PC 1ZVQA 3SU8A 3PENA 1GWNA 5CJ2A 3TW8B 5EP4A 3U6BA 1P2VA 4H1VA 4QM7A 4A92A 1GFIA 1Y63A 3GLGE 1ZD8A 3LA6A 4LI0A 1E2IA 4DUGD 5BQ5A 1F2UA 1VDZA 3LW7A 3FTQA 1N6OA 1Z6GA 2VHTA 4JT4A 1M1YE 1YVDA 1G7RA 3TSOA 2JLZA 4RJLA 4GDFA 2RMKA 4OHZA 3T15A 2OG2A 1PLJA 1P4SA 3QXHA 3EZ2A 4WZBE 2IYLD 1HT2E 4OQXA 5J40A 3TJZA 3R9IA 4C9BA 5JZVA 1AQYA 5P21A 5L3SA 3TVDA 3U3KA 4E07A 4URUR 3CNLA 4PPFA 2RGBA 4LSGA 1T3SA 1WE2A 1T0JB 2AL7A 2ZRPA 5DI3A 2OE2A 3CR8A 1G5RA 2ZYTX 3BH0A 3TK1A 1NN5A 5IRCD 1NVVQ 4PC1A 3THYA 4OL0A 4HB0A 5K8UA 1KI2A 3CONA 1W7AA 2DY1A 1X8JA 4XIGS 1G6HA 2CHGA 3UK6A 3IDQA 1E2PA 2C2HA 2WKQA 4Q03A 1SVKA 4R98A 4TMVA 5AJXA 4KSCA 2JLVA 1PV4A 2VF7A 3BBPA 3FFAA 4QGAA 4B33A 1R2QA 1KJZA 5CK5A 3WP0A 2IXFA 1T4GA 4BFUA 4X8HA 1UBEA 3SJAA 3B60A 4V0OA 4V0MA 3RDPA 4BASA 5JHGB 1TTTA 4NZYA 5LBIA 1ZM3A 3ZVRA 3AUYA 2D06A 4OHYA 2DYKA 4B3FX 4PHHA 4UXIA 2WBLC 4M1WA 2WKRA 4MUBA 1T8TA 4JBXA 2FFQA 4D4MA 1JEEA 3RC8A 3GCGA 1UDXA 5CB8A 1YJ5A 4M1KA 2OCBA 2CNWD 1XB2A 3FWYA 3SZRA 4IVQA 3EW9A 2A9KA 3CO5A 3CRW1 3H2YA 1KK1A 1T5IA 1KI8A 1KI3A 2GEUA 1BS1A 1W5TA 2OBLA 4NH0A 1EFRA 4OHWA 4YDSA 1R6BX 1JALA 3MFYA 3UMSA 1JPNA 1TADA 4XH9B 1K5GA 1U8AA 5JEEA 1Z63A 3L0IB 4TQUS 4LGMA 3OIUA 2B21A 3GJ0A 3NIBA 1W4RA 1ZM4A 4LK2A 4B6EA 3VR4A 4Q4JB 3IHLA 5FOUA 3T1OA 1D9XA 3IIKA 1VIAA 3KKPA 3KQUA 5FOXA 2IUTA 1CXZA 2QI9C 1G19A 3EC1A 2DCUA 5GJVC 3PEUA 1OYYA 1UJ2A 3KQHA 1ZNZA 2AX4A 2OFWA 4PC7A 2J1LA 1M74A 4DLRA 4ON9A 2B8TA 2BKUA 3FMIA 1E2KA 3IIMA 4HZIA 1KI7A 1NIJA 3L82B 2VP9A 2VYFA 1ZC3A 4FIDA 1AK2A 3TUIC 1KJWA 1OXUA 1UKVY 2Q6TA 5FUYA 4A2QA 3P20A 2HYDA 3SYLA 1Q57A 1Q0UA 3TE6A 4Q1FA 2IHBA 1HA3A 4PQRA 3KXKA 4JYBA 2LWIA 4V03A 5FBLB 1ZUHA 1G7SA 1KK0A 4ARZA 2OHFA 2ZVQX 421PA 3B1VA 1XZQA 2VA8A 4LPSA 5H1YA 4C30A 1CTQA 4F7WA 2ZPTX 3QQ5A 1WP9A 3LQQA 1XTSA 2A7QA 3C7KA 4XSHA 2QSYA 3SOPA 821PA 3X1WA 4EPVA 3UATA 1R0WA 3RSLA 4Q18A 3MG9A 2V7QA 1W4BA 1JECA 4MYCA 1SVOA 2AXPA 4Q7MB 3VR2A 4JS0A 3RRZA 1VG8A 3PUVA 4A1FA 3LXRA 2N42A 1PUJA 4OJQA 3CX6A 4FW9A 4HATA 3FKSD 1UDWA 1G64A 2ZITA 3OE7D 2RH5A 1W0JA 1GKIA 2ERXA 4Q9JA 3SHWA 1G20E 5JI3E 4KO8A 3QXSA 2Q3HA 1OHHA 2Q9BA 4IEEA 4L9WA 5C18A 2YKGA 1XWIA 4BFXA 1GL7A 4G1UC 4Y0VA 3PIRA 4D25A 4D80A 3ZS9A 3QPUA 4TMTA 3FHTA 4YQFA 1CJKC 1P2TA 3ZVMA 2ZRMA 2QPTA 1H65A 1M8PA 1YR6A 2E9SA 3QG1A 5HKKA 1MOZA 3JVUA 2B7CA 3EPKA 1N0UA 3CUEF 1OSNA 4DLUA 3SE0A 4CEJB 2J5XA 3SJBA 2ZJ2A 4L8GA 2D7CA 4PZLA 2IEZA 2J0VA 3OFNA 2HEIA 1Z08A 4L9SA 3WNBA 3LBNA 3RVBA 5HTKA 3PFIA 1ZP6A 3ZGXA 4MKGA 3BORA 3U4QA 2BMDA 5FTNA 2QAGC 2QU8A 1LS6A 4M1MA 5JI2E 4TSFD 3BOSA 3CX7A 2OT3B 5FL7D 3GJ7A 2QAGA 3DKPA 1XMIA 5EXTA 1S2MA 5BN4A 2Z5FA 2DFTA 1R8QA 2PT7A 2WTUA 2ZRDA 2H57A 1CBUA 5CITA 4GOXA 1XTRA 2Y8EA 5KTYA 4LC0A 3WMGA 1FFHA 2J87A 4W9MC 4GZMA 4B74A 5FPSA 1ZUNB 1IJFA 1GSIA 1XTJA 3R9XA 1M7BA 4WXPA 1N3BA 4YMSA 4A8JC 3LVRE 2I3BA 4KVAA 4LOAA 1JR3D 2SHKA 3K0AB 3NDPA 2A2ZA 2JCSA 1FUUA 3PG5A 1X1RA 5DISB 5JS8A 4JLPA 4C0KA 2FDCA 4B3GA 4KYIB 3T5GA 3OEHA 5C4MA 2GXAA 3SHFA 4M0LA 4TL6A 3NH9A 1G1MA 1TQ6A 4KCGA 4M8NE 3ZVNA 4A6XA 4Q1BA 2NO0A 1SZPA 2W6JD 1EGAA 2VBCA 3C41J 4ZIRB 4F91B 1NMZA 2CCKA 4BZQA 2Q0HA 3Q8XB 2ZRHA 4M4SA 1N6KA 2PEYA 1YZNA 3C8UA 1JQJC 1BKDR 5F3WB 4JSYA 1TF5A 2HCBA 4PC2A 3A8TA 3K53A 4XSGA 1GKUB 1MO6A 5E7MA 2Q21A 3L0PA 3RHFA 3CB4A 4MITA 1F5NA 3OEHD 3LAWA 4K8OA 3KZ1E 1Z0KA 1XDBA 4PSAA 3VKWA 4DT1B 4OK6A 1G17A 3PJRA 4DDVA 1MO5A 3C5CA 2WJGA 1Z0AA 1ZC4A 3T12A 1VCMA 2VEDA 2ZEJA 4EPXA 4IOJA 5K8LA 1NVWQ 4G01B 5B57C 1ZBDA 3CPEA 2YV5A 2ZSAA 4POAA 1XU4A 2GZAA 1EWQA 2QBYA 4Q1DA 1WF3A 1JJVA 1E9SA 3I32A 2ZS8A 3VNVA 2D62A 3AUXA 5C46F 2JA1A 2PEZA 1Z2AA 3I4LA 2NPIA 4NMMA 1I2MA 2O52A 4ERNA 4YMUA 3I5YA 1P2UA 2HYIC 1E99A 1H8HA 2QQ0A 2IS4A 1Z83A 3AV0B 3ZIAA 2G9NA 2GEDA 5KO2A 4US1R 2V1XA 2EWVA 5LB4A 4D4JA 2RGCA 3CF2A 2FA9A 3LLUA 1G9XA 2QE7A 3FMOB 1XEXA 2OLKA 5EZ6B 3T1TA 5FPTA 1NVUQ 1WDTA 2PBRA 3E5HA 1SXJD 1G8HA 4F4JA 1SXJB 3EX7C 5TVKA 5M04A 3WMFA 4TYNA 2EVWX 1KDRA 3MLEA 1OFUX 4FCVA 4RD6A 2BHRA 5KDLA 1LF0A 3GLIA 3W5JA 1Z6TA 1G8FA 3ZZUA 4URZR 4C7OA 4ZDWA 2JJ2D 1V43A 1XCPA 2RGGA 1UFQA 4OHVA 4C4PA 1KY3A 3BK7A 3AKCA 2ZUBA 2FSHA 2QE7D 2FFHA 1WRBA 1G3UA 5EP3A 2DB3A 3I62A 3PCRB 1RFLA 2BBWA 4E5UA 2VP0A 3KXIA 1M2OB 4M2LA 2ZROA 2WJJA 3D3QA 2GEVA 4Q7KA 3FMFA 4TMWA 5AJYA 3RC3A 4RD1A 4EUNA 2XJ9A 5B58C 3SC3A 1G6OA 1KZGB 4GZLA 2PMDA 2RGDA 5FUWA 3AP1A 2ZJYA 3BERA 4GBMA 4UJ3A 1E1RD 1E2HA 4LUCA 2V1UA 4BEBA 5EXSA 1KDTA 2QMHA 1WXQA 4OQMA 2P0EA 2P6NA 2L0XA 1UPTA 2BMJA 3KQNA 1ESNA 4Z1MA 3EA0A 1C4OA 1E4VA 1RW4A 4LRWA 1S96A 2VTKA 3L8YA 3U3OA 2GXSA 3ZJYA 4CW7A 3GEEA 2QNRA 1D9ZA 1Q44A 3Q5EA 1OV4A 1QRAA 4B43A 3UXMA 4BLOA 2R8RA 4DZZA 3QXXA 1KKMA 1CRPA 2F55A 1HT1E 1QHHB 2ONJA 4P31A 2XX3A 1LF5A 5KHOC 3EPJA 1EFTA 1KIMA 3TW4A 3LFUA 2GCOA 3P4YA 4IOKA 1CJTC 4EAQA 1E0KA 4MUAA 2X2EA 4HAVA 3WBJA 1S4QA 5IK2D 4B3XA 4LJ4A 3W6OA 4MRNA 4ZCLA 1IN4A 3D6TB 1FQKA 5JWOA 4DCTA 2CLCX 3FHCB 4DSNA 2OXCA 2XJ4A 1CR1A 2P2LA 4JKIA 1NSFA 1FMJA 4P4SB 4EFLA 2J0SA 5LPNA 3ZQJA 4KYUA 3A1WA 621PA 1E79A 2DWOA 5FOSA 3BB1A 3KJEA 3LDAA 4Q4LA 4WVFA 2VP6A 2PJZA 1HQCA 4DHEA 4F4IA 2H18A 2F3TA 2XNSA 5AUNB 1VCIA 3AGPA 5C4GB 3LLMA 4GL2A 3KKNA 2ZREA 3TSZA 1NG9A 5KPDA 2ZR0A 4TL8A 3DMDA 3LX5A 2I1VB 1FP6A 4RFSA 1KNXA 1WA5A 1N0WA 2YOFA 2VP4A 5IHPA 4AYTA 2AR7A 2CHVA 1TQ4A 3LX8A 1E9BA 1KI4A 2ONKA 2C9CA 2ZIAA 4B6FA 4C2TA 4HB4A 4MH0R 3AVWA 2R6CA 1S1MA 2J7PD 1VPLA 2UKDA 2O8BA 4A0FA 2WPDD 1VYVA 1KI1A 4A0GA 4XVQA 4FMBB 5TY0A 1M6NA 3GLIE 1E1QD 2WAYA 3T06B 1Z5ZA 2CL6X 2MSCB 5FTMA 3N5CA 1R0XA 4LWZA 3IILA 1NL3A 1ESMA 5DE3A 1CJUC 5KDOA 2WOJA 3R7WA 4TMKA 5SZHB 3IHWA 3IKJA 3SI7A 4PQFA 1BO6A 4ACBA 2EFCB 1OT3A 4JL6A 4QHSA 3TGPA 1R5OA 1U0HC 2ZRFA 1MABA 1OXSC 5E7IA 5DHFA 1NY6A 2CVHA 5LB2A 1SKYE 3WYAA 4HI0E 1OFIA 1DELA 3QKSA 4AWXA 2ZETA 1GL9B 2O0JA 5C2JB 2O0KA 2RGAA 1R7RA 2QL6A 3KKQA 5EP1A 4DBLC 4B76A 3W90A 2O8EB 4PO9A 3U44A 1VKJA 2AXNA 1ZCAA 2IXGA 2XB4A 4KU4A 2BVNA 3T1QA 4B32A 2G3YA 3EZ9A 2J46A 2EFDB 1B23P 2FX3A 4PTLA 4QBGB 5CB6A 4MGKR 3WMEA 5KOYA 3X2SA 4HEJA 2OILA 4CT5A 2Q3FA 2IF2A 3AEZA 2ZRIA 4KBFA 3DL0A 3QF4B 2RGXA 4CIDA 4EJSA 3A4LA 1GM5A 1BH2A 1AGRA 1US8B 5AJVB 2XXAA 2XZOA 5FPKA 4DB4A 2ORIA 3FDIA 4YMWA 1KO5A 4NCHA 4V0LA 2QEQA 1XJQA 2P6RA 5A4JA 1YZGA 2XTZA 1FP7A 3TMKA 1M34E 3KTAB 4H1UA 3U7EB 4E03A 2ZRCA 2GK7A 2PZEA 4HLCA 3SYNA 4JBYA 1NN1A 2W58A 4JLKA 4M1TA 3SJCA 3EIHA 4IVPA 4W5JA 4CF7A 5EUQB 3BAFA 2A3RA 5IF9A 3HDTA 5D3MA 3EA5A 1E9EA 2V4ZA 4FMDB 4DLXA 1VG9B 2AHOA 2DWPA 3MD0A 5TXGA 2CDNA 2V8OA 4BRUA 2H7VA 1AA9A 2NPFA 1Q3HA 3AVUA 2O8CB 5K8TA 2R6DA 2E1RA 1E0SA 1EFHA 4UQOA 1T3LA 4QHYA 4ZDIA 4Q01A 2DFLA 5E4FA 1W5SA 4WAUA 1CKEA 2X19A 4Q9IA 1QHXA 2QA5A 2A30A 3NBXX 1VIYA 1UM8A 1Z07A 5FR1A 4BFVA 1G8GA 3SYKA 2O0HA 1RC8A 2EFEB 2W6IA 1M7HA 4OI2A 3VMFA 2QTHA 2FPMA 3SFVA 2VF8A 2BMEA 2IW3A 4NTZA 1MRSA 1R0ZA 2FPLA 3ASYA 4H9GA 4JLAA 4TMZA 4B3DA 2NO1A 4UXHA 4A6PA 3HU1A 1DG1G 1FX0B 4B71A 5J47A 4AC9A 2GETA 4G5QA 4HZUB 4NPHA 2A5DA 2YWGA 4JKYA 3GP8A 1I4DD 2IYXA 4CEHB 4Q02A 2QPAA 2R2AA 1AJEA 1J70A 5DN6A 2ZYWX 3W8NA 1GILA 4OBEA 2C95A 4Q00A 2IF0A 4RCYA 3QVVA 1AN0A 1D2EA 1G8YA 1NI3A 1OLOA 1VMAA 2LKDA 4KVGA 5E3HA 1LW7A 3UMRA 4PPGA 4QBIA 4A0HA 5JSZB 3VR1A 1CRQA 4LHXA 5L3QA 4WBSA 1TF2A 1GAJA 1DAIA 1E2QA 5FBVB 1KKLA 4CT4B 2AKAB 1D8TA 3U3JA 5DGXA 1DADA 3AVPA 1RE0A 2HV8A 3HU2A 4CGZA 2P5SA 1CU1A 4Q7LA 2WWHA 4QKQA 4DLTA 1OKKA 4BFTA 1Z8FA 4Q4AA 2BEKA 4AKHA 4Z54A 3H86A 5D3QA 5AR1A 2JASA 1EFCA 2C9OA 3TUZC 1TEXA 2F7SA 1XTQA 3RRMA 3KJHA 3RRNA 2XB2A 3NTUA 3KKMA 4M1OA 5KSZA 3L43A 4S35A 4DCSA 1DBSA 4HLQB 2ODEA 1XTKA 2C03A 1NKSA 2JIZA 2NMVA 2J0UA 5EE0A 2P6UA 2R6FA 1K5DA 2ZR7A 1LFDB 1MV5A 1D2NA 3TLXA 4RFVA 1W2HA 5CK4A 1DAMA 4LJ8A 4URYR 5KYKA 1XMJA 2YZ2A 1G18A 1RRPA 2JJ1A 2W2VA 2ZSDA 1JJ7A 5CM8B 3ICEA 4F92B 2FGJA 3A1UA 1NBMA 1DO0A 2X77A 3DMNA 4PANA 2WHXA 5HE9A 4LJ7A 2IC5A 1UF9A 3EZ7A 1XJCA 1Y3AA 3NBFA 4QGHA 1R5BA 4Q47A 4G5SA 4HLUC 1EX6A 2ZTSA 5L3SB 3FHOA 1X8KA 4DWJA 4OI1A 5DI3B 4LC1A 5FBQB 6Q21A 4HLUA 1N6LA 3SN6A 2R44A 2ZYUX 4GP6A 1GOTA 1XF9A 2G88A 1T9HA 2VSOA 2CL0X 2ZUCA 2FV8A 4LDJA 2ZE6A 4AKGA 3U2QA 1X86B 5JJIA 2DFKB 4LYAA 1A1VA 4NDZA 3TIFA 1BMFA 1BYIA 3I5XA 2CL7X 4TYWA 1NMYA 4LV8B 1ZNYA 1G16A 1GTVA 2F43A 4ZO4A 2YOHA 2KE5A 5H70A 1IXSB 2BM1A 4GI7A 5JHHB 2FU5C 3LQRA 5GJBA 1G7TA 2F9LA 3BE4A 4Z8YA 4LCBA 4LBWA 1NSTA 4HDQB 4LJAA 4X8MA 5K8IA 2HXSA 5KUTA 2GCPA 1F2TB 3I73A 4Q4JA 1E9CA 4WA7A 2ZI6A 5CJPA 3PXGA 4MDEA 2JEOA 1OIVA 2VO1A 1RPZA 5F9FA 1XNJA 1EX7A 3K70C 4DEYA 2NQ2C 4I81A 1FZQA 4TLDA 4HUTA 1Z6YA 3AGQA 4B2PA 3ZD7A 3NEYA 3THWA 4NCKA 1NG1A 3ND9A 1FQJA 3R9WA 4HDCA 2NO9A 1P60A 3EZ6A 5HZKA 1EFRD 2WV9A 5L3RA 4GT1A 1NP6A 2RHMA 5JFGA 2V6JA 3RABA 1RRFA 1W0KA 3B9PA 4BUJA 2FFBA 2ZVPX 4JVMA 3KXLA 4MYUA 2EWWA 3O8DA
chains in the Genus database with same CATH superfamily
4EGSA 1UXIA 3C2QA 4UM9B 1JHVA 1ZSYA 1X1CA 4ZPXA 1M1NA 4GQBA 4YECA 3WWYA 2WYWA 5JJLA 3AG5A 5JQGF 2VRWA 1EZ4A 1P91A 2HWXA 1KDVA 2B20A 1PEYA 3DV9A 2CK3A 3IDFA 1C1DB 2GAFA 4M0PA 1GGJA 4RZHA 3UJAA 4KITB 1O94A 2BR4A 2VT3A 4U6SA 4CVNA 3MGBA 1DZIA 4C0HA 4WT7A 4EVQA 3KAJA 3B1YA 4GR5A 3ZCQA 1U0GA 1ZFNA 2C7BA 3R75A 4UTPA 1A82A 3LUAA 3W5IA 4B45A 4HKTA 4HLDA 2ICAA 3Q3VA 1JXQA 2PUGA 1MG0A 4LXTA 4FOTA 4QE3A 3IQHX 4D4LA 3HVKA 1MAUA 3KHKA 2JCYA 6GPBA 1H2BA 1E6UA 1XTIA 2O2DA 3B1FA 3IAXA 4MUIA 1SKAA 1EH5A 1W94A 2FOXA 1M75A 3NW9A 4OXNA 3AFOA 2QN9A 5IMSA 3PXEA 2HBZA 3ANNA 3KL2A 4DDWA 3H42B 1UC4B 4O4IF 4Z4IA 1BVYF 4D0LB 4Q4DA 5F7XA 2CFTA 1W93A 2GO7A 2J7KA 3VHXA 1OAAA 2R3SA 3Q8LA 5TJHA 4LJLA 3TB6A 3UIEA 3VR2D 3HEAA 1I4WA 1QHEA 1T0IA 4PX9A 5AO9A 2B99A 3C3XA 3TN7A 4BGIA 3ZZ0A 5F1YA 4WDQA 1T8WA 2VRNA 4D3SA 2NTEA 3M2TA 3ZJVA 2XVZA 2ILVA 3S2UA 1W36C 1Z8NA 3SEAA 1YRLA 4JJEA 1L5RA 3C3CA 4IQ0A 4H6VA 2XVMA 10MHA 3BL6A 4DJAA 4BLRA 3GAAA 3KQPA 4OFXA 3COZA 3MUNA 1KZ9A 2I71A 2WPNA 1YMVA 3VH4A 4KN6A 2YV2A 3IOCA 3U9TA 4C2BA 5CYFA 2M32A 5DGCA 4AURA 2OY0A 3WXBA 3WRXC 2D7JA 2OHOA 2ZB7A 3MD9A 3NHSA 2ZZMA 3TKYA 1XFAA 3RSZA 4R4JA 5COQA 3OESA 1YDMA 4NFYA 3U40A 5F23A 5JFTA 3H7IA 1BA3A 1ZDMA 1JA1A 4V02A 5C5EA 4ZTUB 2W00A 1Y7TA 2HMYB 5DYNA 1IBRA 5COAA 3W0LB 4LJ5A 3T4UA 5GM2A 3I8XA 4YCBA 3QJYA 5TARA 3JASB 4XVUA 1PS8A 1DUIA 3QLVC 2FFAA 3F3YA 3GMTA 4JJ4A 4I66A 4TVBA 1FLDA 3HXPA 4EMTA 4UMDA 2G4VA 1E5XA 2TRSB 1UFRA 1MB4A 2B5OA 1K7SN 4IJ5A 1KRWA 1Z33A 5F64A 2HBRA 1RJEA 5IH7A 3K0AA 3V7FA 3WL4A 5G40A 3ROXA 5CNKA 4ND1A 5EOVA 3LCJA 1I80A 2YWEA 3DTVA 3SSNA 3H04A 4K5QA 4PHFA 4GOOD 1Y4AE 2PGXA 1ZMXA 3Q3IA 4HHEA 2I65A 3U4GA 3FG9A 3NTLA 5JWHA 2ZJBA 3VDRA 3BPSA 3ZHCA 4NU8X 2BFPA 3UK0A 5DX1A 1AO3A 3PU6A 2ZQYA 2XTNA 3X44A 3D7SA 5A4FS 1YRBA 1TT7A 1C7JA 1BE8A 3ZQ6A 4CF4A 2XOXA 1CUYA 3AMVA 3GJ4A 1ESDA 1Z36A 5CFLA 1AXEA 4EPYA 4C1BA 3ZI0A 3G0IA 3OEEA 1RXVA 4BMSA 2QD2A 1JDVA 1QC5A 1HMYA 2DX7A 1PFWA 2IU4A 3FF4A 4EG6A 2ATVA 1C3EA 3LWDA 4TV8B 1XU9A 5EMJA 5IT9A 1VA4A 4N4AA 1U8EA 1O3YA 3B6EA 3GO4A 4FSHA 4N54A 4KNYA 2WG2A 3L8GA 1KOGA 5G1OA 2PU7A 3A6HA 3PFNA 3UYLA 4YP6A 4MI3A 1NOKA 4OMFG 4WE3A 4ND2A 5BW8A 3T35A 5BWLA 2QUZA 3ZD8A 1XAHA 2PLRA 3OPNA 4CG3A 3FTEA 2IS1A 3GW8A 3FGZA 1XJ0A 1U65A 3KQLA 1EI9A 2FHPA 5CLJA 4NV0A 3V2GA 1I4TD 1UOEA 2FPPB 5ICSA 3D1JA 4C0QC 4I4NA 4HWRA 3RYHB 2VP5A 4P4UA 5IU6A 2HL6A 2EEZA 1CYDA 1RI1A 2Q2NA 4FYKA 4H17A 5TT1A 1D8AA 3W8RA 3TLCA 4DAEA 1SU7A 4ARVA 1C81A 1JZSA 2XGOA 2QB5A 1JIUA 1TCUA 1Z47A 3GMSA 2GAJA 2FCRA 4E51A 4IR7A 4YAKA 5FYQA 1H69A 1UT5A 2ADFA 3G8CA 4MQBA 5LFAA 1PD1A 4UVEA 5BV0A 4AJ9A 2ZAGA 3QSGA 2EXXA 3MTEA 1ZN7A 5ED0A 3FTPA 1M5TA 1KVSA 1Q1EA 2CLDX 4CODB 3CJTA 3FCYA 2QIOA 3DLPX 3FYUB 2B8NA 4JLWA 1WP4A 3PC8C 1O77A 1JLSA 1UMBA 2BSQA 3FPBA 2GARA 1JMKC 1RAAA 4ZGBA 2VQEB 1Z5OA 3NVKI 1X7XB 1KDOA 3JQCA 3P32A 4D4KA 3TZCA 3DDNA 2HLPA 2Q6OA 4Y6LA 5FX2A 3MTIA 1Y3IA 4UFNA 4TWIA 1YQGA 1RRKA 3TUJC 1WO8A 1QIKA 1I3OA 2RH8A 4B6PA 4TT3A 3GGOA 4DLLA 1RQRA 3URKA 1KDPA 4QRHA 1XROA 4DIDA 5EEHA 2IZ6A 2HHJA 3I6IA 3M0EA 1KO8A 4KQKA 4P7GA 5GQSA 3KB8A 3VR5A 6CHYA 1ZZGA 2G63A 1QIIA 1MZVA 4EL0A 1T1RA 3OPYA 4JLVA 1IY8A 2QTZA 5BT8A 4YV1A 2C99A 4NEQA 2CMHA 2WEKA 4RGYA 1IWPB 1M2VA 2IUSA 4C0SA 1SPBS 3R0XA 1ULBA 5A3QA 2J59A 5G0TA 1QNLA 1CCWA 3QZUA 3DB1A 1NVTA 3LOPA 2P69A 4IIGA 4K6OA 4R1NA 5EP2A 4OM7A 1ISFA 1KY5A 1RXSA 5SZKB 3B85A 4ZYZA 1ZVVA 1DXHA 4ALNA 4PSUA 4XFDA 4W5TA 4D57A 2VQFB 5AUPB 4LZAA 5I4KA 2AK3A 2DR0A 2B3TA 4ZAGA 1DIAA 2AQ8A 1N6NA 4M54A 4WTOA 2C2MA 4U1RA 3UAXA 1JKXA 1R8SA 2Z58A 3HYSA 2Y27A 2BEJA 3L01A 3NWBA 3SPXA 3TH5A 4HUQA 2DP4E 4QELA 1PR9A 4R84A 2VG8A 3QU4A 5IXJA 2WFAA 3E1SA 3H1TA 3N6XA 3REGA 3AF0A 3UWPA 4ND8A 1JP7A 2O3QA 1V71A 1T0PA 1YZKA 2WOOA 5EZ5A 4JQCA 4RWEA 1IONA 4F56A 3AR8A 4Z9AA 2XMSA 3O2JA 4U00A 4BWVA 2AW5A 5A0FA 2O54A 2VYQA 3LYLA 3UPUA 3MMSA 3ESZA 3F67A 4DDHA 3H3JA 3MGGA 4DR4B 4UUMA 1JKJB 3T1NA 3MSXA 1VJRA 3WSTA 1K8ZB 3VYVA 3TFOA 1ZM7A 2EL7A 2F3RA 5CXXA 3RC9A 4UUNA 4JNCA 5E95A 3BJRA 3HZOA 4S1VA 3UG6A 3VYRB 1OXTA 1X1SA 2NO4A 4G0OA 2TECE 3EJ6A 2NZ8A 3IXMA 3ZHXA 1U02A 2L42A 5JARA 3G6WA 2FRVA 3QBEA 5G0UA 1H2YA 4JI5B 1N2XA 3L8DA 3PRHA 5ARCA 5KDDA 1SEPA 3RG2A 4Z1MD 1JHRA 4PAOA 2GESA 1NIPA 3IQDB 4RMJA 2UU9B 1M0SA 2PV0A 4C0WA 2W70A 2WYIA 4YX9A 1OXBB 1AM4D 2OPBA 3P0RA 3CRVA 2C7PA 5FWDA 2J3IA 3C6ZA 2VC2B 4O4LA 4LZLA 4XYMA 4G65A 4M1YA 2PKQO 4QNMA 2KJQA 2ZYHA 3BIJA 4DQKA 2F8MA 3V8NA 5KIAA 2IOHA 3V8EA 1CUSA 3K6RA 3DO8A 4TTAA 3QYJA 4A91A 4OX9Y 3K20A 2WIAA 4UE6A 1QVZA 2DPGA 1KDZA 3RUPA 4DV6B 3LNCA 2WJHA 5DM2A 1J25A 3RFCA 5CAEA 3MHTA 3OZTA 3DHWC 4NPAA 2NZ2A 1BE1A 4YJGB 3JAKA 5DP1A 3UAGA 1Z5NA 4OSEA 4WKOA 1E9FA 2F1RA 3W3AA 2Z4RA 1BGXT 1H9BA 1TJ4A 1OLSA 2IPMA 2P5UA 2R86A 3W1VA 4TM8A 3QVMA 3NHBA 2CVZA 1I36A 1SVLA 4FD3A 4JGGA 2YJTD 4C7JA 3FWKA 2Q3JA 3OTHA 5CB4A 3B3JA 4LHZA 1OJLA 3LX4A 5FADA 4OB8A 3UVEA 4ZCQA 2IDZA 4HX2A 1GITA 2LE0A 1EP1B 2I2WA 1TEVA 2HPHA 2AN9A 3HWX1 3P96A 1C2TA 1J49A 3IB6A 4XM2A 1MT0A 1QR2A 2RONA 5DCLA 4NFLA 2AWNA 1KEZA 1OMOA 1OYWA 2IQ5A 3LX6A 2F62A 2F67A 1II0A 4LF4B 1M2FA 4UMVA 2ZI5A 3NHMA 1FP4A 3BXPA 1T0HB 2HLHA 2JH8A 4YRGA 1PR3A 2CNBA 3E9YA 3LVFO 3KZNA 1RQGA 4JI4B 2BEWB 1U1FA 1DGQA 1UR5A 2XZTA 1EB8A 2DWUA 1CEXA 2E6UX 1OILA 2FH5B 1C5KA 3DD1A 2G6BA 1RKBA 1U11A 5IH3A 5HS4A 1NW7A 1NRIA 1JFRA 1Z6XA 1PFUA 3NAQA 4IMPA 1WG8A 3WZMA 2RGUA 3I37X 4BWYA 3IBCA 2VOJA 1XX6A 4YJHB 1ZITA 5FOVA 1T0BA 1PAUA 2VHUA 1KJ9A 2IODA 1Z06A 2GF9A 3MUOA 3T5AA 1CEYA 3I2HA 3KEFA 2A1IA 3AM1A 1MA3A 4D2IA 4PAQA 1Y8ZA 3C6XA 4UZFA 5CVJA 3P2JA 4OM8A 4DQ0A 4NHOA 1N0VC 1MJHA 3Q7SA 4AO8A 7REQB 1T9BA 2X8AA 5IJ9B 5EJ9A 2A0FA 1LQUA 4HXGA 4NCIA 1GTMA 3EG9A 5TJ9A 1KPGA 4CKWB 1HEIA 1KMCA 1XU7A 2W2TA 5K3EA 4C78A 5HWSA 4II2A 4MRSA 4X66B 1R5NA 3SD7A 2RCNA 2VJCA 2NU8B 2Q5LA 5CT5A 3R7WB 1E8MA 1HE5A 4M9RA 4B9AA 2FQQA 2R1VB 1QFXA 4RFLA 2A4MA 4RM3A 3A7DA 3AVQA 3BXGA 4KGZA 5C51B 3TGWA 3IKVA 1CY0A 1SHLA 3TW6A 1ZNQO 2BV3A 3B1ZA 2HJSA 3RVDA 2AK2A 4ETWA 5K03A 2IXBA 2WG0A 2GF0A 5JYEA 2XA1A 2VNIA 4RPHA 1AB5A 3V1LA 2PZBA 4TLMB 1IBCA 4IFEA 2R1TB 4ZEWA 3K92A 4FWIB 4MROA 2EZ9A 3ZDQA 4ZQHA 3OQIA 1WXGA 5JANA 2XMCA 4JHLA 3F90A 2EF1A 3GLGB 2BM0A 1I2BA 1G9SA 1XOIA 4I3HA 4E1BA 2H2IA 2CNOA 5I47A 1ZCBA 4BLQA 2GFHA 3FNFA 5CDFE 4U2CA 5U9CA 2H1CA 3HKDB 1A27A 1M1YB 2I4RA 5BURA 3DE7X 3EJWA 3CT4A 4DMLA 2FI1A 3DGFC 4LSZA 3O5AA 3KZVA 1WXFA 2QTGA 4X1YB 3IEPA 1AS2A 2AFIE 2B92A 4FZ3A 2P75A 3ONWA 4WZBB 3TBFA 1TZCA 5CLGA 4OHXA 4R01A 3OUUA 5B3JA 2ID4A 2IY7A 4UEQA 1U9IA 2BCJQ 2MMCA 3E70C 4M60A 4Q1EA 4WEOA 4BZWA 4CM9D 3Q0TA 2LRHA 4O59O 1C8BA 5KOIA 5CR9A 1J00A 1KYTA 1X1DA 3MAGA 5B1HA 4GLJA 3P9SA 2H1SA 4O2BB 3SVZA 4FMDF 1ONPA 1RXIA 3K9LA 3IVCA 2FZEA 5INTA 1TMOA 1E4YA 1L5GB 4GPBA 2VL7A 3L8FA 3DPUA 4KB5A 1XPRA 1MRZA 2JBWA 5CMLA 1F0PA 2C78A 4FLFA 1H2HA 4QASA 3BJIC 4TV9B 3G0OA 2PX5A 3IAAA 2H2AA 5AVKA 1CF9A 3CUKA 3IQIX 5LDHA 4L2IA 2BF4A 3HN6A 2HC9A 3GLFE 2Y1CA 4PLGA 4BGUA 1YZYA 3X1YA 3GLKA 3GLHA 3OA0A 4NYJQ 1QYRA 1FY2A 2QTFA 4XGNA 3VX3A 5D5QA 4MW6A 3FFWA 1GZ4A 3HJNA 3H75A 1W1IA 1VJGA 2W2MA 3RC1A 5D3MB 5FHQA 4Q9LA 2X4DA 4P84A 4DXHA 4IIHA 2VZLA 1U2DC 3DP7A 4NX2A 2Q9CA 3OAAA 5IUNC 2ZT5A 1AMNA 4K81B 5JMTA 1QV9A 1ZOSA 3LWBA 2NN3C 4M1EA 2G0TA 4WN9A 4JQYA 1W59A 4F71A 3OT1A 4G2NA 3OETA 4MOWA 1C7IA 4RVUA 1JIVA 1F3LA 2C04A 2FN9A 3P0IA 5FOTA 2OAP1 4QPCA 3LFHA 4ZQGA 1UADA 3OZUA 2I9PA 3A9RA 4IKEA 3TLAA 5IF3A 4DV7B 4ABTA 1E6LA 3FPKA 4E2ZA 2W6ID 4Q9HA 1E32A 1GXSB 2QDKA 4KIJA 3M6FA 4N5DA 4N0QA 1KI9A 3WGHA 1XRRA 4ZQCB 2G09A 4OXKA 1WXHA 1WKCA 3HUFA 2LBPA 2NM0A 2WZCA 4KLZA 4BEJA 3FOEC 5HZGA 4L5BA 1K6IA 2Q07A 4G0XA 3ASVA 1C80A 1DDOA 3BK1A 3JAWB 3DZCA 3AEYA 2Z5LA 3OSUA 3A3OA 2X3FA 1E2LA 5L9AA 4LVCA 1QOZA 1K2VN 3KUXA 3KCNA 3KFVA 3NDRA 5DW3A 3U7IA 4FX2A 5KHLB 4M99A 3WDMA 3O6VA 3CBQA 3MAAC 5AW6A 2BF7A 5T5QA 2HUPA 4NL4H 1IIRA 1Z5GA 1OLUA 1DRKA 1QFMA 1XMOB 1WMAA 3QNWA 5CHYA 3KEGA 5B2FA 5CCXA 1H3NA 5A0TA 1LXCA 3L4BC 4RZUA 1TC2A 4D92A 1ULSA 2EP8A 4QUHA 4HRYA 3SZUA 1Z17A 4R1TA 4IX1A 3KPUA 4MJXA 4NOKA 1S8FA 4PIMA 4YP7A 2XYPA 4LZZA 2HMUA 2AI2A 4XVHA 1QCYA 2ZRAA 4GYYA 4FFBA 2GZ3A 3C45A 4Q3DA 4UEWA 5EHGA 3RYTC 1R6XA 1AUQA 3M1YA 2LGJA 3K0CA 1P0IA 2QN6A 3WP1B 2CE2X 3KXPA 4G9GA 3ZS8A 1IN8A 2ZJAA 4Q0MA 5CT8A 1NHGA 4F5YA 3QEJA 1FTWA 3ES9A 2NSJA 3RHTA 3R6DA 1HH4A 4IXMA 2HM7A 2YMLA 3ILVA 2EBHX 1ZISA 3Q72A 4J9UE 3OM1A 2WSYB 2O2SA 1KZ7B 1ZIPA 2OHXA 3L04A 4CL8A 3GNTA 5ESXA 2YIVX 3O3OB 3VR3A 3P9XA 1U81A 2XDYA 2ZBDA 1O0CA 2UZ3A 1ULTA 4HAZA 1OBCA 3HLYA 5GWXA 1X1EA 4PTZA 1EVZA 1C1XA 2WD7A 2CFOA 1NE7A 1RKVA 4X71A 3ROKA 3QG5A 5HBRA 3I92A 3KHSA 3OJ0A 1EUCB 1U6KA 4CLHA 2FUCA 1GL3A 4IVRA 1COWD 5KVCA 1GU1A 5LYJF 2CMFA 2CN1A 5BOSB 1MOPA 3EEBA 2FQXA 3H6KA 3KTFA 4MP8A 2ZAOA 4MPDA 4NQZA 3V4VB 2JFBA 1IDN1 3THYB 4G8DA 3ZHOA 2KS6A 2NYVA 5LZ4A 2HJ9A 3EGCA 4QEZA 4ZOLB 3MW8A 4Z8XA 4ABYA 3FXAA 5DH9A 2C9BA 4BNKA 2AFHE 2JLXA 3QVJA 1SKUA 1A8HA 2N3ZA 3M4JA 3WLEA 3T94A 2B7BA 3S3TA 1ISPA 1NR7A 1IQPA 3FNBA 3JATB 2CBZA 1XZGA 1NAHA 5EJFA 1B0PA 3WX0A 3IBYA 2PWPA 4LHVA 4K6KA 2PSDA 3UGTA 1W49A 5JUWA 1DWOA 3UAOA 3UKDA 2C42A 4R54A 3DZ8A 4BP8A 1PNQA 2CV2A 5H9WA 3H17A 3RVJA 3HVRA 1DKQA 4LV5B 3PHCA 3UM9A 4TTQA 4DQDA 4Z4FA 3ZC3A 1T10A 3IUNA 3C5WP 3KB2A 1L3CA 4J0HA 4D1YA 1NVMB 3QFCA 3PNSA 3A6GA 5DHTA 1CVLA 4LDZA 2Q3LA 5J5CA 1TM4E 1JDTA 2JJMA 5BR1A 4JJKA 4BTLA 3VSBA 1O96B 2C57A 3C15C 4L4UA 2FW1A 1KOJA 1OU4A 1ZM9A 2NXWA 1I0ZA 2ZG6A 1HK7A 5FIUA 2NUTA 3RV4A 4CKEA 1ZICA 1N2GA 2IHUA 4D8TA 2EJTA 2VJMA 3AHDA 2WJAA 1ZY2A 4ZVUA 1PWXA 1VLHA 1MW8X 3AJAA 3RYIB 3UG7A 4UFPA 1YFLA 1FMFA 4TRMA 5KNCA 4O63O 5FUBA 3Q7RA 1SNYA 1HT3A 4FDUA 4P7FA 3VKHA 4J1TA 3WY9A 3H18A 1ITZA 2OBMA 3EIUA 4ZKDA 5AI0A 3GRFA 1YK0A 2FN4A 3LRXA 4WOCA 1UM9B 1LJ8A 2G1AA 1LX7A 1NMXA 3A36A 2POQX 3VPBA 3ZUGA 4B8WA 4ZOAA 1BROA 2AEEA 1IC6A 2ISCA 4IPTA 4LK3A 4IV5A 2VJLA 2CBGA 3TLJA 4WZAE 1SUCA 2QJTA 1KSGA 4ZTBA 4BWGA 4Z3OA 1EUDA 1W85A 2VF2A 3JVDA 4QBHA 1QYVA 1OH8A 1LK5A 5BSGA 5FUMA 1XP8A 4M9QA 3ECAA 3FNQA 1YJCA 2YV1A 3K70B 1DS6A 3ENQA 2V55B 5SY9A 3IQXA 3IJRA 1U2TA 4HCJA 3L4KA 4MV3A 1Y3BE 1XL0A 2JZOA 4D45A 3ON5A 1HE2A 1Q21A 3FH0A 5ADHA 3J7AC 1GZHB 2BFBA 3DV0B 5TNXA 1UKBA 4OSOA 4HVAA 4QJ4A 1PS9A 2GWHA 3FWNA 4JT9A 1KARA 3GAMA 1X7WB 4X8OA 2RCYA 5HCNA 3F6EX 1KC3A 2QI9F 3X1DA 5IM4A 3EGEA 3VTFA 2O2CA 4WECA 4BTVA 5EJ4A 3HKBA 4IDQA 3GDOA 3PDCA 4QU9A 4EVIA 2AUNA 1WHTA 2P2NA 4G63A 2ZJ8A 3E4DA 2N46A 1AQJA 2O5VA 1EZ1A 2JI6A 3WRYA 4DR2B 2Y05A 4PYIA 1DAGA 2QTCA 2HJGA 4G4GA 3JU3A 3Q6NA 4DDTA 1TK9A 1YE8A 1QYXA 4F06A 4QTUB 1DO8A 3THXB 4E22A 2WWIA 3T9AA 4KQCA 1V41E 4X0EA 3UV3A 1P73A 3F6SA 8ABPA 1IY1A 1F8XA 4U3JB 4WADA 4EY3A 1VL1A 2BGJA 1TPYA 2ZIVB 2ASEA 3HDJA 4KQ2A 4RHXA 4EQ6B 2Q4TA 3C8DA 1M6WA 3GFPA 1FFXA 1FFSA 1VLJA 3FCSB 4D8UA 4CEJA 2J3HA 3F5QA 1GPYA 1MXHA 3LP5A 3R6GA 3RSOA 4QLBA 4EKDA 2DOKA 3FI9A 5IAJA 2BFFA 2F8SA 2C8JA 3MWEB 5GZ6A 4LBZA 1XFDA 4G67A 3UMCA 1NJFA 4FWTA 2IYRA 2R79A 5E2IA 3DZKA 2GSDA 4MAFA 3UTDA 5AKHA 4EHBA 3ICQB 4BFZA 3GUUA 3JQ8A 1GT6A 3HCDA 2I7CA 4UBOA 3RREA 2CLMB 3BGWA 4YH1A 3UQYS 5FL7A 1YQDA 1KMQA 1T5HX 2F3QA 2O3JA 1VJ0A 4A4DA 1OIXA 4IDNA 1G3MA 3A9SA 3N0TA 1JAYA 3PFKA 2JAQA 2YMMA 1YQTA 2QZZA 2YUIA 1N7HA 1F7VA 3L5OA 4M7PA 1S7CA 1CR0A 4KXFB 1IHUA 3CNHA 4RTMA 1U7DA 3FFTA 3EXHB 1VMEA 3OQPA 4FONA 3NM4A 4IHJA 1RAFA 3N70A 2ZCVA 1DEKA 1PCXA 5JZSA 1QPZA 2AFVA 2C5SA 3QEBZ 4B2LA 3LI2A 2VJAA 2CCJA 1TA9A 4IUYA 5LL6P 1TD9A 1U4OA 1V2GA 4Z3DA 2O6HA 2XUJA 4IDCA 3TQHA 4DLNA 1TE2A 2E4YA 5J4YA 4IWYA 4EUEA 4FLEA 4B6JA 3GMDA 1NY5A 1DWPA 1UJ4A 2HQOA 1QYDA 1U2GC 2V6BA 3HBAA 3RFUA 3WE7A 2B1QA 2FWBA 4UDOA 1E1LA 4LBVA 1UMCB 1VKZA 5GPBA 2CXQA 2CJXA 3EIEA 4NV3A 3NXSA 4HDMA 1BRTA 1JB1A 4CYMA 1LPOA 2K7ZA 2VKTA 3U9LA 2ONZA 3TI7A 2J48A 3VVBA 1Z2PX 3SF8A 3VZCA 4CM3A 3GZJA 3T6KA 5KQLA 4KE7A 3D6VA 3I1IA 1TZMA 2HMTA 4NXMB 1KBQA 3IOEA 1QFJA 4XCVA 4DC9A 2GUGA 1E89A 4GGPA 4QDZA 3T7EA 2IBMA 1TAGA 3F7TA 3H8JA 3PPIA 4NENA 1QX3A 4UXJA 5TQ0A 4CHGA 5IYZB 4GX5A 2PGDA 3R7LA 3WO0A 3WL3A 3HUEA 1OH7A 4KN5A 1BKSB 3KLMX 2II6A 4JODA 3OCCA 3EGOA 3I9FA 1Q14A 5BVHA 2NTJA 1BC5A 3B5JA 5AVYA 3KKKA 2RAPA 4M21A 4BX8A 2Z3ZA 1L5SA 2VJNA 3H1PA 4KQ9A 4BV9A 3MCTA 1VSVA 4DYVA 3LVQE 2FPGA 3TCNA 1YFZA 2BMFA 1Z6ZA 2QLNA 4F3KA 1XDUA 5DNYB 3U31A 4D82A 1AV7A 1A69A 3GGDA 1RWQA 5FTJA 4D26A 2CB9A 1P1IA 1UXJA 3ZWYA 4MDFA 4RHYA 4C07A 3V1TC 3T4PA 1NI4A 1QU2A 1YS2X 4CEIA 4QOGA 4WZ6A 1L4BA 5A5FA 1RJ9B 4E70A 3CR7A 3GEHA 4WFQA 1QVRA 1X14A 1EJBA 3M4ZA 4CCSA 2ZXEA 3IMFA 2XTJA 7AT1A 4BO2A 2AG1A 3Q9UA 4HAXA 3I39X 3NWJA 1Y7HA 1E61A 4QARA 4R7TA 3D3EA 1D07A 5DNUA 1GNQA 4URXR 3AZQA 3OLYA 1HE8B 1I33A 2JLRA 3BK2A 4C0LA 5GZ3A 1Z0UA 3JWHA 4QGSA 5C1BA 2W43A 2K5UA 3W9SA 3LY5A 4TXNA 3FTCA 1J9GA 2HB6A 1KP2A 4CG1A 1R64A 4DA8A 3W5VA 1GNPA 3EAQA 2X6TA 3DP9A 3OU2A 2IXTA 1K92A 1XKQA 2QGFA 4OJTA 1SXJC 5C35A 1R16A 1KMHA 4X1KA 5JNLA 4FGSA 1GGVA 1NDHA 1RLIA 5G1NA 4DXAA 1HR0B 3C85A 4TQAA 4OHBA 1BCRB 5K3DA 3V4SA 4BNHA 1IUKA 5B36A 1E2UA 3K6SA 2IIPA 2QUKA 4UNPA 4HWOA 2GZHA 3R5FA 4HFNA 3KKZA 3WLSA 4F4FA 4TLBA 2YNMA 2FK7A 1DEHA 4KR7A 2ZTUA 3BIOA 5ALUA 4YRNA 2CLHB 5BSVA 3HBFA 1DBQA 1ORTA 1E2EA 3WNCA 3WV4A 1D7AA 3RKSA 3NAGA 3LTEA 4QYXA 5GIOE 2FKNA 3TAHA 3LIIA 2QN7A 1WTAA 4K9PA 4B2IA 4TKMA 4QTYA 4LGVA 1Z0JA 3IH5A 3HUUA 3KYCA 4MWCA 4RSRA 2BHLA 1D6MA 1KI6B 1JI0A 3RASA 4AF6A 3KZXA 3V2HA 3U7QA 5KNBD 4TYYA 3PL1A 1RYFA 4OGKA 4RL6A 4Q9DA 5TSDA 1NBOA 4AIRA 1D4FA 1P0PA 2RH4A 2ZB2A 4X6LA 4CIYA 2C4HA 1U3TA 1VC2A 2XUHA 3AR2A 2ZZKA 1WXXA 3JARB 3ORYA 3P4UA 5KTKA 1TTPB 4XR4A 1KQFA 3OH8A 4J4BA 4CF6A 2GVDC 2J6IA 1E1RA 4OP2A 4P7JA 4UDYX 1A3CA 2IY8A 1F0NA 2XVAA 3RVRA 1I4LD 1WDWB 2OHHA 4G26A 4IW3B 2HIAA 3I1FA 4KDCA 4D5EA 2D1SA 2GCGA 3F7NA 4TZKA 4UVIA 1TO1E 3ROTA 4BVLA 3SIWA 1JJBA 1OAKA 1W9HA 1NMSA 3EXAA 3HUTA 4G23A 4ARSA 3N2LA 3BH6A 1DDIA 1G60A 2BE9A 3AR6A 4JL8A 4YV2A 3BT7A 2F48A 4F60A 1OB5A 2DLNA 2WFLA 3ITKA 3D0QA 3UHFA 1Z82A 4B6OA 4B46A 3H84A 1NXQA 3K0FA 1I2ZA 1SPXA 2WKPA 3A4IA 4JYCA 2H3EA 2IUEA 4BQNA 4OI4A 4EW6A 1WW3A 3GJ8A 2IP1A 1TM1E 3G5AA 2R47A 5ESRA 2L69A 4I50F 3OY7A 3G7UA 1XA0A 3SR0A 3A6LA 3V97A 1B14A 3G0DA 2ZU6A 1MIOB 2PGOA 3W5AA 4ARIA 1L5OA 3QXCA 2WYVA 3N0RA 4PYRA 3VZSA 3W2EA 1YZQA 4MYRA 3ZW7A 1VMKA 2BH9A 5I9LA 1LDMA 1ZN8A 2ZBUA 3ZLJA 1YRYE 2FQ1A 2LCIA 2X0NA 1N8TA 5L3SA 1VPVA 2B5WA 1S9DA 2ZQZA 4TL7A 3V1NA 3FVQA 3M6MD 5LWQA 2PH1A 2OKCA 1TK2A 2O8FA 2WTXA 2J3MA 4WNAA 2RHWA 3FTFA 1HQYE 5JS1A 2YWDA 3BE8A 1S8NA 5FFMA 4TL9A 4U7WA 4KTTE 2XNDD 4KXLA 3G23A 3ZTYA 4GMGA 2PGNA 2YC2C 2EOAA 5E4JA 4ER0A 3ZQKA 2D2VA 3CEMA 4FOPA 4XX0B 4ACAA 2IDMA 1YCHA 3B7GA 3AR7A 4B9EA 3IMCA 4D0NA 1WBJB 1GZ3A 5B1DA 2J31A 4GFDA 1A4XA 2AA3A 1TVMA 1WVMA 5HMMA 5K6AC 3DCIA 221PA 2O3RA 2XNJA 1Z7GA 2CJFA 2RHCA 2YXNA 2X8JA 3INRA 3LE8A 4QNRA 1U4SA 2ZUVA 3C16C 5EWLA 3ZYZA 5A9SA 1FJGB 2X9VA 3BJZA 3N8HA 1YR8A 3AVVA 1F51E 4HNGA 5HEKA 3CWZA 5I51A 1GSAA 2DLDA 2HWKA 4O0LA 1RI3A 4O6VA 1DQNA 2WAXA 2ZRBA 3K1JA 4DIKA 4IZOA 4BNJA 4JP1A 2OCGA 4MB6A 1V3QE 2XUQA 1GPJA 1DUSA 1XBTA 3ABRB 3ISJA 4MTLA 4I4TB 3COPA 3PJDA 3FSGD 4OGFA 1T5TA 2ZYAA 3SICE 5EJGA 1QUFA 2CD9A 3DOFA 4JFRA 2VSNA 3DKVA 3S1AB 1EIZA 1I24A 1CUVA 3PUZA 4G81A 3LBFA 1IVNA 3T9DA 1LGYA 1X77A 1B15A 3L0YA 5KNDH 3PLAE 4EEZA 1U2RA 4DSOA 3BGOS 2IYSA 1DBRA 1E1QA 3OUTA 1U5CA 3EUWA 2PZJA 2KHZA 1YJBA 3CLUD 3FYCA 3GPCA 3IUEA 5CW1A 3SP1A 2RFLA 1WD5A 2J9GA 2RHGB 3AOEC 1C14A 3GLFB 1MRNA 3KJZA 2CJWB 3NVMB 2O5RA 1P0MA 2YWFA 3J81k 3LRTA 2I67A 2X41A 2GZDA 4RFSB 3G2NA 3ZY2A 2Q62A 1FU8A 3BGSA 5JAPA 1TJ5A 5F2NA 1CB7A 3CVVA 5A2QA 1GSHA 1N6PA 5FBZA 1KBOA 3TXXA 1W4CA 3WIVA 1PF7E 1W25A 2P2YA 3BICA 3KQMA 3P0JA 4GYJA 4PRLA 1UQRA 3O0DA 3OFJA 4LXUA 5E1MA 1Z7EA 2QX8A 3H11B 1IZ0A 3AKDA 4FDTA 3OSZA 2ADMA 4QG7A 2XCTB 2NYAA 3H0CA 1ILEA 5A4DA 2YCLA 1UKYA 2ZM5A 1TA0A 1BX1A 3U5ZB 3MWFA 5TX7A 2QAJA 1VDMA 1R4NA 5CD1A 3WLOA 1QS0A 5FO1A 4BYMA 3VO9A 4HR7A 4JELA 4RZ2A 4G0UA 4Z6KA 1D5WA 3RIHA 5EQDA 3ID6C 1C9EA 1OJ7A 1XSEA 3CW2A 4D8WA 1G8KA 1NYTA 1Q1AA 3FKQA 1GNLA 3C6BA 3LPDA 3N39C 5CYOA 3D3WB 5KOHA 3A1FA 5LP6A 1JU4A 2YZGA 4JBGA 1AF7A 2OO7A 2RH9B 1SVSA 5DYWA 3GX1A 1NBWB 1U4NA 3CRRA 4FFMA 4TLAA 5IUKC 5JPIA 4BDSA 3TSWA 5KTMA 1X42A 4QTZA 3N05A 4WNIA 4YHHB 4YTEA 2WK1A 3ULKA 2ZRLA 4A27A 1V4BA 1W2GA 2CBXA 2WIGA 3EA4A 4GC5A 1OGYA 1EFVB 1NJGA 1VM6A 2ENWA 3CLSC 4YRLA 4DG8A 2EARA 3DFIA 4PXSA 4GPTA 4PPNA 5AVXA 3FPFA 1QHNA 1X6VA 3PUJA 4R83A 3EXG2 3RJZA 2JAHA 3VO2A 3ENZA 1JIKA 2HZ7A 1JEQA 2V3WA 3TIGA 3LWNA 3A1CA 2H1HA 2XBMA 1BTOA 3VFDA 2R8OA 2G9QA 1Y33E 3J7TA 3M5PA 4HN2A 4QUJA 2G06A 5AI6A 3KTAA 2VLBA 4K46A 1NQAO 4DM7A 3ZTWA 1M2GA 1E6CA 3TRFA 1V7CA 3ETGA 1AS3A 1XPOA 5DCUA 1YUMA 1GUBA 5COBA 1XJ5A 3ORRA 1C29B 1CIJA 4HS4A 4YO7A 4BY9E 2J9YB 1SHKA 1RR6A 3LVBA 1LV7A 2JHGA 3D5QA 3SKXA 4ZO7A 4TKZA 5L7YA 4A0SA 5HGXA 1E5TA 5AKLA 2OCXA 5HOEA 4LXQA 3HNOA 4PLWA 1E3TA 3B38A 5I7SA 5KMGA 1DE0A 2JHAA 3CLSD 2KWIA 1OCEA 4LJ6A 5J2UA 1TX4B 2FZVA 5BW6B 3VHRA 4QODA 1U31A 2GJ8A 2HPVA 2SICE 3AR3A 4NZNA 2BH2A 3IPCA 4IIJA 4H60A 4J91A 1FMLA 1B2LA 2RGNA 4R1LA 3LYHA 1O54A 1P9OA 1UPBA 1YS4A 2XHZA 3KJIA 3AI2A 4O2BF 3SM9A 3VNSA 4AKEA 1B8NA 2PMBA 2R4QA 2A78A 2VQ6A 2JFPA 5LQMA 4MA0A 3V9PA 4I99A 1HFWA 4L5JA 4RTSA 4V0NA 2IVZA 4M36A 1OC4A 1FTGA 1HM5A 3LDHA 1Y8CA 2XCOA 3BWBA 2IDJA 1ISRA 3QUSA 4HDAA 4LJSA 1K4YA 3ZY6A 4AMZA 1ORWA 3RVOA 1ZUIA 3FX2A 2AF3C 3PCXA 4RJIA 1YQEA 4UBIA 1MEOA 2C9DA 3TW0A 2PK3A 3FCOA 4TXLA 4KQ1A 1GYRA 3KYDA 3LUHA 4IJQA 4KGVA 3O03A 5BRAA 3NDBB 3HLTA 1MLDA 1JIQA 1GRQA 1H0RA 1PJTA 2GEKA 3N2EA 3U0BA 1EIWA 1M7GA 3HCNA 4JASB 2G1PA 1UBMS 2J08A 1WXEA 2AFHB 3VSDA 3ADDA 4MGYR 4TZ6A 1N2ZA 3K5PA 5GP1A 1SCDA 2QTMA 1E96A 2P9GA 1U0EA 2WWWA 5K1ZA 3RO7A 3D6NB 1OIWA 2JDID 4LVOA 5C1DA 5L95A 4M46A 4HJRA 4EKYA 1IMOA 2OZEA 4G8BA 2PSSA 3AX6A 1ZGBA 1XVTA 3CPSA 4U0KA 4CLDA 2XOKD 1K97A 2WG1A 1O9HA 3EAFA 2XCLA 2E49A 1IOZA 3KG2A 3I6YA 1ZH8A 4FSDA 3CRQA 2QUAA 4LECA 3ZJ4A 1I14A 1I10A 1PL7A 1P3DA 2PJRA 4FEAA 2GX6A 4WNYA 5BSMA 5E4TA 6NULA 2O2EA 2UZIR 1I3KA 1QPBA 5L8VA 3AHHA 4RUKA 1U7WA