2KJQA

Solution structure of protein nmb1076 from neisseria meningitidis. northeast structural genomics consortium target mr101b.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
149
structure length
149
Chain Sequence
MGHHHHHHSHMDYPSFDKFLGTENAELVYVLRHKHGQFIYVWGEEGAGKSHLLQAWVAQALEAGKNAAYIDAASMPLTDAAFEAEYLAVDQVEKLGNEEQALLFSIFNRFRNSGKGFLLLGSEYTPQQLVIREDLRTRMAYCLVYEVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure Of Protein NMB1076 From Neisseria meningitidis. Northeast Structural Genomics Consortium Target MR101B.
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Replication
molecule keywords DnaA-related protein
total genus 31
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2009-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2kjqA01
2QM8A 2OCYC 4MDFA 1MO5A 2VQSA 4JZKA 2AKAB 1NG1A 3QVUA 4MRVA 3RLFA 3DOEA 3QI2A 4HB0A 1AQUA 5DIFA 3NHBA 3KKNA 1HQYE 1L2TA 5CB6A 1VG9B 1M6NA 4JKYA 4RD4A 1ZNZA 3TQFA 2EQBA 5ANRB 4CT5A 1L4YA 3QJYA 4AKIA 3F0TA 3E1SA 4MRSA 4JYBA 1G17A 1P9RA 1YR9A 5IF9A 1UF9A 4TLCA 3VHXA 3K0FB 2D74A 3IILA 4G5RA 3ICEA 3VAAA 3QXXA 1HV8A 1JR6A 2CVHA 5AR1A 1G6HA 1K8RA 5JS8A 1Q1ZA 2WKQA 3RANA 2C5LA 4GSYA 3DMDA 4RFSB 1GAJA 1XZQA 3CRW1 3TVDA 3LFUA 1UKVY 2OM2A 2ZJ5A 2H8KA 3IBYA 4UNRA 2GK7A 4FCTA 1AQYA 1ZW6A 4MYCA 1G1MA 1XDBA 5ELXA 1S4QA 4TL9A 1FUUA 2XXAA 2AHOA 3R9XA 2ZRKA 2AL7A 3B1ZA 1OW3B 2IEZA 3QKRB 1XF9A 3QEJA 3GLHA 3IHWA 1T6NA 1AKEA 4OQMA 1G21E 2VIIA 5SZHB 3I5YA 2GCNA 2ZR9A 3IQXA 4PPQA 3WBKA 3VKGA 3QXCA 2JGNA 1RRFA 2R2AA 4PQFA 1XCGB 2XZOA 1XD8A 2G1KA 3QSYA 1OH6A 1O87A 3AF0A 4WZAE 1PLJA 3X1ZA 2IYLD 4IDNA 1US8B 3KQUA 4S2EA 2F43B 2ZRBA 2DFTA 2FEOA 3DO6A 3FMPB 3LBIA 2B21A 3EIHA 4L8GA 5EXPA 5G53C 5JCPA 4D0LB 3U7FB 3THXA 2R6DA 2Z5FA 2PBRA 3DM9B 5JI3E 1JBKA 4QXAA 4HAUA 1Q21A 3K70D 4QJ3A 4JMPA 2QA5A 1XFAA 1XMJA 4KAXA 5FBWB 5KDLA 2P5TB 2YWHA 3DKVA 4W5JA 4YC7A 2F3TA 1FW6A 2IYUA 2OCBA 2BMDA 3Q85A 4IOJA 2ZE6A 4JBXA 3ONWA 2EYQA 4A0FA 2JIZD 3KJHA 2F1JA 2W0MA 2NO0A 2IXEA 3KTAA 4N3NA 3ZLJA 1AS0A 2QE7A 2PZFA 4C0LA 2DCUA 4RZ2A 1W5TA 2DBYA 4LHWA 1E69A 3A4LA 3CNLA 1JR3A 3K0AB 5FOUA 4MDEA 5JEDA 3QPWA 4ABYA 3QXJA 4HLDA 3VTKA 1AS2A 1WBDA 1G7SA 1MRSA 2V55B 2W58A 1GOTA 2ZUDA 3Q72A 1VHTA 4RCZA 4EUNA 2HXYA 3C7KA 2AD5A 4CEIA 1SVSA 1ZBDA 2NO6A 4PC1A 4LUCA 4HAYA 4Q1CA 1EWQA 5CIQA 1GNPA 3O8CA 4A2PA 1TUIA 2NO9A 3MWJA 5JWHA 2JLZA 3WP1B 2LWIA 2LKDA 1SQ5A 2A2ZA 1M1YE 4BLTA 4O0MA 5BQ5A 1VDZA 2PEYA 2VSOA 2CLSA 5KOYA 2O52A 1TF7A 4G5SA 2N42A 4QBFA 2A30A 1GG2A 3B7GA 3NWJA 1NRJB 5J4VA 1R5NA 2ORVA 3T35A 5JCZA 3TW8B 2AFIE 1OFUX 4F38A 1E9FA 4LZZA 1KO5A 1A5TA 3AVOA 3SE0A 2D7DA 1OIVA 2WMNB 4KLNA 3OE7D 1TEVA 1AIPA 2BKUA 2GXQA 2V4ZA 2ZJOA 2JASA 2F9LA 3A8TA 4PPGA 1CLUA 1JAIA 4J0QA 3SU8A 5K8IA 2A5JA 2VP9A 5DN6A 1E79D 2Q9CA 3LW8A 2XZLA 4TMZA 2MSEB 1TNDA 5CDFA 3SN6A 1FMJA 5P21A 4BFTA 4XWKA 1YZGA 1T91A 2RGGA 2ZRGA 2VPPA 1Q57A 1F2TA 1KY3A 2HF9A 2FSGA 2IUTA 3PV0A 4RJLA 3BH0A 5BYJA 1CU1A 1GIAA 2C95A 3IIMA 4B2IA 3S1AB 4BASA 2H18A 3QE0A 2V8OA 2IC5A 1KZ7B 3MCAA 2IUUA 5SZKB 2JATA 3BH7A 2ODWA 1DO2A 2IHBA 3A58B 3GCGA 4OJKA 3LLMA 2B7BA 3EXAA 2CK3D 2GK6A 3D3QA 2JLWA 3LW7A 1P2SA 2B8WA 3HPRA 3CF0A 3L43A 1J90A 4FCVA 4C0AC 3A6PC 1OV4A 4NTZA 2F1RA 3B1WA 5JWOA 1TPZA 2I1QA 4K81B 2GILA 2CJWB 2SHKA 1S1CA 2VRWA 3B13B 1I4TD 2OHFA 3BWDD 4G5GA 4IW3B 4BLSA 1OB5A 1KNXA 1KIMA 4PO9A 2Q9AA 2ATXA 3B82A 3I8XA 4UKDA 2FGJA 4B3DA 2BM0A 4MQBA 5HKKA 4N0EA 1U8YA 2ZRLA 4FMBB 1XRJA 2KI5A 3V4FA 1NMXA 2QTFA 3P32A 1PVOA 4PAOA 4MRPA 2WJJA 1W4RA 2C04A 3IPYA 4Z8YA 5G3ZA 4C2UA 3CR8A 3K0EA 3MWYW 2DWPA 3FYHA 3NHAA 5JZVA 5FPTA 1XWIA 2Z0MA 5B30A 1W49A 2RB4A 3DDCA 4XIGS 4IXNA 4OHYA 1XCPA 2W2XA 1NNEA 4HUQA 3T34A 4ZIRB 1ZVQA 2Z4SA 1GNQA 2ZROA 1W0KD 1P60A 5G41A 1EFHA 2PZEA 4POAA 2ZUCA 4OHVA 4DCSA 1VMAA 1W36D 3BXZA 2V7QD 4NL4H 4A9AA 4DIDA 1OYWA 1YKSA 2JAQA 3Q8XB 3GLGA 5DI9A 1RIFA 3RYTC 3KQNA 1QDEA 4TMKA 4ZI2A 1XPRA 2QP3A 3K1JA 521PA 1NMZA 2QGNA 5FUWA 5FOXA 2WIAA 1G6OA 3K9LA 4MKHA 3WXMA 1X8LA 2YNMA 4TSFA 3REGA 2AFHE 4ZKEA 2CE2X 1KGDA 2GF9A 5HCNA 2X8AA 3T06B 1NY6A 4OL0A 1NF3A 2OUKA 3FKSA 4PR0A 3K53A 2J0QA 2A7QA 2HLDA 4OQLA 2P67A 4Q9IA 3W3AA 1NSTA 1ODFA 4M1YA 1XBTA 3U2QA 5F9FA 2EFDB 4PANA 4YQFA 4X8LA 2GA8A 4B35A 1KDOA 2DFNA 1F5NA 2BEJA 2J87A 5JSZA 2C2HA 2D7CA 3SDZA 3SNHA 5KUTA 3L8ZA 1SXJA 4I1OA 1CTQA 2WAYA 1ESNA 1TL7C 2AK2A 1VIAA 2FN4A 3MSXA 3WBJA 4BFZA 4E22A 2BWJA 721PA 1CJTC 4ZCIA 3N70A 3K70B 1SHZA 2CCGA 2R6CA 2AXNA 4Q4HA 2P6UA 1EFUA 1KI1A 3BRWD 1BMFD 2RGAA 1NKTA 2QG6A 1TX4B 3KFVA 2O8EA 2R9VA 4B44A 1CRPA 5FTLA 1KMQA 2RGCA 2WSSD 4RFVA 1TAGA 4Q1EA 2IS2A 1IN5A 3MWLA 1P4SA 2WVJA 4M0LA 4XTRA 4DB2A 1UKZA 4O2LA 2A5DA 1F2UB 1CIPA 3MMPA 3OEED 4DLWA 5GVSA 4FD2A 1ZM4A 3QKTA 4KYUA 4C4PA 3WYAA 2Y8EA 4L9WA 4X8MA 3RS3A 3SHWA 4AK9A 4AYWA 2GXAA 5C2JB 3HJNA 3K0CA 4LYHA 4NYMR 1FOEB 3FHCB 1FP6A 1Z2CA 4FMCF 3GD7A 4MA4A 2JLYA 4XJXA 2R6FA 1UJ2A 3VFDA 3K9GA 5DI3A 2CJWA 4PZYA 2O8DA 2J7KA 3QPVA 1RVDA 1FMLA 4BQSA 5JJIA 5BW8A 1L7VC 1OXUA 1UAAA 2OILA 3AB3A 4V0NA 2DFKB 2DYKA 4QHTA 1XMIA 4JS0A 4LHVA 3K9HA 1J70A 2QTHA 2IEYA 2ZAMA 3CWQA 3DEFA 1Z83A 1E9AA 1P2TA 2O0KA 2OLJA 2XB2A 2ONKA 3ETLA 2IW3A 5EE3A 2IXFA 3EX7C 5BN5A 2DR3A 1KSFX 3EPHA 3VU9B 3T15A 2GXSA 4UNPA 2OFOA 1CP2A 3OIWA 3CB4A 3U4QA 1CBUA 4B34A 5IT5A 3WNCA 821PA 1XNJA 4B33A 4IXMA 4DB4A 2WSSA 3X1YA 1M74A 3LV8A 2F43A 2ZJBA 3TW4A 1X1SA 5FOWA 3PJRA 1F60A 4TTQA 3LH5A 1M7BA 4L16A 2WJIA 1G5PA 5J4HA 4M1MA 4Q4AB 1VCIA 1NJFA 1E9BA 1CS4C 2ZRDA 3D31A 2ZU0C 3WMGA 1J7KA 1EK0A 1G4AE 1ESMA 1KK0A 3EARA 4PC7A 3LWNA 5LD2C 1P9WA 3R9IA 2ZU6A 2ERXA 2IS1A 1R0ZA 3THOA 3JZMA 1IONA 3GJ6A 3OESA 1E9CA 3DVLA 2E9SA 1AS3A 3W5IA 3W9YA 3AKEA 4MITA 4BZPA 1SZPA 4LPKA 5C4GB 4HLUA 3TQCA 4N1AA 1GTVA 4NYIQ 3CPEA 5DSZA 2OBLA 3PUYA 1D8TA 1LF5A 1W0JD 3SYKA 3ZJYA 1TTTA 3GJ5A 4Q02A 4Q4LA 4QJ4A 4M8NE 1NVXQ 4ON9A 4Q7LA 2QPTA 2C03A 5D3MA 4QOSA 1RW4A 1HA3A 2GCPA 1ZUIA 1G8FA 5AJVB 2QEQA 1ZIPA 2ODNA 1S0UA 4FIDA 5TV2A 4RD0A 5KHOC 3FGNA 4JIMA 1CRQA 1RPZA 4O3MA 2QSYA 1DADA 2BBOA 2CE7A 1AK2A 2FPLA 2CL6X 1G7RA 4K8OA 3AVTA 1QG2A 4QGGA 1E2MA 1GUAA 2FZLA 4TWZA 2VH5R 1HEIA 3K0CC 3ZGXA 1Z6XA 2ASEA 4I1UA 3I72A 3TBKA 4GP6A 5AJXA 3RS7A 4QHYA 1QVRA 2CNWD 3CM0A 1JAHA 4YMTA 2OV2A 3KX2A 1E96A 3B85A 3IEUA 1T8UA 4LCBA 3VX4A 2GNOA 4UXHA 3CRQA 4P4SB 1EFCA 1ZM3A 1XJQA 2DHRA 1N0UA 4ILEA 4K46A 1N2CE 4DLVA 2BVNA 5CB8A 4Y0AA 3VKWA 1K5GA 2JLQA 2ANBA 3RS0A 1KI3A 2R62A 1AGRA 1XTQA 4KV9A 4C30A 3ZVLA 3C8UA 5GJVC 4D81A 3AF4A 4NHOA 1GDDA 2X2EA 3C14C 3KQKA 1YRAA 1V43A 3WHLA 1S9HA 2ONJA 3CRVA 5H8WA 1COWA 2Q9BA 5KSZA 1R5BA 1OLOA 1W2GA 2VF8A 1N6KA 1EGAA 2HYDA 2P0EA 2W0SA 3QNUA 4LDJA 4LJ5A 4NBSA 3OFND 2ZYVX 1AJEA 3BE4A 4NPHA 5KSOA 2E87A 2GDJA 3NIBA 3CR7A 4JJZA 4FWIB 1DE0A 5FTMA 4KBGA 2HJVA 1HE8B 2C8VA 3EZ9A 3PUZA 1IHUA 1UKEA 3BFVA 3MJHA 1X8KA 5EUQB 4LC1A 2OESA 3AKCA 2UKDA 3NDPA 1XX6A 2GZHA 4W7SA 3PFIA 1TU3A 5FH9A 2CEAA 4HAXA 1QZXA 1KHTA 4ARZB 2ZIAA 4B3GA 3RC3A 2ZJAA 3B9PA 3U61B 1BO6A 2HXSA 2PLFA 4XVUA 2GCOB 2VBCA 4LWZA 1E1QD 4H1VA 4OI1A 1T3LA 1YZKA 3A1VA 1E0SA 1T4GA 1XPUA 1XEXB 3NC0C 5E7IA 4IEIA 2W00A 3TE6A 4PSKA 3D8BA 5CLLA 5KPDA 2VYFA 1ZD9A 4ESHA 3TSWA 1ZU4A 3CONA 5DNYB 1Z29A 4DKXA 4OBEA 5EJEA 3KL4A 3E70C 4BE7B 3U44B 1VCNA 3K0FA 4Q9LA 1U0JA 4CRWB 1R6BX 3L0IB 1CXZA 2V1XA 3WNDA 1GM5A 3DZDA 1G41A 3HWSA 3H1TA 4TL6A 1FL9A 1IXRC 4JYCA 1IN7A 4QKQA 4GZMA 5CJPA 2QI9C 2W6IA 3O47A 4OHXA 3PEUA 1E1QA 4PSAA 5L3QB 4EQ6A 3QG1A 2CHGA 3DPUA 3B6EA 2BIFA 2OFWA 3Q9LA 1OFIA 1P72A 3L82B 1U94A 5FTKA 4XSGA 1HT1E 4QGFA 3CIOA 1I2MA 2XTNA 2H1LA 1NIPA 3JVUA 3LO5A 2O8BB 1KOFA 5K8LA 4DBLC 4FI3C 1R10A 4LBWA 3CW2A 4C9BA 3VMFA 4DEXA 4V02A 4L15A 2RHMA 3OEHD 1N6HA 1RYHA 3GJ7A 2RGBA 1BYUA 1J99A 1K6MA 3CPHA 4ZDKA 4HAZA 3TRFA 2QMEA 2JDID 1KK2A 1BS1A 2QRNA 1UEJA 2PX3A 1GVNB 3D7MA 3TMKA 3U7EB 4AKGA 1W44A 5LBIA 1KI4A 4HB3A 1MABB 3BS4A 3MUFA 1E0AA 4MYHA 3BOSA 4WZ6A 3H0KA 1SVMA 2GJ9A 3HR7A 4TMXA 3UXMA 4CVNA 3ZIAD 2G88A 1SVWA 1E32A 1JR3D 3GEIA 3NDBB 4AURA 2XITA 1TEXA 3TJZA 4Z51A 1E2GA 3ZDQA 1FQJA 1X8JA 2BDTA 2VHJA 3RRYA 4C7OA 2BKEA 3BFXA 4CIDA 1W47A 3R8FA 2VLIA 1KSGA 4YDSA 1FQKA 1Z06A 2ZI6A 4HSEA 4BFXA 1DAKA 3AM1A 3KB1A 2XSZA 4DCUA 1E1RA 2GRJA 3LNCA 4RY2A 1T3HA 2VP5A 2ZR0A 1G3RA 3U6KA 4CEHA 4NP6A 4Q9KA 5DLQC 3M4YA 1U9IA 3EWSA 2XNDD 2B6HA 4CW7A 4JSYA 5BYKA 1RRCA 2ZEJA 2NPFA 4FCWA 2AR7A 4DT1B 4P4TA 4TYYA 1IN6A 1Q1QA 1OE0A 5HPYB 3RNLA 4TTPA 4Q7KA 2ZSEA 1CULC 3PUXA 5AUPB 5KTYA 1KDPA 1E3MA 3QEOA 4QM7A 1XD2B 2EU8A 3K8YA 1CJKC 3BB1A 4JLKA 5CM9C 4XD7D 3UKDA 4BLOA 2CL0X 2BCJQ 3DHWC 3JZAA 1AZTA 4II7A 1UBFA 1XXHE 2BEKA 5GVRA 1SKQA 2F55A 1WA5A 5FPSA 3PUWA 1GL6A 1MT0A 3FFAA 1CR4A 1R0XA 3PITA 2GESA 4G5QA 4NCIA 1R5OA 2GVDC 3NXSA 1YR6A 1N0VC 1Q3HA 3T12A 2J0UA 3ZQJA 2RKOA 1EX6A 3Q3JB 2J0UB 3EIEA 4TMVA 3VU9A 1NG9A 4A92A 2OAQ1 4U02A 3GLIA 4D0GA 1AKYA 2GJAA 4DRZA 3ADBA 2J7PA 1SGWA 1TF2A 2IS6A 4ZV4A 1DVRA 1E2FA 3E5HA 1Z0JA 1X3SA 2A5FA 4WA7A 5CK5A 4NCKA 1OXXK 4LI0A 3RRMA 4ERNA 5EZ5A 4TSFD 1PLLA 1XTSA 4PHFA 2AX4A 4B73A 1D2NA 3X1WA 3NH9A 2IA5A 4JLJA 2F6RA 5TXGA 3T61A 1LS1A 4ARZA 4WBSA 2CMKA 4B43A 1TU4A 4PC6A 2EW1A 4GOJA 2V7QA 4CDGA 4DDTA 2HT1A 1X1RA 1G3IA 2GAOA 2P2LA 4Q1DA 4YXWD 1DAIA 1X86B 1OJLA 2ZRAA 3WMFA 3THWB 4TT3D 1W0KA 2XOKA 2WWXA 3ASZA 3Q7PA 4C0SA 1XTIA 3PG5A 1WMSA 2IWRA 5E7MA 1HYQA 2WV9A 3S1AA 5AWFC 4I1VA 4TQ9A 1DAGA 2CCJA 4M1OA 1NP6A 2QSZA 5GADl 5FPKA 1KI6B 2CLCX 1R7RA 1VTKA 3FVQA 1G8GA 4DSTA 2ZSDA 2BBTA 4C0KA 4IDHA 3AV0B 4Z1MD 1KK1A 3B2EA 3GLIB 1DBSA 3T1TA 4DT1A 3K0SA 1KZGB 2BMJA 1OHHA 4A6XA 1RYFA 3GLGB 2ZRMA 4RD1A 1Z5ZA 4XD7A 1XTRA 1E9SA 2F9MA 2W2TA 4IOLA 1GL9B 3PXGA 3IQWA 1G9XA 1E2EA 5EE1A 1QHNA 5J4LA 4TLAA 5L3VA 1RZ3A 1Z0FA 4TLBA 2Q3FA 5BXQC 1QHYA 1E9RA 1IJFA 1Z07A 2BOVA 2GJ8A 4QRHA 4URVR 2EWVA 4WZBE 3CNOA 4LJ8A 4P0TA 2PX0A 3M0EA 2XNDA 3O8RA 3OEEA 2VHUA 1N6PA 2QUZA 1DS6A 1W7AA 2J45A 4U00A 2WOOA 4M1SA 4C3ZA 1KKMA 4LYAA 1JQJC 2VEDA 1W46A 5CM8B 3VNVA 3GJ3A 3T1OA 3VR4A 4JKIA 1P2VA 1DELA 1JJ7A 1GL7A 1I4DD 1KJWA 3IUYA 4IKEA 3WY9A 1NY5A 4F93B 4JBYA 2J9RA 3SJZA 1KO1A 3LXRA 3EC1A 4EAQA 5JRZA 1FZQA 2QMHA 1SXJD 1CKEA 1W2HA 2IYXA 3CX6A 3NEJA 2TMKA 4NZYA 3L8YA 3DZ8A 2O5VA 3X1DA 1EX7A 1P2UA 2VP2A 5FPYA 2EFGA 4Q4HB 3CO5A 2F7SA 3IGFA 4MRNA 4RFSA 4Q7JB 3CX8A 4C7OB 2DWOA 3BB3A 4RZ3A 4A8JA 4RD2A 3BORA 4C2TA 1OH5A 2IT1A 1OIXA 4PPNA 1KMHB 3WHKA 3KJEA 2QTVB 4G1UC 2A78A 2MMCA 2IX3A 2PLRA 1CR1A 5F3WB 2RCNA 3A1TA 1JEEA 3CKLA 2NO1A 2P5SA 3ZVRA 4E07A 1RFLA 3CRMA 2WIBA 2QAGA 4JLBA 5DISB 3WYGA 1BKDR 5FOSA 5HE8A 5D3MB 4DWJA 3U6BA 1UBGA 2C99A 2FH5B 3VQTA 3A1SA 3AVUA 1DAMA 4P3YA 1E4VA 3EPJA 4EKDA 1A4RA 1YR7A 3LDAA 4RKEA 1G16A 3IO5A 2KB0A 1MABA 2WWFA 5CYOA 4DLTA 2J7PD 3RDPA 4WAUA 1XZPA 1YHNA 4M22A 5HCIA 3EZFA 2NG1A 4KXFB 3KXIA 1COWD 4IJMA 1Y63A 2XAUA 2D2FA 3CZQA 5H70A 1RJ9B 1RKBA 2GXUA 4ACBA 4LOAA 2QP4A 1NBMA 4LJAA 2IS4A 3ZS9A 2IYRA 2CHVA 1JALA 2UVQA 4KVAA 4LHYA 5DO9A 1PV4A 4V03A 4BFVA 1ETUA 2NQ2C 2KSQA 3LXXA 1KI8A 1UEIA 4PO1A 1ZCBA 1UPTA 1GZSA 3AVXA 3QF4A 4XSHA 1KI7A 2FV8A 1E2JA 3PVSA 4URWR 2W6JD 3G5UA 4TYPA 1Z22A 3E2IA 5J5CA 2C9CA 3BBPA 2ZVQX 4S35A 4AI6A 3LY5A 2AWOA 2PJZA 4JT4A 4BLPA 2QAGB 2CNWA 4DLYA 4G01B 2QAJA 2IYQA 3R8CA 2WKRA 4B3CA 4TZ0A 3N2IA 1LFDB 5JFGA 1WB9A 4Q7MB 3SHFA 2AK3A 2I3BA 4US1R 4CGZA 1GITA 5L3QA 1CR0A 2GVZC 5AJYA 2HJGA 2OXRA 1DEKA 4BZXA 3W8RA 6Q21A 4PC2A 5FBQB 4P33A 3OFNA 1QBKC 5SZJA 3GLFE 3U5ZB 3GLHE 4WOPA 5B64A 5A0FA 3I8SA 1BIFA 2P6NA 1NL3A 1ZNYA 5E4FA 3MRSA 1T3SA 2PZGA 4EFNA 3GP8A 2WOJA 1QHXA 1MKYA 4LBZA 3HYTA 2G1JA 3VKHA 2CBZA 2J0SA 4LV6A 2ZE5A 3DL0A 2WJVA 3QENA 3UWOA 4DZZA 4TYWA 2ZSBA 2C96A 3VR2A 1Z0AA 4DHEA 3UG7A 2O8CB 1E79A 2AD1A 1GKUB 2QN6A 3C5HA 4JSTA 2GJKA 1N0WA 3ZYCA 1ZMXA 4QBIA 2Q3HA 3TSZA 3IPXA 2ZSFA 5FBLB 4D0NA 1Z28A 1NSFA 4WVFA 1LV7A 5HKKD 2RGNC 4RD3A 4EPXA 1DAFA 2GZAA 3T1VA 4B2LA 2OXCA 4O25A 4Q4AA 1H8HD 2B92A 2VP6A 1D2MA 2QAGC 2OCAA 1YZNA 1CJVC 1VHLA 1Z2AA 4OQNA 1VCMA 4Q9HA 1RE0A 4GL2A 2IL1A 4LJ9A 3KQHA 4Q9JA 1FP7A 4JL8A 4B3XA 4LV8B 4AYXA 4F4IA 5J4KA 4TMWA 1GILA 2LCFA 1N6LA 4EPVA 1NJGA 3AF3A 4E09A 3ZS8A 1E9DA 3NKVA 4HI0E 3KKPA 1FPMA 3K70C 3QF4B 1HTWA 3SYLA 4GOKA 3HU1A 1GRRA 3HPQA 4IDPA 5DHAA 1U8AA 2GWHA 1ZAKA 1IN4A 2ODBA 5JLJA 1D9XA 4CEJB 3CF2A 1OFHA 4DLSA 2QBYB 2ANCA 2C9OA 1JEDA 1NLYA 2F1IA 5FTNA 3BERA 3C5CA 1SVKA 3EA0A 1U99A 3QVVA 4GOXA 2FFQA 1DO0A 1PLKA 4HLUC 5JECA 4M9XA 3CWZA 3U7GA 4A15A 4TYQA 1YZUA 2VL7A 3OAAD 3SFVA 2RMKA 3A37A 3HYRA 3L0OA 3OF5A 2FFBA 2NOAA 1Z08A 4EFLA 1IY0A 1XEFA 4QFMA 1H8EA 3THYB 1Q1EA 3CPJB 5FOVA 2QE7D 4DUGD 2ZRNA 3LLUA 1GRNA 5L3SB 3W3ZB 4DSUA 1R0WA 1OXVA 5HZHA 2JIZA 3B1YA 5EE0A 5CITA 2H7VA 2PT5A 5IHPA 3K0AA 1Z0IA 4LRWA 4KFTA 4HDQB 3AQ4A 5IK2D 4UNQA 3P26A 1GRQA 4R9UC 5FUYA 5KNCA 4OQFA 1TF5A 3ND8A 3GMTA 1SKYE 2PCLA 3I3SR 4P4SA 4PTLA 4OHZA 2OLKA 4D4JA 3C4JA 3P20A 5TDHA 2PEZA 1ZC3A 3C16C 2XNSA 2QMUA 3JVVA 1E2IA 2ZREA 3ADDA 3U3JA 1JECA 2IYZA 1KNQA 1OT3A 1NMYA 2WJYA 2AXPA 1KSJA 3AUXA 4IRUB 4V0KA 3U3MA 3VR3A 2X2FA 4AG5A 4X8OA 1CJMA 2XJ9A 2I1VB 2EVWX 4HAVA 1YR8A 2YKGA 4KVGA 1WCV1 3AUYA 2NTYC 4M1WA 1LY1A 3MLEA 2DB3A 1XP8A 2QPAA 1O3YA 4GT1A 4LY6A 1KMHA 1SULA 4M9SA 4B32A 2XEXA 4RVCA 4G5OA 1VYVA 2ZRFA 4YONB 4XH9B 1T8TA 2ZI9A 1XD2A 2D2EA 4Q21A 3NBZC 3ICQB 4U5XA 1SXJC 2WSMA 4BEBA 3IIKA 4PQYA 2FPMA 3KQLA 1OH7A 3B78A 3QKRA 2O8BA 5KSPA 4JLMA 1AGPA 1J8YF 1ZU5A 4BEJA 1YQTA 1N6RA 2ZJ8A 4HDOB 4EJSC 4HUTA 1X6VA 2FJUA 1UFQA 1Z6AA 3TLXA 5FR1A 1Q3TA 2YWEA 2WHXA 1XU4A 3EZ7A 3GLFB 2NGRA 1ZD1A 4CT4B 4MUBA 4ZPXA 2REOA 3NBFA 1OKKD 2UZ3A 4NYIR 4BFYA 1OSNA 4FWTA 2AKYA 2FEMA 1DARA 2WWHA 5LPNA 3TUIC 1NVUQ 2YYZA 2VF7A 3FB4A 4PC3A 2DPXA 1ZP6A 4BWYA 3WP0A 3A36A 1SXJB 2IYVA 4GNKA 1P61B 2ZTSA 1NI3A 2R44A 3QKSA 3U44A 1S3GA 4Q47A 5JEEA 3BB4A 1VYTA 1QHHA 3C41J 2D62A 4IFEA 1XTKA 2OBMA 3PIRA 3GJ8A 5B2ZA 4ZDJA 3A4MA 2ZAOA 3KKMA 4M2LA 1QF9A 2YV5A 1G20E 3LBNA 4DLXA 4DVGA 3ZVMA 2P3SA 3QOFA 4LYJA 2HUPA 3UANA 3LVRE 4D4MA 2XGJA 2WJHA 4DC9A 3FMIA 3PEWA 4AC9A 3ZQ6A 4B71A 1N5IA 3TGPA 1LS6A 5H1YA 4Z8XA 3RC8A 1XXHB 3MJRA 3FMFA 3KZ1E 4KU4A 4ZCLA 4QGHA 4QHSA 4MKGA 3P4YA 5EE5B 2ZRHA 2VHQA 2NO7A 4TN1A 221PA 4MRRA 5TVKA 3FKSD 3SOPA 1DG1G 3OHMA 4ZDIA 5JJLA 4OKSA 2REBA 1XCMA 2GBLC 2JLXA 2X1VA 3TSOA 3UMFA 5L8VA 5E7JA 3Q5EA 1WDTA 2PL3A 5BN4A 1W36B 3U3OA 1JXMA 1E2HA 4MKFA 4PSVA 5FL3A 1ZC4A 1M2OB 4TTRA 1ZNWA 2CDNA 4DCNA 3R7WA 1E2QA 4URZR 3B1XA 2JJ1D 3TR0A 1Q0UA 1Z47A 1WF3A 3C15C 3I92A 2WPDA 1FX0A 4LGMA 2QORA 4KSBA 5TB5A 1MH1A 3UPUA 4IVPA 3ASYA 1UDXA 3U3RA 3AGPA 2FE4A 4KJZA 2QNRA 3SFZA 4CF7A 1OH8A 3EPKA 4HZUB 1T5LA 1EFRA 1E2LA 4OYHA 4B75A 3PR1A 3NG1A 2GTPA 4A0GA 4LHXA 1W1WA 3AP3A 5A5GA 5KDOA 1S96A 3CLVA 2DWQA 1KDTA 1CJUC 2V54A 1G3QA 2I4IA 2O0HA 2VP0A 3KKOA 4HB4A 4DSNA 1U90A 4JLAA 5L3SA 3HU3A 5DGXA 4NCNA 3RWOA 4I1SA 4QGAA 4EPRA 2QZ4A 2YWFA 3BGWA 5KNBA 4KFUA 4JLVA 3NH6A 1G7CA 1T5IA 4M53A 5IK2A 2KJQA 2ZRPA 4JLNA 3D6TB 3SQWA 2PJRA 1L4UA 1P3JA 2ZJ2A 3H84A 3QUSA 1N5KA 2L0XA 4BRUA 4D82A 2WJGA 1U9IC 1XB2A 1KO8A 4JVNA 2VHCA 1QVAA 2EFEB 2IHYA 1YZLA 3AF2A 2R65A 5AUQA 1D9ZA 1C9KA 1IQPA 2N1BA 3CNNA 3QF7A 1TQ6A 2FX3A 4V0LA 2ZM5A 3MG9A 4JLDA 1B23P 2HCBA 5DYIA 4UJ3A 3FWYA 4Q1FA 3HU2A 5DE3A 5EXTA 1DAHA 5G40A 1KKLA 2EFCB 3QPUA 3AH8A 4P32A 2B7CA 1PUJA 2FG5A 4Q1BA 3CBQA 4OI2A 2ZI3A 1F2TB 5KPJA 2ZVPX 4TL8A 4QBHA 3LQRA 5CYPA 5JBQA 4DJTA 1LW7A 4E03A 3MGCA 4B6FA 4PHGA 4JT2A 4JVSB 3KFXA 1CR2A 3RS2A 1GWNA 5FOTA 1M7GA 2J1LA 1IXSB 2FZ4A 3KJIA 4LJ7A 3CF6R 4DEYA 5IRCD 1I2DA 2QM7A 4R71A 1SXJE 1W4BA 4OK3A 1U81A 2Q6TA 2WWIA 3MD0A 1U8ZA 3EZ2A 3RRZA 3CUEF 3KB2A 2ZRJA 3Q5DA 1D2EA 2JLVA 1EG7A 2QPOA 3KXKA 5G3YA 5CIWA 5JHGB 1E9EA 1H8HA 3QXHA 1XXHA 1ZUNB 2JLSA 2Z6VA 1MO6A 3FFBA 3ZD7A 2ZUBA 2BJVA 3WRYC 3TAUA 2YJTD 4LBYA 1VYUA 4GFDA 4RSGA 3THXB 2OG2A 2V3CC 4OK5A 3UMRA 1P75A 5AJWA 4IVRA 4D25A 1R0YA 5JMTA 1OHHD 3HR8A 1A82A 4JL5A 1VG1A 1ZD8A 3SJAA 4AIIA 4JVLA 1TQ4A 1YJ5A 2CVFA 2Q0HA 4F92B 3QKUA 4DLUA 3VR5A 2QU8A 5HTKA 3KTAB 1Z3IX 2BV3A 4ZDWA 1ELOA 2GF0A 5LDDC 4TYNA 1JQLB 3Q7QA 2FDCA 4LJ4A 2ODEA 4PFSA 4UXIA 1U0LA 3L0SA 1JXOA 3H86A 1II0A 1LF0A 2EWWA 2QT1A 1OPXA 4GZLA 1XPOA 3L2OB 2WPDD 3TH5A 5M04A 2ERYA 2XOKD 8OHMA 3ZD6A 3K09C 4MKIA 3OZXA 5HR5A 2G77B 2UZIR 4R2IA 2ZXUA 3LQQA 5CLQA 2GETA 3UK6A 3F5FA 4NYMQ 2VHTA 5SZIA 3H4MA 4LJ6A 1G3MA 2BBWA 2IWHA 2O8CA 5DYGA 1N6OA 4X8HA 4XTCS 1JPNA 4DIEA 1N6NA 3BFKA 3K9NA 4ITRC 1G8PA 2WMOB 4OI4A 4CEIB 1MV5A 1Q22A 3ECCA 1M8PA 3I4LA 1W48A 1T0HB 2ECKA 4IVQA 1SVOA 2BC9A 5AJZA 2J46A 4LV5B 3KDSE 4JL6A 4EPWA 2HDNB 1KAGA 2HCJB 5F98A 2CK3A 4QM6A 1E98A 1Z0KA 4TQAA 3L0PA 4GDFA 1G8YA 1SKYB 1QHIA 2A5YB 2ZYWX 3FPAA 4Q19A 3AVYA 2FOLA 1QG4A 1FUKA 5EQTA 2D4HA 4PHHA 1FTSA 4BGDA 4P31A 4FW9A 2IYWA 1XJCA 2J41A 5FR2A 4EDHA 2GJSA 3W6NA 4D80A 4MH0R 4QJ5A 2XTMA 1VKJA 4NMMA 2W6JA 3QQ5A 4MGKR 3ZZ0A 4KFRA 2MSCB 3GFOA 2JLUA 1G18A 4V0OA 4FINA 1DPFA 4QNRA 4V0ME 3B5JA 3RS4A 2H92A 1UM8A 2HT6A 2XX3A 2OCPA 2ZITA 1Q20A 1ZM7A 1NN1A 1ANKA 2WTUA 4QG7A 4NKRA 5DN6D 1NBMD 2IYSA 3AGQA 1KYIA 4OJQA 1P7CA 4I81A 3FMOB 5B58C 4C0JA 2REXB 2W2VA 2ZANA 4Q4JA 4AYTA 5CJ2A 1KK3A 4CZ2A 2GBLA 1EXMA 3OE7A 5CK4A 1WBBA 5C18A 3CH5A 2Q3MA 4OK6A 2VO1A 3W5JA 3SR0A 1XJ0A 4A2WA 3LX5A 4BPBA 4C0QC 2BMEA 3RHFA 1IXZA 3TVTA 5AUOB 2PH1A 1F2UA 1UADA 1OKKA 3WNBA 5FL7D 3THYA 3ZZTA 3IKJA 4CYMA 4OI0A 1RRGA 5E95A 4GRAA 5KO2A 1QHHB 4DDUA 1NBME 4HB2A 5EP1A 4YMUA 2P6RA 3GFPA 4BFWA 5EP4A 1II8A 1H65A 3I32A 2ZPTX 3EWAA 1QHGA 1E2DA 2VSFA 2BM1A 5LB2A 4Q00A 1MO3A 2OSBA 2FU5C 2AWNA 5EUMA 4A8JC 3GJ4A 1XTJA 3EPLA 4NYJR 1ZIOA 4MGZR 1PZNA 4PAQA 1IBRA 5JJKA 2CL7X 1U2RA 4TQUS 1OXTA 3M6AA 3QIAA 1OFTA 1NN3A 2XZPA 3KUCA 4AKEA 1Q1BA 4GP7A 3OAAA 4XVQA 2XTZA 3GEEA 4TMTA 1KAOA 1Q12A 1Z6TA 1HT2E 1Y3AA 2BCGY 2Z43A 3R20A 3DM5A 3I62A 2H57A 4HLCA 3T1QA 3PCRB 1Z0DA 2JDIA 2CXXA 4AKHA 1E2KA 2O8EB 3FTQA 3HP1A 3DKPA 1YZQA 1PUIA 4V0MA 2BBSA 2NPIA 2ZYTX 4Z54A 4EQ6B 3B9QA 3OEHA 3UMSA 1RC8A 4PXAA 5DH9A 3U4QB 1KI2A 4HYYA 1U98A 1OF1A 4Q03A 5FFMA 5LB4A 1JPJA 2IYYA 4ZCMA 1NVWQ 2ZSAA 1LTQA 4W9MC 1KSHA 2QBYA 1EWRA 1G5RA 4CEJA 2ZYUX 1N5LA 2VA8A 3RWMB 3SZRA 1T0JB 1VCOA 2Q21A 1JR3E 2RAPA 3AKDA 2WZQA 1KJYA 2D3WA 4WXRA 5EZ6B 3DMNA 1P9NA 2YVUA 4G0NA 4PX9A 4BZQA 1KI9A 2GKSA 2WAXA 2MMGA 2YOGA 3SI7A 2ZI5A 2ZJZA 4FMDB 2IXGA 4US2R 2N46A 2GAAA 3AF1A 3EW9A 4YLGA 3P27A 4N0DA 1BOFA 4M1TA 1H8ED 5EP2A 1ZYUA 2D06A 4M21A 4EPYA 4B3FX 3V4RA 3IIJA 1GKIA 1WQ1R 2QROA 4FN5A 4KFSA 3GLGE 1GFIA 2NZ8A 4FMDF 1NVVR 1IM2A 2OT3B 1C4OA 3MFYA 4KBFA 4PZZA 4I4LA 2HYIC 2FWRA 3IDQA 1JJVA 1RJ9A 4GMDA 1E2PA 2FMXA 1GP2A 1TMKA 3GJXC 1WRBA 4YXWA 1R4AA 1XEWY 2GEUA 2JA1A 5L3RA 3PEYA 3O8DA 1GNRA 3F3YA 3RSLA 3N2EA 2VP4A 1NIJA 3A1UA 3GLIE 1JB1A 4RCYA 1J8MF 2HLDD 4XWOA 2JCSA 2WWGA 1N3BA 3A1WA 1LNZA 5KU1A 2JJ2A 1IY1A 3IBGA 4AD8A 2IF2A 1KI6A 2LKCA 4B6EA 3SJBA 3P1JA 5FBVB 1LVGA 3FHTA 4EJSB 2CCKA 4NU0A 3RRNA 2WWYA 4MGIR 3VR1A 3W8NA 1FNNA 2V9PA 3PUVA 4IHQA 4B3BA 4BLQA 4PO8A 4DCTA 1R2QA 5KNDA 2OFXA 5D3QA 1D6JA 4Q4JB 3LD9A 1E0JA 3QY0A 5F2EA 3SBDA 3TR5A 1YRBA 3ADCA 3EC2A 1NN0A 3LAWA 1VG8A 1G4UR 3W6OA 3FOZA 1CEEA 2HV8A 5J40A 1MOZA 1IAQA 3DOFA 4OHWA 4M4SA 4AWXA 1SVIA 4YDHB 4BRWA 3ZVNA 2ATVA 1IN8A 3PENA 3WRXC 4WIAA 1G8HA 3BIFA 621PA 2BMFA 2OZEA 1HURA 121PA 1YZTA 3I1FA 4HUQB 4EFMA 4F7WA 3G82C 4NONA 4ZKDA 4NCJA 4F91B 1UDWA 1AM4D 1VIYA 2IYTA 3B1VA 2YOHA 3I61A 5DHFA 4UXJA 4KCGA 3RSOA 2ZQ5A 1HUQA 2NMVA 2F1HA 1SHKA 3T5GA 3KJGA 2C98A 3CZPA 1Q44A 4F4CA 1A1VA 4US0R 2RH5A 2FFHA 2WICA 2R8RA 4BUJA 3SEAA 2NIPA 1G3UA 2WWWA 2XXAB 1UBCA 2ORWA 1Z8FA 2OBNA 3PEVA 3CH4B 2H17A 2JJ2D 5AUNB 2E1RA 4G3XA 4DSOA 3P4XA 3AVQA 4KSCA 2YWGA 1AZSC 3FE2A 4AG6A 3QXSA 4ASUA 3G0HA 1F48A 1TQDA 3BC1A 1ZINA 3I73A 2C9YA 4ZO4A 2ZRCA 2G9NA 2NZJA 2RHDA 4URYR 4F4JA 1BH2A 3RS5A 4KHZA 3THWA 1A2KC 4GI7A 1W0JA 3TUZC 3AP1A 1W36C 1K5DA 1IY2A 4O2RA 4LBVA 3UWKA 1IJEA 4IEEA 1IOZA 5FTJA 5JS7A 4PAMA 3AVWA 1WE2A 4PZLA 3MWKA 5GJCA 1M7HA 3NBXX 1C1YA 4EPTA 4M9ZA 1YVDA 1QHSA 2OE2A 4YMVA 3AEZA 3SYNA 5GJWC 2A3RA 3NTUA 3AP2A 4YMSA 5TMPA 2KBEA 1RRPA 1E99A 2F3RA 2RGNA 2WKPA 4NE2A 5HZKA 2CHQA 3VHLB 2R6AA 1KY2A 1L8QA 4R7ZA 4WW0A 1AN0A 3W6PA 3UIEA 1J2JA 1FNMA 2QGZA 3GEHA 2FF7A 5FI0B 3SS8A 3N5CA 2ZE8A 4OQXA 1G291 4WXPA 2QQEA 4IOMA 4PPFA 4TLDA 3BH6A 2IBMA 5FL7A 3NC1C 1JI0A 4HZIA 4NCHA 1FFHA 4KODA 1P5ZB 4JLPA 2ZETA 4DUGA 2BJWA 421PA 4AY2A 1FTNA 3GJ0A 4IFBA 4URUR 5CDFE 4LPSA 3TK1A 4B76A 2W6ID 4JBWA 2J0VA 2C78A 4U7DA 3VX3A 4LYFA 5EE9A 1ZNXA 2FPKA 2ZI4A 2ZJYA 5HE9A 1HY3A 1EESA 3TKLA 2OO7A 1US8A 2IK8A 2QP9X 2DY1A 2FSFA 3SBEA 2YOFA 4W5HA 2Z83A 2KBFA 2GHIA 2C77A 1T9HA 1ZCAA 1TADA 4LSGA 2YZ2A 3VNUA 2X19A 3GLHB 3LRPA 4IOKA 2FNAA 4RZUA 3W90A 3GFTA 1GKYA 3X2SA 4A1FA 2QRZA 4B74A 4FXPA 4MGYR 3J81k 3KXLA 1OB2A 1TQ2A 5GJBA 1W4AA 3MAAC 4GBMA 5JWRA 4MUAA 2IF0A 2QMOA 1Z6GA 3PQCA 5EXSA 5J47A 1S3SA 2MSDB 1OXSC 2O8FA 1G7TA 5E3HA 4D6PA 1S2MA 4UQOA 2JJ1A 4XVRA 2QT0A 1F3OA 1ZM9A 4I99A 2HEIA 2Z4RA 4KYIB 2G6BA 4Q48A 4HEJA 3BJIC 1OIWA 4URXR 5B57C 4A36A 1R8SA 1SVLA 4ZIRA 1DOAA 1E2NA 1LB1B 4KI0A 2RGEA 3RAPR 4TL7A 3T5DA 4GMXA 4YMWA 1N25A 3F8TA 1Z6YA 4XOIA 5EXXA 2ZS9A 1BMFA 1WXQA 3GLFA 4EIWA 3AVVA 4A0RA 4TLEA 2DFLA 2JLRA 3FKQA 3M1IA 2OEPA 2FFAA 3W34A 3WMEA 5J4YA 1KTVA 1ZM2A 2QQ0A 3U60B 1D5CA 1S9DA 4DLRA 2EFHB 2ZS7A 2VTKA 3EIQA 3NBYC 1G19A 4UNNA 4R98A 2V6IA 1Z63A 4Z1MA 3AKYA 2J3EA 1KDRA 4NYJQ 4LHZA 2R6GA 5FBRB 1II8B 2GEVA 4QC2A 4R2HA 3KUDA 1B0UA 4D2IA 2YINC 5K8UA 5LD2B 1W5SA 2RGDA 1HE1C 3TIFA 2AN9A 2ZS8A 2K5UA 1A2BA 2A5GA 4FMCB 4HLQB 3EZ6A 1GSIA 4HAWA 3AVPA 4L4UA 1NVVQ 3EG5A 4IDQA 5FPHA 2WM9B 4TT3A 1XD9A 2GZDA 3TAHA 1XEWX 3O8BA 2QENA 1G5TA 1QRAA 2O0JA 1P62B 5JSZB 4RD6A 5H68A 2YHSA 4DDVA 5JI2E 4M1KA 4Q1AA 5TARA 3RVBA 1I4LD 2FSHA 2XB4A 2CLDX 2W83A 3KKQA 2ZI7A 1S8FA 4H1UA 3X1XA 4LK2A 1DTSA 2YC4C 1F6BA 3BD9A 1MO4A 1DG3A 4ASUD 3RABA 2J5XA 3SJCA 4PHTA 3IEVA 1PJRA 3V00A 4B47A 3IO3A 2RGXA 4BLRA 2JJ8A 2G83A 4DDWA 2KE5A 4UNSA 2WBLC 4A8JB 1G64A 4NH0A 1E1RD 1XMSA 4HATA 1BYIA 2PCJA 3NVAA 2KWIA 2V1UA 1NLFA 1P73A 4A4DA 2O8FB 5UKDA 3FHOA 2B8TA 3B8HA 3V9PA 5BWMA 4KITB 5KSYA 1E94E 3R7WB 3CX7A 1R8QA 1VECA 2P65A 5KYKA 2FSIA 3TUJC 4CEHB 1ZRHA 1ZUHA 4KO8A 4QBGB 1VPLA 1VG0B 3IHLA 4Q66C 4B48A 4BECA 5EP3A 1AA9A 4QNMA 4NDZA 2X77A 3SQXA 1NLZA 4MYUA 4ESVA 4W5WA 2XJ4A 4IDOA 2O8DB 4JLOA 4HZUA 1XEXA 3ZH9B 4HDCA 4PQRA 4Q01A 2G0NA 2VSXA 3R9WA 1EFTA 3QKSB 3H2YA 1U0HC 3VR6A 3EA5A 3REFA 1II9A 3LA6A 4GPTA 4Y0VA 3A4NA 4DCVA 4EJSA 1KO4A 1UBEA 4BFUA 2J59A 3CRRA 5C4MA 3B60A 4E5UA 4M9QA 2ZE7A 2QL6A 4JVMA 1YE8A 3EAQA 4DXAA 3GQBA 1ONBA 1JNYA 3I5XA 2OAP1 4RZXA 2XSZD 5F9HA 1CF4A 4H9GA 2EYUA 5FI1B 4Q5IA 5C1BA 3ND9A 1OYYA 5BN3A 1KJZA 1WP9A 4L9SA 1S1MA 5JRJA 3QBTA 4QL3A 1N6IA 3BK7A 5TY0A 3OIUA 2ORIA 1M34E 2YC2C 1EFRD 1MRNA 4C0HA 3ZZUA 1E6CA 1HH4A 2BHRA 1NKSA 4UJ5A 3ZIAA 3EASA 4A82A 1W4CA 1A7JA 3QBVA 2H16A 3TNFA 4A6PA 3U7HB 2FGKA 2PMDA 3GPLA 3HDTA 3ADKA 1P6XA 4C0BA 4MYTA 4D26A 3UATA 2ZR7A 2GEDA 2V6JA 5JHHB 4P4UA 5AK0A 3FDIA 4LC0A 2HF8A 4LJYA 1HQCA 1UKYA 3LBHA 3NEYA 4DLZA 3U3KA 3OIVA 1N5JA 4ACAA 3SC3A 4XWAA 1DAEA 1FX0B 1YU9A 3LVQE 3QG5A 2A9KA 2G0TA 4D4KA 5FUXA 5KDDA 2GCOA 5K8TA 4D4LA 2ZRIA 1V5WA 5DI3B 3WYFA 2PT7A 2QY9A 2JEOA 4A2QA 1KO7A 5IDVA 1ZJ6A 4A0HA 4LX0A 5C46F 3OIYA 1MR3F 3BAFA 4Q18A 4TZ6A 1E0KA 4JJKA 4BFSA 2G3YA 2PMKA 4KLZA 5FUVA 5A4JA 4L5BA 2H5EA 2FA9A 2IUSA 1XMVA 4B2PA 1NN5A 3LX8A 3UG6A 4RKFA 1TUEA 4ZI3A 3K09A 1E4YA
chains in the Genus database with same CATH superfamily
1I9GA 1Y5MA 5JYBA 1VE7A 1RPJA 4P4GA 3QEBZ 3CFYA 1ZGCA 1JHYA 4HB0A 4YHHB 3NHRA 3UOAB 4DG5A 5CB6A 1V1MA 2X0RA 4J0IA 4MPTA 3RVKA 5C7OO 3GRFA 3BMCA 3GPIA 5BY2A 5FWXA 3RQSA 2G07A 1BC5A 4RD4A 2DSNA 2YW2A 4NV1A 4MV9A 3OMXA 4AJLA 2X86A 3B3JA 3N75A 4Z7OB 1PGNA 3F0TA 4OB6A 4WE3A 4V0SA 4WLEA 4AWAA 1P9RA 2FPGB 1YR9A 2ZT8A 3O8QB 1UF9A 3VHXA 5IF9A 3K0FB 4Q3BA 4XUGB 5JSQA 3FTEA 1EE9A 4Q7QA 1V3TA 4RZIA 3ZX5A 4G0MA 4Q3KA 4XQ9A 1C0KA 1KKUA 3M49A 4QRDA 3ZGOA 1Y8RB 1PR4A 1ZSYA 3IQHX 1JR6A 3RJTA 1Q1ZA 2WKQA 3TIXB 4GSYA 1JQDA 5LL6P 1D1QA 4BV2A 3M6LA 1FXSA 1SUDA 4IJWA 1QYRA 3N05A 1RI4A 1J21A 5DWVA 1DBVO 2ZFUA 3CX4A 5LLSA 3M3HA 4GOOD 2CJYA 4OMUA 3S2IA 1DKQA 2H8KA 2WSYB 3ROPA 3UXEA 4FCTA 2QUJA 1AQYA 2IYEA 5DCUA 1XDBA 2F64A 3L4KA 3QXGA 1FUUA 2WUWE 1FIUA 2C42A 3AZPA 5K03A 3F6PA 1Y7HA 3JWIA 4TQGA 1OW3B 3AEQA 3RD5A 5D85A 2PX5A 3FB1A 1AOXA 4GZ5A 1LLCA 4ZFNA 4KNWA 3NT5A 5SZHB 4U63A 2PZMA 2ZR9A 3IQXA 3PNSA 4IH1A 1Q0SA 2JGNA 4J2HA 4LRTB 1RRFA 2D5AA 2E55A 4BBJA 5EJ4A 3I6IA 4PQFA 4P3NA 4AG3A 3NMUF 3ETJA 4MLCA 4RANA 4KHPB 1OX5A 1AKQA 4QDTA 5A71A 2C92A 3RRXA 3AF0A 4IX1A 3ROFA 3UMVA 1AUPA 3FSEA 5KVVA 5GOZA 2O3RA 3RFFA 3GY0A 1OZGA 1VLMA 3KQUA 2F43B 2DFTA 1ZCJA 2XKBA 3DO6A 2BEUA 3FMPB 3LUJA 4L8GA 4QREA 3TWOA 1BCRA 4LMPA 2PKXA 2WLSA 1U2QA 1TLFA 3G89A 2FMHA 1JP7A 2Z5FA 2PBRA 3PHIA 4QULA 4QXAA 3R3ZA 4HAUA 1WNFA 1U5BB 4JMPA 2QA5A 1XFAA 2PUVA 4IJ6A 4JNKA 4UW9A 1M6WA 3HJTA 4GWLA 5FBWB 2JGAA 2P5TB 4MUEA 1WLYA 5EKXA 2F3TA 1IVSA 3PQ4A 2HBYA 4X60A 1M2JA 4JB3A 4WFJA 4ZQEA 3VR5H 2YXLA 1JQAA 3BMOB 1CB0A 2XI4A 3EIXA 4QAQA 3Q85A 1M0SA 1H0RA 2HMYB 2W6CX 1OAOC 1C81A 3MUNA 1ZK2A 3ER6A 4XSVA 4CQLA 4LF8B 2JIZD 2JS7A 4R2JA 4P34A 2F1JA 4CF6A 4QYMA 4DSOA 3GP3A 3PNPA 3ZLJA 1AS0A 2QE7A 2YIJA 1W5TA 1RBYA 2CXQA 2Q5IA 4EDFA 2XHZA 2WHEA 3E2MA 2C9ZA 3EJWA 2GPTA 2D0OB 2MT9A 3HB5X 5ALWA 3A4LA 1TKAA 2QXUA 3NB0A 3ROQA 2QWXA 2QN9A 4OFXA 1W94A 5CB0A 3IYLW 1XC7A 1CK4A 2FKNA 5LQDA 2V0GA 1N8SA 4TTIA 4BQPA 4HNAB 1GOTA 3EVFA 3H4VA 2H1OA 3HCFA 3BMXA 1CC1S 4P2GA 5HM8A 4BE4A 5KKAA 2Q7XA 2BYTA 3BD7A 4F12A 5AXAA 1EWQA 1Y3CE 2LD4A 3V46A 4MVJG 5CIQA 2DUWA 3S7TA 3SQOA 5KSWB 4A2PA 3I4FA 1T1GA 3C3KA 1FLAA 3PQDA 3IV9A 3RSHA 3LQ1A 3ZWMA 2CWWA 3QVSA 3VH1A 1V3QE 3RYCB 3H2BA 2WSLA 4GLBA 4NENA 3L3BA 4INOA 3UJBA 2YTZA 4UE2A 1J9ZA 1HG0A 1S2IA 3FUVA 2PBFA 1GU7A 2PEYA 1WDKA 3UMCA 4C03A 5FO1A 4CMIA 3CLTD 4QBFA 4ATNA 1OAAA 5ULLA 1C3LA 4P1ZA 1NRJB 3OT1B 1R5NA 2Q99A 5D6OA 2XUJA 1VLJA 2HPAA 2WMDA 4KPGA 3VC1A 3IPRA 4PVDA 1E9FA 2HSGA 4YYEA 4LZZA 1BN6A 4OP1A 1Q15A 1A5TA 1UMBB 2C5EA 2P30A 2P3QA 3P45A 2D7DA 2QRJA 4NATA 3T7RA 3U0BA 5LQMA 4UHKA 2BFAA 2MSNA 2DWUA 3RIXA 2BKUA 1AIPA 1LI5A 2GXQA 3JPYA 4YH1A 1U6IA 1WPQA 2F9LA 3OOYA 4NBVA 3VNRA 4BGIA 5KTRA 5TS2A 1ZWLA 5DNEA 4UTZA 2RE8A 1S3IA 5K8IA 1IUKA 1MAAA 3ET4A 1LQTA 2VP9A 3N7TA 4RTOA 1MQ9A 2CNNA 5IMSA 3JPWA 2Q9CA 3LW8A 2VYQA 1W5AA 2FEPA 3L1JA 4TMZA 3PDIB 3NV9A 5ERYA 5CFLA 2H52A 4RAQA 1T6XA 2PBZA 4BTLA 2EWMA 2C29D 2D13A 1YZGA 3OG9A 1F2TA 4K3UA 1KY3A 1AD2A 4UUAA 1URPA 3H11B 3KG2A 3PV0A 5E38A 2H4YA 3IIMA 4JASB 5BYJA 1ADJA 2VT6A 3MRVA 3S1AB 3QE0A 3OJ0A 1DTWA 2GI4A 2ECPA 2IC5A 2V7VA 3IOBA 3MCAA 4Q3EA 2JATA 3BH7A 4XX1A 4HGRA 1SAYA 2ODWA 2IHBA 3DO8A 5LZ5A 2FHSA 2B7BA 1MFPA 3EXAA 3PXXA 3CNBA 3G2LA 3FSGA 2X58A 4FHFA 2JLWA 3TLGB 3STHA 3HPRA 1E1YA 3R3WA 4FCVA 3A6PC 3BGOS 1QOPB 4NTZA 3W4JA 4BAZA 5JWOA 2RGYA 3IVAA 2XA9A 1POWA 1Z4OA 1YQWA 3EUAA 4HNAA 1B8OA 2UYQA 3B1KA 3GCXA 5KJEA 1A71A 4IGFA 3MVEA 2SHKA 2UZ1B 3SXUA 1S1CA 3FYSA 1DIBA 4PYNA 5I7UA 3CT6A 3VHRA 2NACA 3WJAA 5KYYB 3CYFA 1AKTA 1KIMA 4HEA6 4DNOA 3JYQA 1DQPA 1HWYA 3H5NA 3I8XA 4ND8B 4UKDA 3RH0A 2ARKA 4OX9Y 1C7IA 2BM0A 4MQBA 3MAJA 5AM2A 3K73O 3HSSA 1GG5A 1IQ0A 2QMYA 4G1BA 1GLGA 5DOVA 3MGKA 3DEHA 1FJ2A 1PJBA 5ILOA 3BBLA 5D1HA 1NMXA 4B8WA 4F2PA 4KN9S 4AQYB 2B9EA 3NETA 4YJHB 2GAIA 4N03A 2CT8A 5DYNA 2JLBA 4UE3S 4WLUA 5BPHA 4ERXA 2V97A 4Y7DA 1YAHA 3NHAA 4YP6A 3LX6A 1ZQ9A 4NJEA 4D9CA 2AGVA 2CHEA 3KPJA 3OX3A 5LU8A 3ZWNA 3CN7A 4UU1A 1ZIXA 1G59A 1CUIA 4LK3A 2PT6A 4MI1A 2XB6A 4KAJA 1XRPA 4IXNA 3Q1LA 1RZUA 3DMTA 5J9FA 4OHYA 4UU8A 4J0HA 1EH5A 3T34A 2EATA 3F90A 3V55A 5LN1A 4ZIRB 1ZVQA 4NH4A 1CQIB 2YN0A 4HWSA 3UT6A 2HPHA 2JHAA 5G41A 5L6MB 2IS4A 3DAYA 3KYIB 4KXMA 1PL6A 3O4VA 1L7OA 3QWBA 4HVAA 4FZ3A 2V7QD 2NYUA 3H87A 2B34A 5TGTA 2PD3A 2Z2XA 3AY7A 4INAA 1ABBA 2VTBB 2RHRA 3FH0A 1R3UA 3HXKA 3GLGA 1RIFA 3SC2A 4NK4A 1QDEA 5JJBA 2IBTA 4TMKA 3INTA 2IU6A 2VNJA 3L40A 1PJCA 3K1JA 2P62A 1RBMA 5INTA 3GRPA 3BDIA 3HV0A 3KPWA 2ZUWA 4M88A 5JVDF 3PNLA 1X8LA 4Y30A 4K9KA 1QP0A 1CVRA 1WDLA 5HUHA 4R4JA 5CGQB 3UAYA 2B30A 2PT9A 4JBLA 5HCNA 3AEQB 2CVQA 1IZZA 3PFNA 3RRFA 3T06B 3LOQA 1NF3A 4MW1A 4PR0A 4NBKA 1I2AA 3K53A 5KYUB 2A7QA 1C3VA 4L72A 4QJIA 2IHNA 2XWQA 1DT5A 3PGLA 2ASVA 1SBZA 1YO6A 4H17A 3UN1A 4PANA 2EF1A 4YQFA 4X8LA 3K71B 2CLMB 3WGYA 4B35A 3P9YA 1IVYA 1F5NA 4QO7A 5DYYA 2X0DA 4RY8A 2CDBA 2JBHA 2D7CA 3L77A 4NFYA 3LCJA 3RG8A 3SDZA 2CLIB 4BLUA 2NNWB 2EX4A 4MKRA 4V0RA 3FNHA 1SXJA 2NU7A 3N8DA 3R0XA 1CTQA 4I1OA 4I55A 1XVVA 3VPFA 1ESNA 1ZMRA 3OPYB 3WLLA 2MSLA 4BFZA 3ONVA 3BGDA 5D87A 4BMVA 4CJXA 3FDJA 4L73A 2CMDA 3KD3A 1JQ5A 5BSMA 2F4NA 2CCGA 1SURA 1XO1A 1HR0B 1R6UA 1NYRA 1QZ3A 2CYBA 2P6UA 3KVNA 2I7TA 3ESQA 5IBCA 5AIBA 4F5EA 1RXIA 4N40A 1BMFD 1P4GA 4BO5A 4DJEC 2O8EA 1S2OA 4NQZA 2R9VA 5TGDA 2X1HA 4KQ9A 2RGCA 1U31A 3CCBA 2WSSD 3PKJA 4FEAA 4S1WA 1EAYA 1KY5A 3JYNA 2PVCA 4Q1EA 1X7XA 2YR0A 1P4SA 1SH7A 5AOVA 5LZ2A 3HO1A 3VH3A 1M1UA 2CF5A 3A3NA 1F2UB 4C08A 1OLSA 2IPXA 1SXQA 2QLBA 2CD7A 1EJ0A 2Y0CA 3GNSA 2V7GA 2CV2A 2Y8EA 4NX2A 2A3NA 4ZZIA 4FDTA 3RS3A 4AK9A 2GXAA 4M7RA 4MWGA 1RAHA 4RVSA 1CT9A 3OCVA 4LYHA 1QK3A 4E5VA 1NWCA 3KYCB 3PQFA 4J1QA 2WJWA 4MI3A 1Z2CA 3WGKA 1GAXA 5JH7A 1AUOA 1KQPA 1RRVA 1UXOA 3FMGA 3GD7A 4MA4A 5AW1A 2XV1A 1G2PA 3U7JA 1IOWA 1VZ2A 3HNOA 1C0EA 2CJWA 2XNKA 1ODKA 2J7KA 3E9CA 3KP1A 3FOZA 1FSGA 1K8ZB 2MU1A 2YHIB 4UMFA 2WU4A 5BW8A 1FS4A 3UAGA 2YS7A 2XY4A 4FZRA 5DB4A 2A4KA 4HFMA 4QHTA 1CIVA 5DLEA 5JNLA 3C4VA 1XMIA 4C3UA 1EDBA 2QTMA 2PSFA 4CNQA 2ZAMA 1JTVA 3NCTA 4XXHA 5LDGA 1HYEA 4GLFA 3KSDO 2W70A 3MCTA 3ZHQA 1MOQA 4F7DA 3CC8A 1IZ9A 4K28A 1KU6A 2IW3A 5EE3A 3I64A 3EX7C 2DR3A 1HXHA 1SD2A 1UK7A 3T15A 4UNPA 2OFOA 4OY3A 5HA5A 3FXAA 3CB4A 4J6FA 4M83A 3WKDA 1GKKA 3SVLA 3EOAI 3JQCA 2FSUA 1C9EA 1SCIA 1VKOA 3I9V1 3WSVA 1NUUA 5AKZA 1NI4B 821PA 1A9PA 1QVVA 4B8ZA 5DLPA 3VZPA 2ZM6B 4MUXA 1FJXA 1A4IA 1Y5NA 5ESWA 5A0VA 1WHTA 2F43A 3AFIA 5FOWA 3C3MA 4R1MA 1U8CB 1M1ZA 4M8SA 1M7BA 4L16A 1UOQA 3RU9A 1SC1A 5J4HA 3IX7A 4M1MA 1P1KA 4XFDA 2X7XA 2BE9A 4Z5XA 1GQ2A 3MHPA 4J29A 4ZRDA 2JI9A 2PSDA 4EB3A 3IQFA 1NPDA 1ULHA 5LM3A 2ZCJA 1TTTA 3CXRA 5FA6A 4J4TA 3M6VA 1VI2A 2HFKA 1DLJA 4I3HA 1Y6ZA 4J0EA 2HK6A 1R0ZA 1B6RA 4GPD1 3BEOA 3GJ6A 4ZOCA 2E9SA 1PT8A 4NSNA 3AIMA 4AROA 2K2WA 2YWXA 3AKEA 2JHFA 3QKWA 2KPOA 3R5KA 4W6QA 1EK1A 5C4GB 3FG9A 1L7XA 3TQCA 4A03A 5KYNA 4X41A 4YCDA 3ZQUA 4N1AA 4NYIQ 4BNHA 2CUNA 1N8NA 2VRCD 2OBLA 3NM4A 4G37A 4PBSA 5CG1A 4ISCA 3UC5A 1XZAA 1P9LA 5JFOA 1QO7A 2CJXA 3BM5A 3LS2A 4M8NE 1NVXQ 2FQQA 4Q7LA 3ANNA 5HRUA 4F5YA 4H7IA 4ZAZA 3RIMA 2GGSA 1L3CA 3RW9A 3TDKA 4YAUA 4OM7A 4R9VA 4BBZA 4RTMA 1NR7A 3SC2B 4NG5A 2NM0A 1R9NA 4ZQCB 3JQFA 4J94A 3NGXA 1CRQA 2RH9B 4ZI7B 1RPZA 1MJHA 4YP0A 2IZZA 3TCKA 1YONA 2BBOA 3H6GA 5JPCA 4EGQA 4F60A 5HOQA 2DQYA 1AV7A 5J2TA 1NAHA 2CXHA 3LDFA 4E6EA 4XDGA 5JSFA 1D2RA 3VTZA 2VK1A 3K0CC 4YJGA 3TNLA 5JAPA 2JHCA 1Z6XA 4PV7A 2X4LA 4GM0A 1PYGA 3OI7A 3CM0A 4KEAA 3DFZA 5EFZA 3QLUA 4HWKA 3GZ4A 1E96A 2JFXA 3B85A 4DMHA 3VX4A 1QQ5A 4O29A 4P4SB 3HKBB 3D3WB 4GI5A 4WLFA 1NM5C 1V7QA 4EHLA 1DUVG 5C8YB 4ILEA 4K46A 4RS3A 1N2CE 3L1UA 2YXNA 2ZB2A 3ZWKA 4TXMA 1UQUA 2BVNA 5CDUA 1BFKA 3DLPX 4X5OA 1ORIA 2JLQA 1KI3A 1RYNA 2IEBA 3K6RA 4KV9A 5GJVC 1E5TA 2MSWA 4K3VA 4K9OA 1KC1A 2WTNA 2JIRA 1GDDA 1JU9A 2X2EA 4ZGGA 4QVIA 3KQKA 1SRRA 1YRAA 3VSCA 1QF6A 4L8YA 1Z82A 1T2UA 5T8KA 3HFRA 3JZDA 3REQB 2HRBA 1VI6A 4YUZA 8GPBA 3QNUA 4NBSA 1QR2A 2HYDA 2W0SA 5JE8A 5HUJA 3OFND 4E5UA 4EF6A 1RWMA 4NPHA 1SU7A 2HU2A 2J6BA 1U9JA 3EODA 2E87A 1EVJA 3KK0A 3NIBA 4C6HA 1KTIA 4OB8A 1YK0A 3KJXA 1Y6JA 3K05A 1DE0A 1THZA 1Q92A 1U4NA 5FTMA 1SIUA 1USIA 4BZZA 4JEIA 4CG2A 1VE1A 1ZD4A 1HE8B 4K9LA 4QEZA 4RNCA 4G1EB 2QLNA 3BFVA 4HEQA 1BEEA 2R86A 5EUQB 4I46A 2OESA 5HFAA 4ZTBA 4ZT3A 1Q1AA 5LA6B 3JS5A 4XJSA 3E84A 4BX2A 1Z39A 3COPA 1TU3A 5FH9A 4B3GA 3IVGA 1L5KA 5LYJF 3RC3A 1D6MA 3ZHBA 2Z9CA 5CH3A 2PLFA 3PGKA 4XVUA 1H2FA 2RGRA 2ODAA 1U80A 1VOTA 3MJCA 3NHKA 4ZU3A 2XQFA 3AV3A 4LN1A 4RZQA 5DIZA 1N34B 2K6GA 3RAJA 1YZKA 3A1VA 4KDEA 4UBJA 4RWEA 4KR9A 1T4GA 2GWRA 3CZMA 5CLLA 4I5GA 3QYPA 1ZD9A 2OTCA 1KJNA 3TSWA 1NKVA 1Q7GA 2H4ZA 2IW1A 4O4JA 1Z29A 3BZUA 4OBEA 2G4LA 4RK4A 4MB2A 5EJEA 1UXIA 3AU9A 2HN9A 3E70C 4XQGA 3K0FA 1OYOA 4L57A 4CRWB 3U44B 2V1XA 2W8ZA 3DZDA 4D4IA 1G41A 3HWSA 1V1JA 4TL6A 1CUGA 2OGWA 1IXRC 1YNSA 1YKGA 1IN7A 3TCXB 1IULA 1Y33E 1SVUA 2IE0A 2JFPA 1N0IA 5DBIA 2BTEA 1E1QA 1QAQA 4EQ6A 5E8JA 2CHGA 3SFTA 1ZOLA 3CS3A 4B3SB 1OR8A 1VSVA 1MVOA 2GYVA 2OFWA 5JS6A 1OFIA 4O02B 3AEUB 2UZAA 1DKMA 4XSGA 4IHJA 2BJHA 2JJQA 1EGVB 3D6UA 2FSVA 3DOHA 3GD5A 4QGFA 1L5HA 1CJCA 1IRXA 2FWJA 1GG8A 4IAOA 4C06A 3JVUA 2VDQB 1ZK0A 2SKEA 5BR8B 4NY1A 4IZIA 2G1UA 3N3BC 3L7CA 3DXFA 5J3JA 4M76B 4I0WB 2C94A 3FLAA 3L7BA 1TEZA 2Q3JA 1GPAA 1N6HA 3GJ7A 2RGBA 1BYUA 4NMHA 5HIMA 1CUDA 4J1TA 1ZONA 4R9NA 1YQ9A 3RI3A 4M89A 4ENWA 2PX3A 1BS1A 2QRNA 2QYOA 2VPTA 1DTEA 1GVNB 3C8DA 3DG9A 3O1JC 3U7EB 5LBIA 1ULBA 2R8XA 4DIOA 3BS4A 3MUFA 3I9NA 4XI9A 1E0AA 1CQJB 1SO8A 1T6YA 4CFSA 1PGQA 1YDMA 2GHTA 1H9CA 1SVMA 1E5LA 1WZIA 2GJ9A 3HR7A 1CRZA 3AIKA 4TMXA 4EYKA 1WZUA 3BSWA 4CVNA 3ZIAD 3B3FA 3T9FA 1C0PA 1CZLA 2G88A 3EFBA 3KKLA 3ZIUA 3GEIA 2VF4X 5T4EA 5EHGA 2HK8A 2FR1A 5KTSA 4GZ6A 4M46A 2B20A 2PVSA 3ZDQA 1HFEL 3HR4A 3TEFA 3DZGA 1XMQB 4LE2A 4ZAGA 4CM3A 3OIDA 1YDWA 4J75A 4CUKA 2JIDA 1VPVA 3LVBA 1U9YA 2Z2JA 4BN5A 5IHXA 3I0NA 4G41A 4OVKA 3QLTA 1GU0A 5CGZA 4YDSA 1J06A 3SCZA 4EUEA 4DLPA 2ZI6A 4JXXA 1DAKA 4GUAA 4IJVA 3RO7A 4Y2PA 1NFFA 5DX0A 1AGYA 2XSZA 3ZDXB 1UMBA 4E21A 3BJRA 2P69A 4H3HB 5IVDA 1E1RA 4RY2A 4HAOA 3ROTA 1RBZA 1T3HA 3SKYA 3TLEA 3DL2A 2XMCA 1G3RA 1M2GA 2ZR0A 3PRYA 2R87A 2PRSA 5HIKA 5DM4A 3TLKA 3IKTA 1HO3A 2OXIA 5JTUA 1O8BA 4RHUA 4NP6A 4Q9KA 3VSEA 5I3CA 1VJCA 2DHDA 4M3NA 3ZK7A 3E7DA 2XNDD 2B6HA 3KO8A 2DQZA 3DBHB 4IWYA 2QZ9A 4J76A 4LQCA 4EBFA 1E1NA 1RRCA 1R0LA 2AR7A 4U3JA 1IN6A 1Q1QA 1OE0A 2QG4A 5BUCA 4EJ2A 1DBWA 2ZT5A 1T4DA 3C97A 4Q7KA 2ZSEA 4OREX 3EXFA 4FYJA 3PUXA 4KLCA 5AUPB 4D3DA 2VDWB 1E3MA 1RYBA 2R25B 4DA8A 1QMGA 5JZSA 5CM9C 2XMBA 4V2IA 5T57A 5THQA 5TMEA 5TPZA 1E59A 2CL0X 4O5OA 2A9OA 3U3ZA 3DHWC 4II7A 1TA0A 1XXHE 1GCIA 3TQRA 1XMPA 3B52X 4Y0NA 2EFYA 1WA5A 5BW4A 4YLYA 2FOIA 3N9IA 3D4OA 5DM70 3PITA 4G5QA 4NCIA 3EULA 2A0YA 3NXSA 1GXSB 4CIVA 2YWBA 3T12A 1YCHA 1MJGA 3Q3JB 3R2JA 3GRVA 1N2SA 3O9VA 3VUFA 2EF0A 3VU9A 2X41A 2YRFA 2VTVA 3CTMA 3UCEA 4D0GA 2JH8A 4FGKA 4DRZA 3GLIA 3O2SB 5ARBA 5FFNA 2J7PA 1P3DA 4BY9E 1E2BA 1HRKA 1A4UA 3TD6A 1TLLA 4FHZA 4ZV4A 3DNPA 1QVZA 1FU4A 4OXKA 3MBOA 1WIWA 3NHYA 5JLAA 3N6RA 1WVMA 2A9RA 3C3EA 3RRMA 4LI0A 5IVIA 1D3AA 3OBIA 4BTVA 2AX4A 4AJPA 3L9WA 3USES 1F1JA 3I53A 1MDFA 4YRNA 1SQ0A 5EKUA 3ZYZA 2F6RA 4OQQA 3P97A 4IY1A 5TXGA 3ONNA 2Y3IA 1UAYA 3FTDA 5C8DA 2BTQB 4ARZA 1V4BA 3K6KA 1NW4A 4CLRB 1Z33A 1H69A 2DGDA 2EBWA 4IIJA 4GOJA 2V7QA 3R5TA 4LRXA 4CDGA 3OU6A 4DDTA 5K0ZA 1X1RA 4Z9BA 2DBQA 5DBFA 4Q1DA 3ZDZB 1X86B 3CUYA 1OVGA 1L3BA 1L6IA 3NOVA 4TT3D 1QV7A 1W0KA 3QUQA 2NVUA 2WWXA 5HSGA 4P4LA 1H5UA 2PMEA 4F56A 2Z5VA 1MA0A 1HYQA 2BM8A 4MB6A 3DYVA 4X20B 1FC0A 2FR8C 3FYTA 4MW0A 3GAZA 4I1VA 5AWFC 3BWCA 2BP7A 1NE2A 2DVMA 1DAGA 4TQ9A 4UM9D 4JYZA 3FOBA 3ZU2A 2YQ5A 1AUXA 3TRKA 1WZNA 1KI6B 3WGUA 1SELA 3VR5D 5KX5A 1X1BA 1SBYA 1K2WA 1GXSA 5LZ4A 3RSFA 4UAUA 5E6SB 3DBLB 2FN8A 3GWGA 2XDQA 1KK1A 2FMFA 3EVAA 4BN4A 4WBNB 2V7XA 4WKPA 2PXAA 5IF3A 2OB1A 3TXXA 4DT1A 1QKIA 1OHHA 3VOSA 2WZCA 1RYFA 2QX4A 2M6RA 2I65A 4G9GA 1Z5ZA 3VJLA 3OZEA 5LP6A 1XTRA 5EC8A 2W2TA 4UVEA 4IOLA 4HCJA 4BBAA 2XWPA 1B14A 1G9XA 2ZULA 3UK2A 3W04A 5ABPA 3C7TA 5J4LA 2DUJA 1QC5B 2A86A 1RZ3A 2FPWA 3KWFA 4TLBA 2QIPA 5BW6B 1GCUA 2GN1A 5BXQC 1P5HA 5A2GA 4JHLA 2CGEA 2GAFA 2FAXA 5ALJA 3TLJA 5L51A 3DE4X 4WH0A 4URVR 3E9NA 3P2OA 4PX3A 4R2MA 4WZBE 3VDNB 3VZCA 3M0EA 3O8RA 3OEEA 1N6PA 4EMUA 2NAFA 1W7AA 3VZBA 1P7ZA 2WF6A 3IKVA 2REQA 3HBJA 4M1SA 4HQLA 4E2FA 4Z3OA 1JQJC 4QPCA 2IY8A 3ZV4A 1YBHA 4IQFA 3LVFO 1QMPA 4YMIA 3VNVA 3GZNB 4JA0A 2XMRA 1DELA 1I4DD 1CSEE 1JZTA 2FVYA 3H8VA 1NY5A 1RC0A 1OBCA 2J9RA 2LV8A 3SJZA 1RLTA 3FYUA 2EG5A 5JJCA 1R88A 2O07A 1UZUA 3R44A 2BSQA 1DEHA 4IF6A 2HDHA 3E61A 1OV6A 3G9UA 3NBAA 5DCYA 1FZQA 5IH3A 5JQGA 5JRZA 3VM6A 1HQKA 5EMKA 4JUDX 4NZYA 2IYXA 4PGFA 2TMKA 1TO6A 2O5VA 3PWTA 1RPAA 4BJ1A 1WEKA 4EYQA 3D4NA 3T1NA 1VPTA 2C58A 2XE7A 3KXDA 3NJ4A 4KE8A 2F7SA 3ZE7A 1YS7A 1KEPA 5BO5A 4X62B 5CCXA 3PTLA 2JZCA 4C7OB 1GL3A 1OXMA 1XZCA 3FNIA 2YJGA 3BB3A 3M1YA 1H6CA 2DM6A 2I22A 1H3FA 1ISRA 2GZ2A 5KCZA 4IRMA 4WJZA 4UOQA 1TYCA 5HF5A 5A6SA 1AU9A 1OH5A 5KNDH 1LLFA 2HB6A 1MXFA 2QTVB 3CUTA 3KV3O 4CT0A 2HNAA 3O84A 1IYZA 3E7WA 3MCWA 5KYVA 4IILA 4NV3A 1FTWA 1A9RA 2XNCA 4KH0A 2RCNA 1JEEA 3IS3A 5CLJA 1XOIA 1MB2A 4N7JA 5FPPA 3ZVRA 3MMSA 1U0FA 4JLBA 4D5GA 1TM1E 2OA0A 5HE8A 4FYHA 3KKEA 1A2OA 5HEKA 1UPCA 1UBGA 3K1AB 3SDSA 1VKRA 3R7BA 1LPAB 4EO7A 1BWQA 2VDVE 2XE6A 4P3YA 1JE1A 4PTZA 4BDSA 3LDGA 5FDFA 3D0QA 5IDXA 4P5EA 2NSYA 4OQDA 1EZ4A 5CTAA 1I8TA 3EXFB 3AO0B 3U1TA 5LFAA 3HGTA 2WY2D 2KB0A 1MABA 3ZHZA 1CCWA 2CNBA 4DLTA 1RAAA 4Y9SA 3ZCUA 1TZCA 2EDCA 3H5IA 2VUTA 5HCIA 2X8JB 5WRFA 4URHA 1VL0A 1E77A 3G2IA 4JOSA 2AFHB 1IY8A 3RHTA 4IJMA 4HXGA 3ZE9A 5CHYA 2BHSA 3CZQA 5FHRA 4ZN6A 2GXUA 3UBMA 4DM7A 1NBMA 2P41A 4C78A 4YREA 1WWKA 3OC0A 5BNFA 1JQKA 1JALA 5DO9A 5I5GA 4IPTA 3DBOB 4V03A 1PV4A 1FNCA 1OVMA 2CUTA 2KSQA 1ZZEA 2NQ2C 3FTPA 4LOKA 4QU9A 3ZI4A 3AHFA 4F3TA 3A6FA 5ICFA 1ZCBA 1UPTA 3HDGA 4F1JA 3DE1X 5G0VA 2VPQA 4CMHA 5LUBA 2AJTA 3K15A 2VNKA 1E2JA 3G5UA 1DWUA 4BQNA 2QUIA 3KPUA 5C8YA 5J5CA 1BEZA 4F3YA 3BBPA 4S04A 3OE1A 2ZVQX 4WZBA 3RJ9A 5BMVB 2AWOA 1RWXA 2BGMA 4JT4A 4BLPA 4RDXA 2CNWA 2F67A 2QAJA 3RARA 3FVVA 3PLRA 1P0QA 1LFDB 3AR6A 1RXEA 4H0CA 5JFGA 2FZCA 2TMYA 4JV5B 1K0UA 1M6EX 1ENZA 4MCAA 1Y5RA 3AR4A 4OGGA 1Z56C 3R5HA 1HTTA 1STOA 4OHBA 2GVZC 3Q11A 5DTRA 3USCS 1JHMA 4AO8A 3CKKA 4KMRA 1H3EA 3AR9A 2PMFA 6Q21A 1ZMBA 2PS9A 5HVNA 4PLFA 4YCLA 5BQ3A 4P33A 1HLPA 2Y1WA 2JFNA 3OFNA 3TTVA 2AF4C 3GLFE 3GF4A 1QZTA 3FZEA 4ZAFA 3R9XB 3O38A 2GN6A 2XUKA 5B64A 1SBTA 5A3QA 5HKAA 2P6NA 1NL3A 4WACA 2HOQA 5E4FA 3MRSA 4TKUB 3WGHA 4QT4A 4MQUA 2A33A 2AI1A 1GR0A 2R8ZA 2WOJA 4HDKA 5K8VA 1XZGA 1DKPA 4MEJA 4M36A 2J5QA 4C1NA 2ZE5A 2WJVA 3QENA 3UWOA 5JH7B 4TYWA 2FN9A 5GONB 1X1CA 4FQ8A 2JZNA 3LRXA 3Q8LA 1D4ZA 1Y9JA 2W2QA 3OM8A 2H0AA 1MQSA 2JFWA 2MR6A 4F1WA 4NIMA 1E79A 1XU7A 2AD1A 1GKUB 3EGDB 3NHPA 3DW3X 1ML4A 1R66A 4CN9A 3TSZA 3IPXA 4D0NA 3D8TA 1NSFA 1MZPA 4WVFA 4BO1A 2RGNC 2NSHA 1ZOIA 3WLFA 3T1VA 2GZAA 2VNAA 5LZ9A 3EE6A 1EINA 3L7OA 2EXXA 2VKQA 3THSA 1NVGA 2B92A 3ELYA 5J58A 4KPEC 2OCAA 3EGWA 1VHLA 3NANA 4DM3A 1CUVA 1AMOA 2IL1A 2AJCA 4LJ9A 5AK4A 2X8BA 4E51A 1IB6A 4LZOA 4TMWA 1U8EA 1GILA 1Q50A 5AM4A 1FMTA 5TQ2B 3AF3A 3MSCA 4G8BA 3DW1X 3NKVA 4IEFB 1ZPDA 3QF4B 1PF7E 4QDZA 5IJWA 3RF6A 1TT7A 2XMQA 4EHBA 1JEYB 2D1QA 5L4SA 1U8AA 1I9CA 2Q2OA 1C7ZA 2CNOA 1RVV1 4ZZ1A 3G3EA 5ITWA 5F4BA 5JXJA 3K1TA 5LZ8A 1XZLA 2GZRA 1JE0A 1JDBC 3MJSA 1OU0A 3AJEA 2BZSA 4HRVA 4JJEA 4MINA 1GTZA 4FKMA 4BNWA 3IEMA 3A2MA 3LK6A 1YB7A 4M60A 4EKGA 1ONOA 3ZNPA 4E4YA 2N1MA 1SBNE 4W7IA 4CKXA 4D9HA 2D1YA 5HQ3B 3NAGA 4RHXA 1SCAA 4I50A 2P8SA 1P80A 1SEPA 3BMQA 4BQIA 4D0SA 5JECA 5TEVA 3CWZA 3NZEA 3SLGA 3AEXA 4A15A 5GOTA 4ZD6A 2VL7A 2ZJ1A 2O2HA 5CVCA 4EP1A 5AW7A 3HCNA 3G02A 2NOAA 3RRBA 3WJ7A 5KYYA 1IY0A 4HDNA 1HMPA 4QFMA 4CQLB 1H8EA 1GT91 2PVPA 3HDHA 2EGUA 1XT6A 1CQJA 3KB6A 5IARA 4BJHB 3TD2A 4YT5A 3IQEA 2VK2A 2ZRNA 3HGMA 3LLUA 2YZ7A 3H9QA 4MIYA 3U4GA 1X74A 4OXNA 3V1NA 4M0FA 2X7JA 4WUVA 2AR9A 4O4IF 2PT5A 5IHPA 4U1RA 4LRWA 5B1DA 2BISA 2FI1A 5I7WA 2DBZA 4HDQB 4Z9YA 2QTTA 2H4JA 3EGXB 3IVCA 1JEJA 2XUOA 5K20A 1NVMB 2IITA 4I50F 1AMUA 1XNRB 2V98A 3QPDA 5KNCA 1DNPA 1TF5A 4OQFA 3GMTA 2PBLA 4P4SA 4PTLA 1CR6A 3I3SR 1C9DB 2ZQZA 3CEMA 1ODCA 4KQWA 5ALDA 4RVUA 4EGCB 5D6NA 4DKJA 4N5DA 4N4AA 1YOVA 1MB9A 2XNSA 4BXOB 2IV7A 4EFLA 2XGOA 3JVVA 1E2IA 4FDUA 1DC7A 1P5JA 2DCMA 2EFJA 2NTJA 3K2BA 3BILA 4GWGA 4XE5A 3E5RA 3N0TA 3GVHA 3OPQA 5U4QA 1V16A 2VZ9A 3ZZMA 3STWA 2EBFX 2AXPA 2WJYA 3AUXA 3CNEA 4V0KA 1H2BA 1BZYA 3U3MA 1AXRA 5FT9A 4AG5A 4DMRA 2HHHB 3A06A 4LNUA 2M6LA 1Z5PA 1EXWA 2XKAA 2W43A 4XCXA 2YKGA 4CLRA 4HDRB 3AUYA 2NTYC 4WHMA 1LY1A 4JROA 5BN5B 4DLKA 3MLEA 3U39A 4CE6A 5E2AA 2JCGA 4V38A 3KBBA 4GT1A 1FE8A 1KMHA 4XKJA 1WQ4A 4RVCA 2MCFA 2M6KA 5ICMA 2ERCA 4KO2S 2MYUA 2XMDA 3DE5X 3TDMA 1NUPA 1HX7A 1XD2A 4EVRA 1SXJC 2WSMA 4BEBA 3BRSA 4PQYA 2WFLA 2FPMA 3NVMB 4N54A 3B78A 3LUFA 1VP9A 3D1LA 4FI3F 1CY0A 4UEWA 4KR6A 4QA9A 3PQ5A 4MJXA 4Q16A 1J8YF 1ZU5A 4K6CA 3ZGNA 4B4KA 4BEJA 2ODPA 4HDOB 4YUYA 3HMKA 2I91A 2IP1A 2PH7A 1ZCZA 2QXYA 2MR5A 3K1AA 1NQ5A 1UFQA 3O1IC 2C2ZA 3JQ9C 5FR1A 4G26A 4GXTA 2WHXA 4TKVA 1XU4A 4YRDA 1IUPA 4X1YA 2UZ3A 4L22A 4UVDA 1H0KA 1OSNA 3JQGA 3W5VA 3HDJA 2IHZA 4WCVA 2I4RA 4PZEA 4CG0A 3BCHA 5LPNA 1L5SA 3SX4A 5B1EA 5IX8A 3WP0A 1KEVA 4YP7A 1C7QA 3SOZA 2Q1UA 1DJQA 4CIYA 1P61B 1Y3HA 2Y66A 2ZPAA 3BE8A 4LTMA 5CH5A 1ADFA 4JP1A 3U44A 1PO7A 2WWTA 1JX6A 4DQ0A 1VYTA 2ZAIA 5EPUA 3L7IA 3FPBA 4KUGA 4NOMA 2D62A 2FCAA 2Z58A 4IFEA 3COVA 4NCXA 4NNOA 1FYDA 1IUOA 3R3YA 5F21A 2HNKA 3AONB 2OK8A 1MNAA 3V4SA 4ZDJA 2ZAOA 5C1PA 3QFHA 4FDVA 4M2LA 1TM5E 4DGSA 1QF9A 3DP9A 1G20E 2O3SA 4DLXA 3EFEA 3ZVMA 4HYEA 4LYJA 4CUZA 2IIVA 1DBQA 1INLA 3R3SA 2WJHA 3LWBA 4UOEA 4QQFA 2VNIA 2W11A 1H05A 2FZVA 4UEQA 4BBPA 2FQYA 4ZVSA 4B71A 2I29A 1N5IA 4R6WA 5A3RA 1LS6A 3R7DA 3WK9A 4FB4A 4Z8XA 3RC8A 3VYTB 4RWZA 3HZHA 3ZHOA 3FMFA 4EJFA 3CV3A 4PONA 4MKGA 1CUEA 4NK5A 5A3SA 3W3AD