2KJRA

Solution nmr structure of the n-terminal ubiquitin-like domain from tubulin-binding cofactor b, cg11242, from drosophila melanogaster. northeast structural genomics consortium target fr629a (residues 8-92)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
95
structure length
95
Chain Sequence
MGHHHHHHSHGKSDFIKVNVSNSHNDAVAFEVKLAKDLTVAQLKTKLEILTGGCAGTMKVQVFKGDTCVSTMDNNDAQLGYYANSDGLRLHVVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG11242
publication title Solution NMR structure of the N-terminal Ubiquitin-like Domain from Tubulin-binding Cofactor B, CG11242, from Drosophila melanogaster. Northeast Structural Genomics Consortium Target FR629A (residues 8-92)
rcsb
source organism Drosophila melanogaster
molecule tags Chaperone
total genus 16
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kjrA01
2BYEA 4HK2A 4IUMB 3JYUA 1WYWB 2CU1A 2N7EA 2I1JA 4GU2A 4DBGA 1OTRB 2N9EB 2JRHA 2K8CA 4NQKE 1UBQA 2L00B 3DVGY 3OJ3A 4DK5A 1RAXA 1WR1A 3NOBA 3ZRCA 4IG7B 4ASWC 1E5WA 3KH0A 2LD9A 4GMVA 4GB9A 4I6NB 4W9DA 4BBNF 5AZHA 4BOSC 1P98A 2LWPA 2RPQA 3QWZB 5DPSA 4MM3A 2AL6A 4ICUA 3A4SC 3HHMA 2ZVNA 2KKCA 2ZZPB 4KSLC 1GNUA 1SIFA 4P7IA 1J8CA 3RZWC 2DAJA 4DHJD 1HE8A 5AZFA 3ZNHB 2JZ3B 3ZNZB 2G4DB 1XT9B 3V61A 3JW0X 3QARA 2D2QA 4HPLB 1E7UA 4AP4C 1WZ3A 5BO4B 4W9GA 1WM2A 3DVNU 5JH5C 1XD3B 1RFAA 3H7PB 3QK0A 3ZTCA 4TQ0A 4ZDVA 1I42A 2MBQA 4FHJA 5DPTA 3NY5A 2O6VD 2BKRB 4K7UA 4W9LA 5AEKB 1Q0WB 3ZKJC 2KDBA 4EZJA 3V62A 3L0WB 2L76A 4FN2A 2DZMA 2PJHA 2JY6A 4MJSA 1M94A 3UF8A 3UINB 2DZJA 1WX9A 3M3JA 2FCQA 4G3XB 3M95A 4WJQA 2DYBA 2WYQA 4N9F4 2K6DB 5G2NA 4HDQA 4NAWA 4WWOA 2WX0A 2UWQA 3GZNI 3QC8B 4K7SA 4IM0A 1IPGA 2LJ5A 3I3TB 2M17A 1GG3A 2VRRB 5E6NA 1P1AA 1R4MI 1SE9A 3AU5A 3GOEA 1V86A 5CTRC 4PS7A 4ANXA 4EOYA 1WJUA 1QZEA 5CHFA 2KNBA 2MLBA 2L0FA 2KWVB 2B3AA 2FIDA 4LJOB 4JLCA 3DVNV 3A1QA 3A33B 4K81A 3TBLD 2EMTA 1RRBA 4URKA 1KM7A 2V4LA 4ANVA 4MJSB 2FCNA 2BYVE 3MJWA 3DQVA 3DPDA 4OVVA 4AWJA 4DWFA 2JF5A 4ANWA 4E71A 1Z2MA 3OJ4B 1U4AA 2C7NB 1WRDB 1TBEA 3ZDMC 2PE9A 3PHXB 3QJZA 2AYOB 3KYDD 3ML9A 4BKSD 2L05A 3H7SA 1EO6A 2LUEA 3A4RA 4NQLB 3U30A 4NAWB 3WAOA 1V49A 2Z0DB 2MW5A 1S1QB 4HDOA 3ZNGC 4KDIC 1PQSA 4G50A 4XX5A 5C23A 3EFUA 2RGFA 3PRZA 1Q1OA 2KC2A 4BKTA 1BT0A 2BWES 2BPSA 2JXXA 2PE6B 3P2BA 3KYCD 4WWNA 3A1QB 4NJ6A 1I35A 2KFKA 3MTNB 1WMHA 1V5TA 2ZCBA 2KC1A 3VUWA 1GJZA 2LVQA 3AXCA 3B1LX 4XZ4A 2JUOA 4FULA 2CS4A 1P3QU 4K1RB 3VAWA 2DYMA 3VFKA 3N30A 5DPRA 3L17A 1UD7A 4KZCA 3KUDB 3WA0A 3SD5A 2K25A 3B0AA 2JRIB 2JZZA 3V6CB 3VH4B 4DHZE 1S3SG 2KMAA 3M62B 4GGQA 4EFOA 4HJKA 3D32A 3ZDTA 3PRMB 4WJPA 3AI5A 1ZGUB 1WGYA 3WALA 3PTFC 4WQOB 2BKFA 1R4NI 2NS5A 3KW5B 1NI2A 1EUVB 1A5RA 2LASA 3X0WA 1T0YA 3SU8X 2PPHA 1WR6E 1WXMA 3APFA 1TGZB 2KFKB 2Z59B 1WMHB 3RULA 3IFWB 5LLIA 3PSEB 3ZLZA 1WJ4A 1E7VA 3KUZA 3PREA 3DDCB 2LXCA 1NDDA 2GBRA 2BGFA 2CR5A 1E8ZA 2LGDA 1IYFA 2G4SA 5TR5A 3C0RB 4WAAA 1YX5B 2G3QB 2L0TA 3PS6A 4GDKA 4E74A 1WI0A 4AOFA 4PYZA 2C7MB 2MCNB 2IYDB 2MRPA 1D3ZA 5DPWA 2L7RA 5LXHA 2NBUA 2EMSA 2ZEQA 2LGYA 3DOWA 2NBVB 4AUQC 3DCGA 2GBJA 3VUYA 4DDGD 4EUTA 2JPHA 4A3OA 2KDEB 1V9JA 3QA8A 4IM3A 5D94A 2KQSA 2O2VA 3NZUA 1GUAB 3CSTA 3RT3B 1CMXB 1E8WA 2IO3B 4MGZE 4CO7A 5KHOA 4RMAA 3U7DA 3IHPC 1KOTA 2KWCA 2NR2A 4WJOA 2MSED 4G11A 5CX3A 2K1FA 4II2B 3TL5A 3IG3A 2KOXA 3X23A 1UH6A 1YIWA 2GOWA 4FLHA 4K7WA 4MDKE 3ZTDA 2FIFA 2KHWB 2KK8A 4DHJB 1ZW7A 2KDFB 4GDKB 4MGIE 2LI5A 3VXWA 4CYEA 3EC8A 2D10A 2L3ZA 4FADA 3PHWB 2REXA 5IAAC 2FCSA 3APCA 3R7RA 3WAPA 3HM6X 1L7YA 2GBNA 2AWTA 3LDZE 1TZ1A 1J19A 1VCBA 4LDTD 3UIOB 2ZJDA 2FNJB 2GMIC 2KN5A 4HWIB 3Q3FA 3T8MA 1TTNA 3JSVA 4G0NB 2O2VB 5D7GA 3IVFA 4JIOU 2KO3A 2LRWA 3K9OB 2MBHA 2FCMA 4F8CB 2MA9B 1E8YA 2BF8B 3DBLI 4W9FA 1AARA 2MWSB 2MX2A 4KZ0A 3UQBA 2M0XA 3QX1A 2HD5B 1C1YB 4W9IA 2DX5B 2W9NA 4I6LB 1Q5WB 4HCPB 2V3SA 1KLVA 4LCDE 4TV3A 4AJYB 3K9PB 4EZLA 1OEYJ 1X1MA 2KQ7A 2N4FA 4NJ7A 4BKSA 4MEMA 1UZXB 3CSFA 1ISNA 4GSWA 4JQWC 5J18A 1G6JA 2AEHA 3UGBB 2J0JA 4B9KA 3EHVA 3L16A 1SGHA 2K6QA 2KD0A 4JGHB 1LM8B 4NNJB 1Y8RC 3LJ3A 4W9CA 4DDID 4DHZB 5C1ZA 4GDLA 3EECA 4RM8A 1LFDA 2KMCA 1WXSA 2JT4B 3ZIMA 3JSVB 1E8XA 1OGWA 3L13A 2CHWA 5E6PA 4TUUA 4X57B 1EF1A 2N7DA 2Y5BB 4ANUA 3T9LA 3VTWA 4KDLB 1WGHA 5J2RA 4BFRA 2M8SA 1YX6B 2C60A 1L2NA 4FJVB 4FBJB 4EKUA 2ZNVC 3OAWA 1P0RA 1WFYA 2R2QA 3OLMD 5FR6A 1UELA 2LRUA 3DVGX 3ZNID 3AULA 1H8CA 4GIVA 4DXAB 3NZSA 4WJNA 2JVCA 3QQ8B 1V6EA 4KSKC 4OVUA 1P9DU 2C7HA 2J7QB 2WX1A 2XK5A 4ZYNA 4MH0E 2XEWA 3QCAA 1Z5SB 5CHWA 4GDLB 2KVRA 2DYOA 1FXTB 2IO0B 1WX8A 3ALBA 4IWQA 1WGRA 1GC7A 3ZW3A 4F1SA 2WWZA 3O65B 4ZRIA 2LVOA 3H1UA 4TQ1A 3WAMA 3H6NA 4NY0A 4M0WB 1GC6A 2G45B 2R2OA 3RZFA 3L10B 4XC2A 1YJ1A 1C3TA 2L8JA 2IO2B 3ZO5B 2IBIB 1WY8A 2KLGA 3PVLA 4AJWA 5GMVA 2IY1B 4RM9A 3U8ZA 1J0GA 2KZRA 2KFJA 3UIPB 3RD2A 2NPTA 4MGYE 5JHBA 3N3KB 3VVWB 2OOBB 1MG8A 1LXDA 2XK5B 2ZNVB 5D6JB 3PLUA 3RCZA 2J0MA 2QHOA 4MSQB 4PS8A 4GXBA 3SDLC 2D3GA 3VTUA 3PPAA 4IWPA 2A5UA 4W9KA 3W1YA 2M4NA 3QAQA 5IA7A 5CHVC 1OEYA 4W9EA 4BVUC 2KXJA 3H7PA 4HCNB 4J6IA 5EDSA 2IO1B 3PRPB 3AU4A 2N1WA 4ZRJA 2MBBB 4B6WA 1E90A 4BBNC 3DBSA 2KLCA 2O6VA 4E3CA 2HJ8A 3CMMB 3A9JA 4FA6A 3BY4B 2MBOA 2MQJA 5JZEB 2V1YA 3ONSA 4IC7B 1V80A 2NPTB 4M8NA 3JVZX 3HM3A 1NBFC 4W9JA 2KWUB 2I1KA 2ZPNA 4HXDA 4WWPA 1VD2A 1LQBA 3TIXA 3S2AA 3BINA 1IP9A 3PT2B 4KVGB 4HPMB 5AZGA 2MBEA 3Q3JA 1UGMA 4GOCA 2LZ6A 2KTRA 4A20A 1WE6A 4KIKA 4YL8A 3V6EB 2HTHA 2CKHB 1K8RB 4BKGA 3WANA 3ZRFA 2D11A 2BWFA 5E6OA 1F9JA 1JRUA 2KJRA 2KX0A 3PLVA 2O6VB 2DHZA 2GBMA 3ZVVA 1EF5A 2DZKA 3A9JB 2WDTB 3L54A 2IZVB 2ZVOA 3NS8A 2J0KA 2YVCA 5L83A 2RR9A 3TCAA 3MHSD 3DBHI 2K8HA 1WM3A 2PEAA 3VQIA 4I6PA 2CHXA 3SHQA 4LJPB 3N32A 3A9KA 2GBKA 3R3MA 4JL9A 2C9WB 1V5OA 4LDTB 1WIAA 2YLMA 3ENEA 3VTVA 4NPNA 3KVFB 3R7QA 4HVBA 3V60A 2KDIA 2KJ6A 3B08A 4MSMB 2KTRB 2M1MA 4KIKB 4MGKE 5DCNA 4IWOA 4PS3A 4B95A 2NBWB 3L08A 5LXIB 2UYZB 3DBRI 4TKNA 4II3B 3NHEB 3ZUNA 2N9PC 4A3PA 2D07B 1WX7A 1WGDA 2FAZA 2MP2A 3UQAA 1H4RA 4F7ZA 2DAFA 1WE7A 3PGEA 4FJYA 3M63B 4IW0A 3W1SC 4EEWA 2OJRA 1RLFA 1XQQA 4KV2A 2EKEC 2LGXA 4ZRKA 5JHAA 3A9KB 2KJHB 1WXVA 3APDA 3ECIA 1ZKHA 2N9XA 1YD8U 3TJPA 2CHZA 1UBIA 2XBBC 4PYUA 2N1VA 4MELA 1V2YA 3W1SA 1WZ0A 2RSUA 4W9HA 1WJNA 3TMPB 2DENB 2ZPYA 5J17A 2LXAA 5G55A 3HK0A 2C5LC 2K39A 3VDZA 2KANA 5KHQA 2BYFA 2FUHB 2NVUI 3CF6E 3QHTA 2ZCCA 2ASQA 1WJ6A 2HE7A 2K8BA 3R66C 3VHTC 1OQYA 2LVPA 4FJZA 4EZKA 2KTFA 3HIZA 4CHKA 2RD0A 2AL3A 2JWZA 3IBEA 1YQBA 1WGGA 4HLEA 2KX3A 2IY0B 5L95C 2MP2B 5D2MB 1V81A 2NCNA 3VUXA 4GN1A 1KJTA 2A4ZA 2Z0EB 3ML8A 3PZDA 3KUCB 5HKHA 1WH3A 4FHKA 3PV1A 3QIJA 1WF9A 1WXAA 3RYTA 4ICVA 4BOZB 4IM2A 3RUIB 3H9DA 3WIMA 2DZIA 4M8MA 3VH3B
chains in the Genus database with same CATH superfamily
2BYEA 3O13A 3JYUA 1WYWB 2I1JA 2N9EB 4NQKE 2K8CA 1TY2A 2RPVA 2L00B 3OJ3A 4DK5A 1WR1A 5FR3A 3NOBA 1F0ZA 3R2TA 1C4AA 4IG7B 3KH0A 2LD9A 4BOSC 2RPQA 4MM3A 2BS2B 3A4SC 2ZVNA 4KSLC 1SIFA 4P7IA 1FRRA 1PYWD 1TY0A 2PIAA 5EE9A 4RGNA 3V61A 3JW0X 3Q3NC 2D2QA 2QIEB 3RI7C 2KWDA 4AP4C 1WZ3A 1P7FA 4DQOC 5H92C 5JH5C 2PKOA 1XD3B 3QK0A 1C77A 4P1BC 5BYQA 4K7UA 4W9LA 1Q0WB 1YN4A 2KDBA 4C4VB 2GB1A 1K51A 3L0WB 2PJHA 2E6XA 1M94A 2W54A 1WX9A 3M3JA 3HRDD 2FCQA 1TKGA 1TJEA 4UDUC 2BT6A 2AQ2B 2UWQA 2WX0A 3GZNI 3QC8B 3Q8CA 4IM0A 4K7SA 2AX5A 1PGXA 1RYJA 2WXHA 3MFGA 2M17A 4DXGA 3GOEA 4ANXA 3AU5A 1PUTA 5CHFA 3TEZA 2XN9C 2B3AA 4JLCA 3A1QA 4K81A 4L1BA 1FCCC 2V4LA 1YN5A 4MJSB 3RNGC 2BYVE 4ANVA 3DQVA 1SBBB 2AYOB 2BW2A 4NAWB 2KYWA 4HDOA 4KDIC 1PQSA 4XX5A 5C23A 4LNIA 3GS2A 2ZW0A 1QOBA 1HQRD 1I35A 2KFKA 4KGTA 2KC1A 2LVQA 3B1LX 2BQQA 4XZ4A 2JUOA 1NEKB 1UD7A 3KUDB 3VH4B 1S3SG 3D32A 3ZDTA 3PRMB 3E56A 4IOIE 3WALA 1XEEA 3BWUD 2NS5A 2J52A 4A55A 1A5RA 1XLNA 2LASA 2W3RA 4DXFA 3X0WA 3SU8X 2PPHA 2WNMA 2I38A 1TGZB 3ZLZA 5LLIA 3KUZA 2CR5A 3L4PA 1FNUA 4LNNA 5LNK1 3IAM1 1IYFA 2M19A 3PS6A 4AOFA 4PYZA 1D3ZA 3TSSA 5DPWA 5LXHA 2LGYA 3NZ3A 2NBVB 4GLSC 4ZOHC 3VUYA 2JPHA 2KDEB 5HG2A 1CMXB 1MI0A 1E8WA 3Q3OC 5KHOA 3AE8B 4OZBA 2K1FA 4II2B 2B76B 1YIWA 3ZTDA 4MDKE 2FIFA 4RGTA 4GDKB 1QOGA 2LI5A 1T0SC 2Y5CA 3ETRA 3EC8A 3GE8C 3PHWB 2REXA 3URYA 4LK0M 1XF5L 1L7YA 3LDZE 2ZJDA 2KN5A 2WXIA 4G0NB 5D7GA 4YTNB 4JIOU 2KO3A 4F8CB 5IP4D 2BF8B 4W9FA 2MWSB 1EU4A 2M0XA 3QX1A 2DX5B 2W9NA 3MHZA 4XWTA 4HCPB 4A6QA 1TS3A 1TS5A 5C2TB 1UZXB 5J18A 2AEHA 1HA5A 3LJ3A 4GDLA 1VZ6A 1LFDA 3NG0A 1NYQA 1OGWA 4TUUA 1GPXA 1EF1A 1C78A 2C60A 1HZ6A 4FJVB 1D4BA 1D6EC 1JCKB 1ZOYB 1WFYA 2R2QA 5FR6A 1UELA 3DVGX 4GIVA 2G1EA 4WJNA 3QQ8B 1I4HA 4OVUA 2XK5A 4ZYNA 1Z5SB 1ZXIA 1AN8A 2TSSA 2KVRA 2DYOA 1WX8A 3ZYYX 2WWZA 3O65B 2WQYB 1LO5D 4NY0A 4M0WB 3T3NA 2G45B 2WLBA 1YJ1A 2EKIA 1C3TA 4HJGE 2IO2B 5AUKA 3PVLA 3H8HA 2KACA 1J0GA 4N6EB 4OZCA 2KZRA 1K50A 3RD2A 1SE4A 3N3KB 1MG8A 5D6JB 3PLUA 2MH7A 1QOFA 3MJ5A 4MSQB 4PS8A 5JXVA 3SDLC 2D3GA 2A5UA 3QAQA 4W9EA 4HCNB 2R61A 3PRPB 4ZRJA 2MBBB 1E90A 4YXDB 2J42A 5BMIA 2L32A 3TUOA 3CMMB 1SF0A 3A9JA 2V1YA 2JZPA 4IC7B 1RFKA 3JVZX 4QAYA 2J53A 1N61A 2I1KA 1XLPA 3TIXA 3BINA 4L2YA 1IP9A 1YQ4B 1JW9D 4GOCA 1I7HA 3AB5A 4YL8A 1EWYC 2NMQA 2D11A 3WCQA 2BWFA 2DZKA 3I63C 3AEGB 2RDBC 5HFYA 5L83A 2RR9A 3DBHI 4WURA 1I4PA 4P16A 3NVZA 2CHXA 3SHQA 3A9KA 1WIAA 2YLMA 3R7QA 1E7PB 4KKJA 1TT5B 1V1PA 2GI9A 4TSSA 3RPFC 1ROEA 4KIKB 4PS3A 3DBRI 2PLPA 1WWTA 2INPE 2KN4A 2FAZA 1WGDA 4F7ZA 1WXQA 3PGEA 4EEWA 2OJRA 4RNAA 4BAXA 2QMTA 5JHAA 2ON8A 3ECIA 2N9XA 3FC4A 2CHZA 2N1VA 2X8XX 3RNCC 3W9CB 1WJNA 2ZPYA 2LHDA 4JE3B 3VRBB 5J17A 2K39A 5HI1A 3OG5A 3AE3B 2ASQA 1WJ6A 1XCQL 2LVPA 3RNFC 5L95C 5D2MB 1UNSA 3C8YA 3KUCB 3DBLB 1F2RC 1ZDVA 1NENB 1WF9A 3RYTA 1ZUD2 2DZIA 4M8MA 4PT5A 2PVOD 3RNEC 1OTRB 1UBQA 4NAMA 1SB3C 3DVGY 4RH6A 3ZRCA 3DWGC 5GXGB 4W9DA 2LWPA 1AYFA 5DPSA 1L4DB 2AL6A 3HHMA 2KKCA 1EWCA 1HE8A 3ZNHB 4ZHPA 3ZNZB 2G4DB 2HDEA 1DOXA 2W55A 3P1MA 4LNOA 4A9AA 3B2GA 1YN3A 3H7PB 3EGRA 4TQ0A 4ZDVA 4FHJA 3W5VB 3NY5A 1SXTA 1D5ZC 1ZPSA 1MJDA 2O6VD 3EUB2 3N20C 3EFCA 5AEKB 3LYYA 2DZJA 2WXRA 4M02A 1P7EA 1T5XD 2JYEA 3M95A 3TEXA 2WYQA 4IDIA 1IPGA 1TIFA 2W82A 1V86A 5CTRC 2FIDA 3A33B 2EMTA 4JPSA 2H89B 2PW9A 1K52A 1KM7A 1KH0A 2FCNA 3MJWA 4OVVA 4AWJA 2JF5A 4E71A 1U4AA 1C4PA 2C7NB 2PE9A 3PHXB 3KYDD 4BKSD 3SFDB 4NQLB 5C3JB 3BIID 1V49A 2MW5A 2RGFA 1F77A 4BKTA 2RMMA 2QCZA 1ENFA 4WWNA 1UWMA 2JXTA 2ZCBA 3N9YC 4RGMA 3C19A 2BYTA 4A90A 2YEPB 5BYRA 3VFKA 1P3QU 1N5WA 3N30A 4ACFA 1F1HA 1MVKA 2INCC 4HEA1 4GGQA 4EFOA 4HJKA 1WYGA 3SFEB 1C79A 1UWXA 3PTFC 4WQOB 1R4NI 2LHEA 1EUVB 1YQ3B 2WGSA 1WXMA 1IGCA 1CQVA 1WMHB 3RULA 1WJ4A 3PREA 4WH4A 1SEBD 4OZAA 2KVZA 1T0RC 2C7MB 2MCNB 2L7RA 2EMSA 2ZEQA 4AQ7A 3N1ZC 4AUQC 3DCGA 3OWEB 4DDGD 4EUTA 3CSTA 1HZ5A 1FNVA 2ACZB 2D3BA 2IO3B 5EE0A 4RMAA 2PVGC 4WJOA 2WDVB 2MSED 4G11A 3TL5A 3IG3A 4K7WA 5MPOA 4JWUC 2KK8A 1UGJA 2KDFB 2KAJA 2L83A 3VXWA 4TMAB 5IAAC 3APCA 3HM6X 2AWTA 1J19A 1VCBA 3B2FA 3UIOB 4HWIB 2FNJB 2GMIC 4C56C 3T8MA 1TTNA 3JSVA 2O2VB 1ZE3D 2LRWA 2MA9B 1E8YA 3ZXRA 3UQBA 1JALA 4I6LB 1GB1A 1KLVA 4LCDE 3RN9C 4EZLA 1OEYJ 3R2IA 4NJ7A 2Q5WD 4MEMA 4GSWA 4EE2A 1G6JA 5IN7A 3EHVA 3L16A 3KWVA 1SGHA 1Y8RC 1RM6C 1C4CA 1VZ7A 2KMCA 1ESFA 4X57B 2QDFA 2FE8A 1VR9A 1WGHA 1YX6B 4FBJB 1FRDA 3PO0A 1F2RI 1K53A 2LRUA 1VZ8A 4DXAB 3MC9A 1V8CA 2JVCA 1V6EA 3KWLA 2C7HA 3ZJUA 4MH0E 3Q8AA 2CJOA 1FD6A 2IO0B 3ALBA 1ET9A 4ZRIA 1I4XA 4TQ1A 3WAMA 3RZFA 4XC2A 2WDQB 1WY8A 2VZKB 3NJTA 4RGOS 4AJWA 4RM9A 3U8ZA 1R4MB 4HKQA 2WU5B 4MGYE 5JHBA 3VVWB 2OOBB 1LXDA 4PK1A 2ZNVB 1N63A 3VTUA 3DHGC 3PPAA 3P63A 4W9KA 3W1YA 1E0ZA 1UUPA 3H7PA 2N1WA 3RNAC 1MG4A 2QEJC 3ZJTA 4FA6A 4REZA 2MBOA 2MQJA 5JZEB 2BTEA 3U52E 1TZOA 2NPTB 4M8NA 3HM3A 2GRIA 2ZPNA 2X38A 4WWPA 3NS1A 2BVCA 3HUIA 4Q2JA 1IBXB 3VR9B 4HPMB 3Q3JA 1UGMA 3UI3A 2QILA 1WGKA 3ZRFA 5E6OA 1F9JA 3PLVA 1N6ZA 2KJRA 2KX0A 2M56B 2O6VB 2GBMA 1L6VA 2V4IB 2WXQA 1SE2A 2IDYA 2ZVOA 2J0KA 3MHSD 2K8HA 1FMAD 1ZP0B 2AQ1B 2PEAA 4I6PA 3FILB 4JL9A 4B0MA 1KRHA 3VTVA 1L5PA 3VR8B 2KJ6A 1MFWA 2KTRB 2M1MA 5DCNA 2INNE 2NBWB 5LXIB 1SJED 1FPYA 3FKYA 4TKNA 4II3B 1FCLA 5IOIA 2D07B 3UQAA 4YTPB 2DAFA 3M63B 1RLFA 3P4QB 2KJHB 1YD8U 4MELA 1WZ0A 4RCOA 2RSUA 3HK0A 2IPKD 3VDZA 5KHQA 2FUHB 2HTME 3R66C 3VHTC 1OQYA 4B0EA 3AEFB 1JQ4A 3HIZA 4MACA 4CHKA 2AL3A 4P1CC 2KX3A 1DGJA 2K5PA 2IY0B 2MP2B 5E6JA 3Q69A 4YSZB 4GN1A 3PZDA 1D5MC 3ML8A 2DBYA 1ZXHA 4FHKA 2QSDA 2L1AA 4ICVA 4ZRQA 3VH3B 4IUMB 2L52A 4HK2A 4O1NA 5G5GA 2CU1A 2N7EA 4DBGA 2OEDA 4GMVA 4BBNF 5AZHA 3QWZB 4C4VA 1HTOA 2ZZPB 3NRZA 1GNUA 2SEBD 4RF1A 3RZWC 1BUIC 4US8A 4RFBA 4L23A 2JZ3B 1E7UA 1L0VB 4JX1C 2MJ3A 2V3NA 5BO4B 1L0XB 1RFAA 2H88B 2MHJA 1I42A 1JMLA 1XLQA 4ZRPA 4EZJA 4MM3B 4MJSA 4USAA 4FN2A 3UF8A 4HROA 5BYSA 4WJQA 1OQRA 5G2NA 1FXIA 4NAWA 1RWSA 2LJ5A 3KLSX 3CWIA 1Q10A 1GG3A 2WDRB 1P1AA 1JWUD 1SE9A 2J4XA 3AE1B 4EOYA 1QZEA 2KNBA 2L0FA 2KWVB 1YJJA 2BS4B 4LJOB 2D3CA 1JWAD 1YMHE 4DWFA 2MJEA 3BZDB 1CJEA 1Z2MA 1WRDB 3NVYA 3ZDMC 2LEKA 2L05A 3H7SA 3HVZA 3RNBC 2LUEA 2LJIA 2VH2A 2V0GA 3SEBA 4ITKA 4G50A 3ABVB 1MHHE 1XO3A 3EFUA 1T3QA 3BVGA 1Q1OA 2BPSA 1AWDA 2JXXA 2Y3AA 1VLBA 3KYCD 1T6BX 2Y5PA 3A1QB 1JWSD 1V5TA 3VUWA 1GJZA 2QJLA 2VZKD 3U7ZA 2CS4A 4K1RB 3VAWA 2DYMA 3L17A 4NJCA 1E9MA 2JRIB 4M00A 2WXKA 2KMAA 4YTMB 1HXYD 4WJPA 3KW5B 1QT9A 1WR6E 3APFA 1BXTA 2KFKB 4IKGA 3IFWB 3T3OA 1SJHD 1NDDA 2GBRA 2XNAC 1T0QC 2BGFA 1E8ZA 1FXAA 2LGDA 2G4SA 4RF0A 4WAAA 1YX5B 2G3QB 2L0TA 4E74A 4GDKA 2NBUA 5FKAC 2IGGA 4WWMA 1KLGD 4A3OA 1V9JA 3QA8A 3NZUA 3IHPC 1KOTA 2NR2A 5CX3A 3J9CA 4A8XC 2KOXA 3X23A 4FLHA 2KHWB 2WXFA 4C80A 4DHJB 4CYEA 1UF0A 1N5XA 2N9LA 1L0YB 2L3ZA 4FADA 2FCSA 3R7RA 2DLBA 1XLOA 1TZ1A 3Q3FA 1YOVB 2IGHA 3IT6B 2FUG1 3Q8BA 3IVFA 1DOIA 3K9OB 2MBHA 1F52A 3DBLI 3BK2A 4KZ0A 1HEZE 1C1YB 1LGRA 1Q5WB 2V3SA 4AJYB 3K9PB 1X1MA 1VDVA 2KQ7A 4BKSA 3CSFA 4JQWC 3RMKC 3AE4B 1AW7A 2J0JA 4B9KA 3DWMA 4JGHB 1LM8B 2WXJA 3EECA 4RM8A 3W5UB 2JT4B 4S0RA 1E8XA 3L13A 2CHWA 2N7DA 4ANUA 1KF6B 1B9RA 3T9LA 4KDLB 4M0WA 5IO9A 2I2YA 4BFRA 2M8SA 3TEYA 4H2AA 2OJWA 2RDHA 2ZNVC 1P0RA 2D3AA 3ZNID 3AULA 1H8CA 3NZSA 3MP9A 2SAKA 3IAS1 1V97A 4KSKC 3B9JA 1P9DU 2WX1A 2M0AA 1CK1A 3TEWA 3QCAA 4D2KA 4GDLB 2WU2B 1WSPA 1VRAB 4YSYB 4F1SA 3P4RB 3H1UA 2KQ4X 3H6NA 5HHDG 2R2OA 2E3TA 3L10B 3ZO5B 2KLGA 3GZNB 5GMVA 2KDMA 4R3DA 1JWBD 2KFJA 4ARCA 2DWQA 2WHIA 2XK5B 1N62A 3RCZA 1DYQA 2MEKA 4C7YA 4HRSA 2JYTA 5H8YE 1M4VA 3BYYB 2LGIA 4BVUC 4J6IA 1GOZA 2JU6X 3AEEB 3AU4A 3BVZA 1PGAA 4KGSA 4E3CA 4LTUA 3HVDA 3PZ8A 3LB8C 4K3CA 3I57A 4C00A 5IKCM 2JX5A 5G5HA 1LQBA 1JROA 3PT2B 3ZGZA 5AZGA 2MBEA 4MT5A 1FEHA 1JRPA 4A20A 1WE6A 4KIKA 3V6EB 1K8RB 3WANA 1EU3A 3SR6A 2K9XA 3A9JB 2ZW1A 2WDTB 3L54A 2IZVB 3AEAB 3NS8A 2YVCA 2BBCA 1BMLC 3VQIA 4HPPA 3N32A 3DHIC 4LDTB 2C9WB 1V5OA 3ENEA 1KFYB 3KVFB 3V60A 3AEDB 3VRAB 3B08A 4ZYSA 4MGKE 3NVWA 3N1YC 2UU7A 4B95A 3L08A 1R7SA 4KGRA 4XE0A 1WX7A 1EM7A 1WE7A 2KMMA 4IW0A 3W1SC 1XQQA 4KV2A 2EKEC 2LGXA 4ZRKA 3A9KB 4US9A 3TJPA 1UBIA 2AQ3B 2WP9B 3GP7A 1V1PB 4W9HA 2V9HA 3TMPB 2LXAA 2KANA 2BYFA 3QHTA 2K8BA 4S17A 1J7AA 5FK9C 4EZKA 2RD0A 1YQBA 1V81A 2NCNA 2K0PA 3VUXA 2A4ZA 3U2SC 1ZDXA 5HKHA 1WH3A 3PV1A 3QIJA 1WXAA 4BOZB 3RUIB 2D5GA 1QLBB 4M01A 1QILA 4GU2A 3Q14C 2LUMA 4KX6B 2JRHA 3AE5B 2N7JA 3Q3MC 4LNFA 1RAXA 4ASWC 1E5WA 4GB9A 4I6NB 1P98A 5I4DA 3V05A 4ICUA 3AE6B 3P4SB 4ZHOA 1J8CA 1I4GA 3Q8EA 2DAJA 4DHJD 5AZFA 3EA6A 5D3IB 1XT9B 3KQ4A 3QARA 4HPLB 3LXFA 3P4PB 3AE2B 3DHHC 5BMHA 4W9GA 1WM2A 3DVNU 1FFVA 3ZTCA 4JWSC 2MBQA 5DPTA 2BKRB 3ZKJC 3V62A 2L76A 2WXLA 2DZMA 2JY6A 3UINB 4WQMA 1OQQA 2HJ1A 1SSNA 3Q8FA 1A70A 4G3XB 2DYBA 2V3PA 4N9F4 4C7ZA 2K6DB 1XCTL 4HDQA 3ZQ4A 4WWOA 1TS2A 4NZLB 3E9SA 3I3TB 5E6NA 2JSVX 2VRRB 1R4MI 4PS7A 2RDGA 1WJUA 3I9V1 1NI3A 1NYRA 2MLBA 2YEPF 3TBLD 3DVNV 4MH8A 4J3OD 1RRBA 4URKA 4XWWA 1MPEA 3I5JC 3DPDA 4ANWA 3GE3C 3OJ4B 1SIJA 3ZJVA 1TBEA 1E6EB 3QJZA 3ML9A 4YWGG 1I4QA 1EO6A 3A4RA 1I4RA 3U30A 3NVVA 3WAOA 2Z0DB 1S1QB 3ZNGC 1HTQA 4LNKA 3PRZA 2KC2A 2INDC 4HKZE 1BT0A 2BWES 1ET6A 2PE6B 3P2BA 2NTSA 5AUIA 1YNTE 4OW0A 4NJ6A 3AV8A 3MTNB 1WMHA 4WAFA 4XDCA 1L6UA 3AXCA 1FM0D 4FULA 4LLGM 5DPRA 4KZCA 2PTLA 3WA0A 1L4ZB 3SD5A 2K25A 3B0AA 2JZZA 3V6CB 1FFUA 4DHZE 3M62B 1C9FA 3AI5A 1ZGUB 1WGYA 2BKFA 1QOAA 1NI2A 3DBHB 3P42A 4N59A 1T0YA 4CQNA 2Z59B 3PSEB 1E7VA 2EELA 1YJIA 2LMCA 3DDCB 2LXCA 1B1ZA 4XDDA 4FXCA 1E10A 5TR5A 3PZ7A 3C0RB 4YSXB 2LGSA 1WI0A 2IYDB 2MRPA 2LFIA 3DBRB 1J7CA 3DOWA 3BYTB 1TKYA 2GBJA 3N1XC 4K3BA 5D94A 2JQRB 4IM3A 2G9HD 2KQSA 2O2VA 1GUAB 3RT3B 3R8BA 4MGZE 4CO7A 3GB1A 3U7DA 2KWCA 1XXGA 1QF6A 2IGDA 1NVID 3AECB 1UH6A 2GOWA 1ZW7A 4MGIE 2D10A 5T8IA 3NUHB 5EE3A 1QKZA 3WAPA 1OFFA 2GBNA 4LDTD 4XYCA 1TS4A 1IUEA 2W3SA 2FCMA 1AARA 2MX2A 2HD5B 4W9IA 2K22A 4TV3A 4XGAB 1FO4A 2BB5A 2WXOA 2N4FA 1ISNA 2BS3B 3UGBB 4AS1A 2DNFA 2K6QA 2KD0A 4NNJB 4DDID 4W9CA 4DHZB 5C1ZA 1WXSA 3MC0B 3ZIMA 3JSVB 2Z8LA 5E6PA 2Y5BB 1JWMD 3VTWA 5D3DA 2NTTA 5J2RA 1L2NA 3AEBB 4P6VF 4EKUA 2OHFA 3OAWA 3AH7A 3OLMD 1SE3A 3Q6BA 2K3UA 4ARIA 2J7QB 3FAHA 2XEWA 5CHWA 1D5XC 1FXTB 4IWQA 1WGRA 1GC7A 3ZW3A 3CIRB 2LVOA 1GC6A 2L8JA 2IBIB 2WS3B 3AE7B 4OHJA 2IY1B 3AM9A 1FNWA 3UIPB 1PDXA 2NPTA 2WXGA 2N0SB 3RFZB 1IGDA 3ZXVA 2CU3A 2J0MA 2QHOA 1J7BA 4GXBA 4OVZA 2CJNA 4IWPA 1IBXA 2KT7A 2M4NA 5IA7A 5CHVC 1OEYA 2KXJA 5EDSA 1TYGB 2IO1B 4B6WA 3W2DA 4BBNC 3DBSA 3U4EG 1VJKA 2KLCA 2O6VA 2HJ8A 5EE1A 2N9KA 3BY4B 1PGBA 3ONSA 1V80A 1NBFC 4W9JA 5BMGA 2KWUB 3Q2AC 1ACCA 3FILA 1KTKA 4HXDA 1Y56A 1VD2A 3S2AA 1C76A 2FBWB 4KVGB 2LZ6A 2KTRA 2HTHA 2CKHB 4BKGA 3MC8A 1KLUD 1JRUA 2ONQA 3ZVVA 2DHZA 2IJ0A 1EF5A 1WRIA 1R4NB 3TCAA 1WM3A 4KKIA 4LJPB 2GBKA 3R3MA 2WXPA 3AE9B 4NPNA 4YT0B 4HVBA 2KDIA 4MSMB 2BB6A 2WXNA 3AMZA 3AN1A 4IWOA 1FIQA 1TKEA 2UYZB 2WXMA 3NHEB 2VH1A 3ZUNA 2N9PC 4A3PA 2MP2A 1H4RA 3V3XA 3BVMA 4FJYA 1V1OA 2ICIA 3BK1A 1CZPA 1N60A 3APDA 1WXVA 1ZKHA 2QC8A 2XBBC 4PYUA 2PMVA 1V2YA 3W1SA 2JWUA 1GAQB 4N58A 1QQRA 2DENB 3IXSA 5G55A 2C5LC 1DOYA 2NVUI 3CF6E 2ZCCA 2HE7A 1PFDA 4FJZA 2GLSA 2KTFA 2JWZA 3IBEA 4HLEA 1WGGA 5TSSA 2MJDA 1MHXA 3IT4B 4BZAA 1KJTA 2Z0EB 4WIPA 1STEA 4IM2A 3H9DA 3WIMA 1GB4A
chains in the Genus database with same CATH topology
2BYEA 4HK2A 4IUMB 3JYUA 1WYWB 2CU1A 2N7EA 2I1JA 4GU2A 4DBGA 1OTRB 2N9EB 2JRHA 2K8CA 4NQKE 1UBQA 2L00B 3DVGY 3OJ3A 4DK5A 1RAXA 1WR1A 3NOBA 3ZRCA 4IG7B 4ASWC 1E5WA 3KH0A 2LD9A 4GMVA 4GB9A 4I6NB 4W9DA 4BBNF 5AZHA 4BOSC 1P98A 2LWPA 2RPQA 3QWZB 5DPSA 4MM3A 2AL6A 4ICUA 3A4SC 3HHMA 2ZVNA 2KKCA 2ZZPB 4KSLC 1GNUA 1SIFA 4P7IA 1J8CA 3RZWC 2DAJA 4DHJD 1HE8A 5AZFA 3ZNHB 2JZ3B 3ZNZB 2G4DB 1XT9B 3V61A 3JW0X 3QARA 2D2QA 4HPLB 1E7UA 4AP4C 1WZ3A 5BO4B 4W9GA 1WM2A 3DVNU 5JH5C 1XD3B 1RFAA 3H7PB 3QK0A 3ZTCA 4TQ0A 4ZDVA 1I42A 2MBQA 4FHJA 5DPTA 3NY5A 2O6VD 2BKRB 4K7UA 4W9LA 5AEKB 1Q0WB 3ZKJC 2KDBA 4EZJA 3V62A 3L0WB 2L76A 4FN2A 2DZMA 2PJHA 2JY6A 4MJSA 1M94A 3UF8A 3UINB 2DZJA 1WX9A 3M3JA 2FCQA 4G3XB 3M95A 4WJQA 2DYBA 2WYQA 4N9F4 2K6DB 5G2NA 4HDQA 4NAWA 4WWOA 2WX0A 2UWQA 3GZNI 3QC8B 4K7SA 4IM0A 1IPGA 2LJ5A 3I3TB 2M17A 1GG3A 2VRRB 5E6NA 1P1AA 1R4MI 1SE9A 3AU5A 3GOEA 1V86A 5CTRC 4PS7A 4ANXA 4EOYA 1WJUA 1QZEA 5CHFA 2KNBA 2MLBA 2L0FA 2KWVB 2B3AA 2FIDA 4LJOB 4JLCA 3DVNV 3A1QA 3A33B 4K81A 3TBLD 2EMTA 1RRBA 4URKA 1KM7A 2V4LA 4ANVA 4MJSB 2FCNA 2BYVE 3MJWA 3DQVA 3DPDA 4OVVA 4AWJA 4DWFA 2JF5A 4ANWA 4E71A 1Z2MA 3OJ4B 1U4AA 2C7NB 1WRDB 1TBEA 3ZDMC 2PE9A 3PHXB 3QJZA 2AYOB 3KYDD 3ML9A 4BKSD 2L05A 3H7SA 1EO6A 2LUEA 3A4RA 4NQLB 3U30A 4NAWB 3WAOA 1V49A 2Z0DB 2MW5A 1S1QB 4HDOA 3ZNGC 4KDIC 1PQSA 4G50A 4XX5A 5C23A 3EFUA 2RGFA 3PRZA 1Q1OA 2KC2A 4BKTA 1BT0A 2BWES 2BPSA 2JXXA 2PE6B 3P2BA 3KYCD 4WWNA 3A1QB 4NJ6A 1I35A 2KFKA 3MTNB 1WMHA 1V5TA 2ZCBA 2KC1A 3VUWA 1GJZA 2LVQA 3AXCA 3B1LX 4XZ4A 2JUOA 4FULA 2CS4A 1P3QU 4K1RB 3VAWA 2DYMA 3VFKA 3N30A 5DPRA 3L17A 1UD7A 4KZCA 3KUDB 3WA0A 3SD5A 2K25A 3B0AA 2JRIB 2JZZA 3V6CB 3VH4B 4DHZE 1S3SG 2KMAA 3M62B 4GGQA 4EFOA 4HJKA 3D32A 3ZDTA 3PRMB 4WJPA 3AI5A 1ZGUB 1WGYA 3WALA 3PTFC 4WQOB 2BKFA 1R4NI 2NS5A 3KW5B 1NI2A 1EUVB 1A5RA 2LASA 3X0WA 1T0YA 3SU8X 2PPHA 1WR6E 1WXMA 3APFA 1TGZB 2KFKB 2Z59B 1WMHB 3RULA 3IFWB 5LLIA 3PSEB 3ZLZA 1WJ4A 1E7VA 3KUZA 3PREA 3DDCB 2LXCA 1NDDA 2GBRA 2BGFA 2CR5A 1E8ZA 2LGDA 1IYFA 2G4SA 5TR5A 3C0RB 4WAAA 1YX5B 2G3QB 2L0TA 3PS6A 4GDKA 4E74A 1WI0A 4AOFA 4PYZA 2C7MB 2MCNB 2IYDB 2MRPA 1D3ZA 5DPWA 2L7RA 5LXHA 2NBUA 2EMSA 2ZEQA 2LGYA 3DOWA 2NBVB 4AUQC 3DCGA 2GBJA 3VUYA 4DDGD 4EUTA 2JPHA 4A3OA 2KDEB 1V9JA 3QA8A 4IM3A 5D94A 2KQSA 2O2VA 3NZUA 1GUAB 3CSTA 3RT3B 1CMXB 1E8WA 2IO3B 4MGZE 4CO7A 5KHOA 4RMAA 3U7DA 3IHPC 1KOTA 2KWCA 2NR2A 4WJOA 2MSED 4G11A 5CX3A 2K1FA 4II2B 3TL5A 3IG3A 2KOXA 3X23A 1UH6A 1YIWA 2GOWA 4FLHA 4K7WA 4MDKE 3ZTDA 2FIFA 2KHWB 2KK8A 4DHJB 1ZW7A 2KDFB 4GDKB 4MGIE 2LI5A 3VXWA 4CYEA 3EC8A 2D10A 2L3ZA 4FADA 3PHWB 2REXA 5IAAC 2FCSA 3APCA 3R7RA 3WAPA 3HM6X 1L7YA 2GBNA 2AWTA 3LDZE 1TZ1A 1J19A 1VCBA 4LDTD 3UIOB 2ZJDA 2FNJB 2GMIC 2KN5A 4HWIB 3Q3FA 3T8MA 1TTNA 3JSVA 4G0NB 2O2VB 5D7GA 3IVFA 4JIOU 2KO3A 2LRWA 3K9OB 2MBHA 2FCMA 4F8CB 2MA9B 1E8YA 2BF8B 3DBLI 4W9FA 1AARA 2MWSB 2MX2A 4KZ0A 3UQBA 2M0XA 3QX1A 2HD5B 1C1YB 4W9IA 2DX5B 2W9NA 4I6LB 1Q5WB 4HCPB 2V3SA 1KLVA 4LCDE 4TV3A 4AJYB 3K9PB 4EZLA 1OEYJ 1X1MA 2KQ7A 2N4FA 4NJ7A 4BKSA 4MEMA 1UZXB 3CSFA 1ISNA 4GSWA 4JQWC 5J18A 1G6JA 2AEHA 3UGBB 2J0JA 4B9KA 3EHVA 3L16A 1SGHA 2K6QA 2KD0A 4JGHB 1LM8B 4NNJB 1Y8RC 3LJ3A 4W9CA 4DDID 4DHZB 5C1ZA 4GDLA 3EECA 4RM8A 1LFDA 2KMCA 1WXSA 2JT4B 3ZIMA 3JSVB 1E8XA 1OGWA 3L13A 2CHWA 5E6PA 4TUUA 4X57B 1EF1A 2N7DA 2Y5BB 4ANUA 3T9LA 3VTWA 4KDLB 1WGHA 5J2RA 4BFRA 2M8SA 1YX6B 2C60A 1L2NA 4FJVB 4FBJB 4EKUA 2ZNVC 3OAWA 1P0RA 1WFYA 2R2QA 3OLMD 5FR6A 1UELA 2LRUA 3DVGX 3ZNID 3AULA 1H8CA 4GIVA 4DXAB 3NZSA 4WJNA 2JVCA 3QQ8B 1V6EA 4KSKC 4OVUA 1P9DU 2C7HA 2J7QB 2WX1A 2XK5A 4ZYNA 4MH0E 2XEWA 3QCAA 1Z5SB 5CHWA 4GDLB 2KVRA 2DYOA 1FXTB 2IO0B 1WX8A 3ALBA 4IWQA 1WGRA 1GC7A 3ZW3A 4F1SA 2WWZA 3O65B 4ZRIA 2LVOA 3H1UA 4TQ1A 3WAMA 3H6NA 4NY0A 4M0WB 1GC6A 2G45B 2R2OA 3RZFA 3L10B 4XC2A 1YJ1A 1C3TA 2L8JA 2IO2B 3ZO5B 2IBIB 1WY8A 2KLGA 3PVLA 4AJWA 5GMVA 2IY1B 4RM9A 3U8ZA 1J0GA 2KZRA 2KFJA 3UIPB 3RD2A 2NPTA 4MGYE 5JHBA 3N3KB 3VVWB 2OOBB 1MG8A 1LXDA 2XK5B 2ZNVB 5D6JB 3PLUA 3RCZA 2J0MA 2QHOA 4MSQB 4PS8A 4GXBA 3SDLC 2D3GA 3VTUA 3PPAA 4IWPA 2A5UA 4W9KA 3W1YA 2M4NA 3QAQA 5IA7A 5CHVC 1OEYA 4W9EA 4BVUC 2KXJA 3H7PA 4HCNB 4J6IA 5EDSA 2IO1B 3PRPB 3AU4A 2N1WA 4ZRJA 2MBBB 4B6WA 1E90A 4BBNC 3DBSA 2KLCA 2O6VA 4E3CA 2HJ8A 3CMMB 3A9JA 4FA6A 3BY4B 2MBOA 2MQJA 5JZEB 2V1YA 3ONSA 4IC7B 1V80A 2NPTB 4M8NA 3JVZX 3HM3A 1NBFC 4W9JA 2KWUB 2I1KA 2ZPNA 4HXDA 4WWPA 1VD2A 1LQBA 3TIXA 3S2AA 3BINA 1IP9A 3PT2B 4KVGB 4HPMB 5AZGA 2MBEA 3Q3JA 1UGMA 4GOCA 2LZ6A 2KTRA 4A20A 1WE6A 4KIKA 4YL8A 3V6EB 2HTHA 2CKHB 1K8RB 4BKGA 3WANA 3ZRFA 2D11A 2BWFA 5E6OA 1F9JA 1JRUA 2KJRA 2KX0A 3PLVA 2O6VB 2DHZA 2GBMA 3ZVVA 1EF5A 2DZKA 3A9JB 2WDTB 3L54A 2IZVB 2ZVOA 3NS8A 2J0KA 2YVCA 5L83A 2RR9A 3TCAA 3MHSD 3DBHI 2K8HA 1WM3A 2PEAA 3VQIA 4I6PA 2CHXA 3SHQA 4LJPB 3N32A 3A9KA 2GBKA 3R3MA 4JL9A 2C9WB 1V5OA 4LDTB 1WIAA 2YLMA 3ENEA 3VTVA 4NPNA 3KVFB 3R7QA 4HVBA 3V60A 2KDIA 2KJ6A 3B08A 4MSMB 2KTRB 2M1MA 4KIKB 4MGKE 5DCNA 4IWOA 4PS3A 4B95A 2NBWB 3L08A 5LXIB 2UYZB 3DBRI 4TKNA 4II3B 3NHEB 3ZUNA 2N9PC 4A3PA 2D07B 1WX7A 1WGDA 2FAZA 2MP2A 3UQAA 1H4RA 4F7ZA 2DAFA 1WE7A 3PGEA 4FJYA 3M63B 4IW0A 3W1SC 4EEWA 2OJRA 1RLFA 1XQQA 4KV2A 2EKEC 2LGXA 4ZRKA 5JHAA 3A9KB 2KJHB 1WXVA 3APDA 3ECIA 1ZKHA 2N9XA 1YD8U 3TJPA 2CHZA 1UBIA 2XBBC 4PYUA 2N1VA 4MELA 1V2YA 3W1SA 1WZ0A 2RSUA 4W9HA 1WJNA 3TMPB 2DENB 2ZPYA 5J17A 2LXAA 5G55A 3HK0A 2C5LC 2K39A 3VDZA 2KANA 5KHQA 2BYFA 2FUHB 2NVUI 3CF6E 3QHTA 2ZCCA 2ASQA 1WJ6A 2HE7A 2K8BA 3R66C 3VHTC 1OQYA 2LVPA 4FJZA 4EZKA 2KTFA 3HIZA 4CHKA 2RD0A 2AL3A 2JWZA 3IBEA 1YQBA 1WGGA 4HLEA 2KX3A 2IY0B 5L95C 2MP2B 5D2MB 1V81A 2NCNA 3VUXA 4GN1A 1KJTA 2A4ZA 2Z0EB 3ML8A 3PZDA 3KUCB 5HKHA 1WH3A 4FHKA 3PV1A 3QIJA 1WF9A 1WXAA 3RYTA 4ICVA 4BOZB 4IM2A 3RUIB 3H9DA 3WIMA 2DZIA 4M8MA 3VH3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYE A;  4HK2 A;  4IUM B;  3JYU A;  1WYW B;  2CU1 A;  2N7E A;  2I1J A;  4GU2 A;  4DBG A;  1OTR B;  2N9E B;  2JRH A;  2K8C A;  4NQK E;  1UBQ A;  2L00 B;  3DVG Y;  3OJ3 A;  4DK5 A;  1RAX A;  1WR1 A;  3NOB A;  3ZRC A;  4IG7 B;  4ASW C;  1E5W A;  3KH0 A;  2LD9 A;  4GMV A;  4GB9 A;  4I6N B;  4W9D A;  4BBN F;  5AZH A;  4BOS C;  1P98 A;  2LWP A;  2RPQ A;  3QWZ B;  5DPS A;  4MM3 A;  2AL6 A;  4ICU A;  3A4S C;  3HHM A;  2ZVN A;  2KKC A;  2ZZP B;  4KSL C;  1GNU A;  1SIF A;  4P7I A;  1J8C A;  3RZW C;  2DAJ A;  4DHJ D;  1HE8 A;  5AZF A;  3ZNH B;  2JZ3 B;  3ZNZ B;  2G4D B;  1XT9 B;  3V61 A;  3JW0 X;  3QAR A;  2D2Q A;  4HPL B;  1E7U A;  4AP4 C;  1WZ3 A;  5BO4 B;  4W9G A;  1WM2 A;  3DVN U;  5JH5 C;  1XD3 B;  1RFA A;  3H7P B;  3QK0 A;  3ZTC A;  4TQ0 A;  4ZDV A;  1I42 A;  2MBQ A;  4FHJ A;  5DPT A;  3NY5 A;  2O6V D;  2BKR B;  4K7U A;  4W9L A;  5AEK B;  1Q0W B;  3ZKJ C;  2KDB A;  4EZJ A;  3V62 A;  3L0W B;  2L76 A;  4FN2 A;  2DZM A;  2PJH A;  2JY6 A;  4MJS A;  1M94 A;  3UF8 A;  3UIN B;  2DZJ A;  1WX9 A;  3M3J A;  2FCQ A;  4G3X B;  3M95 A;  4WJQ A;  2DYB A;  2WYQ A;  4N9F 4;  2K6D B;  5G2N A;  4HDQ A;  4NAW A;  4WWO A;  2WX0 A;  2UWQ A;  3GZN I;  3QC8 B;  4K7S A;  4IM0 A;  1IPG A;  2LJ5 A;  3I3T B;  2M17 A;  1GG3 A;  2VRR B;  5E6N A;  1P1A A;  1R4M I;  1SE9 A;  3AU5 A;  3GOE A;  1V86 A;  5CTR C;  4PS7 A;  4ANX A;  4EOY A;  1WJU A;  1QZE A;  5CHF A;  2KNB A;  2MLB A;  2L0F A;  2KWV B;  2B3A A;  2FID A;  4LJO B;  4JLC A;  3DVN V;  3A1Q A;  3A33 B;  4K81 A;  3TBL D;  2EMT A;  1RRB A;  4URK A;  1KM7 A;  2V4L A;  4ANV A;  4MJS B;  2FCN A;  2BYV E;  3MJW A;  3DQV A;  3DPD A;  4OVV A;  4AWJ A;  4DWF A;  2JF5 A;  4ANW A;  4E71 A;  1Z2M A;  3OJ4 B;  1U4A A;  2C7N B;  1WRD B;  1TBE A;  3ZDM C;  2PE9 A;  3PHX B;  3QJZ A;  2AYO B;  3KYD D;  3ML9 A;  4BKS D;  2L05 A;  3H7S A;  1EO6 A;  2LUE A;  3A4R A;  4NQL B;  3U30 A;  4NAW B;  3WAO A;  1V49 A;  2Z0D B;  2MW5 A;  1S1Q B;  4HDO A;  3ZNG C;  4KDI C;  1PQS A;  4G50 A;  4XX5 A;  5C23 A;  3EFU A;  2RGF A;  3PRZ A;  1Q1O A;  2KC2 A;  4BKT A;  1BT0 A;  2BWE S;  2BPS A;  2JXX A;  2PE6 B;  3P2B A;  3KYC D;  4WWN A;  3A1Q B;  4NJ6 A;  1I35 A;  2KFK A;  3MTN B;  1WMH A;  1V5T A;  2ZCB A;  2KC1 A;  3VUW A;  1GJZ A;  2LVQ A;  3AXC A;  3B1L X;  4XZ4 A;  2JUO A;  4FUL A;  2CS4 A;  1P3Q U;  4K1R B;  3VAW A;  2DYM A;  3VFK A;  3N30 A;  5DPR A;  3L17 A;  1UD7 A;  4KZC A;  3KUD B;  3WA0 A;  3SD5 A;  2K25 A;  3B0A A;  2JRI B;  2JZZ A;  3V6C B;  3VH4 B;  4DHZ E;  1S3S G;  2KMA A;  3M62 B;  4GGQ A;  4EFO A;  4HJK A;  3D32 A;  3ZDT A;  3PRM B;  4WJP A;  3AI5 A;  1ZGU B;  1WGY A;  3WAL A;  3PTF C;  4WQO B;  2BKF A;  1R4N I;  2NS5 A;  3KW5 B;  1NI2 A;  1EUV B;  1A5R A;  2LAS A;  3X0W A;  1T0Y A;  3SU8 X;  2PPH A;  1WR6 E;  1WXM A;  3APF A;  1TGZ B;  2KFK B;  2Z59 B;  1WMH B;  3RUL A;  3IFW B;  5LLI A;  3PSE B;  3ZLZ A;  1WJ4 A;  1E7V A;  3KUZ A;  3PRE A;  3DDC B;  2LXC A;  1NDD A;  2GBR A;  2BGF A;  2CR5 A;  1E8Z A;  2LGD A;  1IYF A;  2G4S A;  5TR5 A;  3C0R B;  4WAA A;  1YX5 B;  2G3Q B;  2L0T A;  3PS6 A;  4GDK A;  4E74 A;  1WI0 A;  4AOF A;  4PYZ A;  2C7M B;  2MCN B;  2IYD B;  2MRP A;  1D3Z A;  5DPW A;  2L7R A;  5LXH A;  2NBU A;  2EMS A;  2ZEQ A;  2LGY A;  3DOW A;  2NBV B;  4AUQ C;  3DCG A;  2GBJ A;  3VUY A;  4DDG D;  4EUT A;  2JPH A;  4A3O A;  2KDE B;  1V9J A;  3QA8 A;  4IM3 A;  5D94 A;  2KQS A;  2O2V A;  3NZU A;  1GUA B;  3CST A;  3RT3 B;  1CMX B;  1E8W A;  2IO3 B;  4MGZ E;  4CO7 A;  5KHO A;  4RMA A;  3U7D A;  3IHP C;  1KOT A;  2KWC A;  2NR2 A;  4WJO A;  2MSE D;  4G11 A;  5CX3 A;  2K1F A;  4II2 B;  3TL5 A;  3IG3 A;  2KOX A;  3X23 A;  1UH6 A;  1YIW A;  2GOW A;  4FLH A;  4K7W A;  4MDK E;  3ZTD A;  2FIF A;  2KHW B;  2KK8 A;  4DHJ B;  1ZW7 A;  2KDF B;  4GDK B;  4MGI E;  2LI5 A;  3VXW A;  4CYE A;  3EC8 A;  2D10 A;  2L3Z A;  4FAD A;  3PHW B;  2REX A;  5IAA C;  2FCS A;  3APC A;  3R7R A;  3WAP A;  3HM6 X;  1L7Y A;  2GBN A;  2AWT A;  3LDZ E;  1TZ1 A;  1J19 A;  1VCB A;  4LDT D;  3UIO B;  2ZJD A;  2FNJ B;  2GMI C;  2KN5 A;  4HWI B;  3Q3F A;  3T8M A;  1TTN A;  3JSV A;  4G0N B;  2O2V B;  5D7G A;  3IVF A;  4JIO U;  2KO3 A;  2LRW A;  3K9O B;  2MBH A;  2FCM A;  4F8C B;  2MA9 B;  1E8Y A;  2BF8 B;  3DBL I;  4W9F A;  1AAR A;  2MWS B;  2MX2 A;  4KZ0 A;  3UQB A;  2M0X A;  3QX1 A;  2HD5 B;  1C1Y B;  4W9I A;  2DX5 B;  2W9N A;  4I6L B;  1Q5W B;  4HCP B;  2V3S A;  1KLV A;  4LCD E;  4TV3 A;  4AJY B;  3K9P B;  4EZL A;  1OEY J;  1X1M A;  2KQ7 A;  2N4F A;  4NJ7 A;  4BKS A;  4MEM A;  1UZX B;  3CSF A;  1ISN A;  4GSW A;  4JQW C;  5J18 A;  1G6J A;  2AEH A;  3UGB B;  2J0J A;  4B9K A;  3EHV A;  3L16 A;  1SGH A;  2K6Q A;  2KD0 A;  4JGH B;  1LM8 B;  4NNJ B;  1Y8R C;  3LJ3 A;  4W9C A;  4DDI D;  4DHZ B;  5C1Z A;  4GDL A;  3EEC A;  4RM8 A;  1LFD A;  2KMC A;  1WXS A;  2JT4 B;  3ZIM A;  3JSV B;  1E8X A;  1OGW A;  3L13 A;  2CHW A;  5E6P A;  4TUU A;  4X57 B;  1EF1 A;  2N7D A;  2Y5B B;  4ANU A;  3T9L A;  3VTW A;  4KDL B;  1WGH A;  5J2R A;  4BFR A;  2M8S A;  1YX6 B;  2C60 A;  1L2N A;  4FJV B;  4FBJ B;  4EKU A;  2ZNV C;  3OAW A;  1P0R A;  1WFY A;  2R2Q A;  3OLM D;  5FR6 A;  1UEL A;  2LRU A;  3DVG X;  3ZNI D;  3AUL A;  1H8C A;  4GIV A;  4DXA B;  3NZS A;  4WJN A;  2JVC A;  3QQ8 B;  1V6E A;  4KSK C;  4OVU A;  1P9D U;  2C7H A;  2J7Q B;  2WX1 A;  2XK5 A;  4ZYN A;  4MH0 E;  2XEW A;  3QCA A;  1Z5S B;  5CHW A;  4GDL B;  2KVR A;  2DYO A;  1FXT B;  2IO0 B;  1WX8 A;  3ALB A;  4IWQ A;  1WGR A;  1GC7 A;  3ZW3 A;  4F1S A;  2WWZ A;  3O65 B;  4ZRI A;  2LVO A;  3H1U A;  4TQ1 A;  3WAM A;  3H6N A;  4NY0 A;  4M0W B;  1GC6 A;  2G45 B;  2R2O A;  3RZF A;  3L10 B;  4XC2 A;  1YJ1 A;  1C3T A;  2L8J A;  2IO2 B;  3ZO5 B;  2IBI B;  1WY8 A;  2KLG A;  3PVL A;  4AJW A;  5GMV A;  2IY1 B;  4RM9 A;  3U8Z A;  1J0G A;  2KZR A;  2KFJ A;  3UIP B;  3RD2 A;  2NPT A;  4MGY E;  5JHB A;  3N3K B;  3VVW B;  2OOB B;  1MG8 A;  1LXD A;  2XK5 B;  2ZNV B;  5D6J B;  3PLU A;  3RCZ A;  2J0M A;  2QHO A;  4MSQ B;  4PS8 A;  4GXB A;  3SDL C;  2D3G A;  3VTU A;  3PPA A;  4IWP A;  2A5U A;  4W9K A;  3W1Y A;  2M4N A;  3QAQ A;  5IA7 A;  5CHV C;  1OEY A;  4W9E A;  4BVU C;  2KXJ A;  3H7P A;  4HCN B;  4J6I A;  5EDS A;  2IO1 B;  3PRP B;  3AU4 A;  2N1W A;  4ZRJ A;  2MBB B;  4B6W A;  1E90 A;  4BBN C;  3DBS A;  2KLC A;  2O6V A;  4E3C A;  2HJ8 A;  3CMM B;  3A9J A;  4FA6 A;  3BY4 B;  2MBO A;  2MQJ A;  5JZE B;  2V1Y A;  3ONS A;  4IC7 B;  1V80 A;  2NPT B;  4M8N A;  3JVZ X;  3HM3 A;  1NBF C;  4W9J A;  2KWU B;  2I1K A;  2ZPN A;  4HXD A;  4WWP A;  1VD2 A;  1LQB A;  3TIX A;  3S2A A;  3BIN A;  1IP9 A;  3PT2 B;  4KVG B;  4HPM B;  5AZG A;  2MBE A;  3Q3J A;  1UGM A;  4GOC A;  2LZ6 A;  2KTR A;  4A20 A;  1WE6 A;  4KIK A;  4YL8 A;  3V6E B;  2HTH A;  2CKH B;  1K8R B;  4BKG A;  3WAN A;  3ZRF A;  2D11 A;  2BWF A;  5E6O A;  1F9J A;  1JRU A;  2KJR A;  2KX0 A;  3PLV A;  2O6V B;  2DHZ A;  2GBM A;  3ZVV A;  1EF5 A;  2DZK A;  3A9J B;  2WDT B;  3L54 A;  2IZV B;  2ZVO A;  3NS8 A;  2J0K A;  2YVC A;  5L83 A;  2RR9 A;  3TCA A;  3MHS D;  3DBH I;  2K8H A;  1WM3 A;  2PEA A;  3VQI A;  4I6P A;  2CHX A;  3SHQ A;  4LJP B;  3N32 A;  3A9K A;  2GBK A;  3R3M A;  4JL9 A;  2C9W B;  1V5O A;  4LDT B;  1WIA A;  2YLM A;  3ENE A;  3VTV A;  4NPN A;  3KVF B;  3R7Q A;  4HVB A;  3V60 A;  2KDI A;  2KJ6 A;  3B08 A;  4MSM B;  2KTR B;  2M1M A;  4KIK B;  4MGK E;  5DCN A;  4IWO A;  4PS3 A;  4B95 A;  2NBW B;  3L08 A;  5LXI B;  2UYZ B;  3DBR I;  4TKN A;  4II3 B;  3NHE B;  3ZUN A;  2N9P C;  4A3P A;  2D07 B;  1WX7 A;  1WGD A;  2FAZ A;  2MP2 A;  3UQA A;  1H4R A;  4F7Z A;  2DAF A;  1WE7 A;  3PGE A;  4FJY A;  3M63 B;  4IW0 A;  3W1S C;  4EEW A;  2OJR A;  1RLF A;  1XQQ A;  4KV2 A;  2EKE C;  2LGX A;  4ZRK A;  5JHA A;  3A9K B;  2KJH B;  1WXV A;  3APD A;  3ECI A;  1ZKH A;  2N9X A;  1YD8 U;  3TJP A;  2CHZ A;  1UBI A;  2XBB C;  4PYU A;  2N1V A;  4MEL A;  1V2Y A;  3W1S A;  1WZ0 A;  2RSU A;  4W9H A;  1WJN A;  3TMP B;  2DEN B;  2ZPY A;  5J17 A;  2LXA A;  5G55 A;  3HK0 A;  2C5L C;  2K39 A;  3VDZ A;  2KAN A;  5KHQ A;  2BYF A;  2FUH B;  2NVU I;  3CF6 E;  3QHT A;  2ZCC A;  2ASQ A;  1WJ6 A;  2HE7 A;  2K8B A;  3R66 C;  3VHT C;  1OQY A;  2LVP A;  4FJZ A;  4EZK A;  2KTF A;  3HIZ A;  4CHK A;  2RD0 A;  2AL3 A;  2JWZ A;  3IBE A;  1YQB A;  1WGG A;  4HLE A;  2KX3 A;  2IY0 B;  5L95 C;  2MP2 B;  5D2M B;  1V81 A;  2NCN A;  3VUX A;  4GN1 A;  1KJT A;  2A4Z A;  2Z0E B;  3ML8 A;  3PZD A;  3KUC B;  5HKH A;  1WH3 A;  4FHK A;  3PV1 A;  3QIJ A;  1WF9 A;  1WXA A;  3RYT A;  4ICV A;  4BOZ B;  4IM2 A;  3RUI B;  3H9D A;  3WIM A;  2DZI A;  4M8M A;  3VH3 B; 
#chains in the Genus database with same CATH topology
 2BYE A;  3O13 A;  3JYU A;  1WYW B;  2I1J A;  2N9E B;  4NQK E;  2K8C A;  1TY2 A;  2RPV A;  2L00 B;  3OJ3 A;  4DK5 A;  1WR1 A;  5FR3 A;  3NOB A;  1F0Z A;  3R2T A;  1C4A A;  4IG7 B;  3KH0 A;  2LD9 A;  4BOS C;  2RPQ A;  4MM3 A;  2BS2 B;  3A4S C;  2ZVN A;  4KSL C;  1SIF A;  4P7I A;  1FRR A;  1PYW D;  1TY0 A;  2PIA A;  5EE9 A;  4RGN A;  3V61 A;  3JW0 X;  3Q3N C;  2D2Q A;  2QIE B;  3RI7 C;  2KWD A;  4AP4 C;  1WZ3 A;  1P7F A;  4DQO C;  5H92 C;  5JH5 C;  2PKO A;  1XD3 B;  3QK0 A;  1C77 A;  4P1B C;  5BYQ A;  4K7U A;  4W9L A;  1Q0W B;  1YN4 A;  2KDB A;  4C4V B;  2GB1 A;  1K51 A;  3L0W B;  2PJH A;  2E6X A;  1M94 A;  2W54 A;  1WX9 A;  3M3J A;  3HRD D;  2FCQ A;  1TKG A;  1TJE A;  4UDU C;  2BT6 A;  2AQ2 B;  2UWQ A;  2WX0 A;  3GZN I;  3QC8 B;  3Q8C A;  4IM0 A;  4K7S A;  2AX5 A;  1PGX A;  1RYJ A;  2WXH A;  3MFG A;  2M17 A;  4DXG A;  3GOE A;  4ANX A;  3AU5 A;  1PUT A;  5CHF A;  3TEZ A;  2XN9 C;  2B3A A;  4JLC A;  3A1Q A;  4K81 A;  4L1B A;  1FCC C;  2V4L A;  1YN5 A;  4MJS B;  3RNG C;  2BYV E;  4ANV A;  3DQV A;  1SBB B;  2AYO B;  2BW2 A;  4NAW B;  2KYW A;  4HDO A;  4KDI C;  1PQS A;  4XX5 A;  5C23 A;  4LNI A;  3GS2 A;  2ZW0 A;  1QOB A;  1HQR D;  1I35 A;  2KFK A;  4KGT A;  2KC1 A;  2LVQ A;  3B1L X;  2BQQ A;  4XZ4 A;  2JUO A;  1NEK B;  1UD7 A;  3KUD B;  3VH4 B;  1S3S G;  3D32 A;  3ZDT A;  3PRM B;  3E56 A;  4IOI E;  3WAL A;  1XEE A;  3BWU D;  2NS5 A;  2J52 A;  4A55 A;  1A5R A;  1XLN A;  2LAS A;  2W3R A;  4DXF A;  3X0W A;  3SU8 X;  2PPH A;  2WNM A;  2I38 A;  1TGZ B;  3ZLZ A;  5LLI A;  3KUZ A;  2CR5 A;  3L4P A;  1FNU A;  4LNN A;  5LNK 1;  3IAM 1;  1IYF A;  2M19 A;  3PS6 A;  4AOF A;  4PYZ A;  1D3Z A;  3TSS A;  5DPW A;  5LXH A;  2LGY A;  3NZ3 A;  2NBV B;  4GLS C;  4ZOH C;  3VUY A;  2JPH A;  2KDE B;  5HG2 A;  1CMX B;  1MI0 A;  1E8W A;  3Q3O C;  5KHO A;  3AE8 B;  4OZB A;  2K1F A;  4II2 B;  2B76 B;  1YIW A;  3ZTD A;  4MDK E;  2FIF A;  4RGT A;  4GDK B;  1QOG A;  2LI5 A;  1T0S C;  2Y5C A;  3ETR A;  3EC8 A;  3GE8 C;  3PHW B;  2REX A;  3URY A;  4LK0 M;  1XF5 L;  1L7Y A;  3LDZ E;  2ZJD A;  2KN5 A;  2WXI A;  4G0N B;  5D7G A;  4YTN B;  4JIO U;  2KO3 A;  4F8C B;  5IP4 D;  2BF8 B;  4W9F A;  2MWS B;  1EU4 A;  2M0X A;  3QX1 A;  2DX5 B;  2W9N A;  3MHZ A;  4XWT A;  4HCP B;  4A6Q A;  1TS3 A;  1TS5 A;  5C2T B;  1UZX B;  5J18 A;  2AEH A;  1HA5 A;  3LJ3 A;  4GDL A;  1VZ6 A;  1LFD A;  3NG0 A;  1NYQ A;  1OGW A;  4TUU A;  1GPX A;  1EF1 A;  1C78 A;  2C60 A;  1HZ6 A;  4FJV B;  1D4B A;  1D6E C;  1JCK B;  1ZOY B;  1WFY A;  2R2Q A;  5FR6 A;  1UEL A;  3DVG X;  4GIV A;  2G1E A;  4WJN A;  3QQ8 B;  1I4H A;  4OVU A;  2XK5 A;  4ZYN A;  1Z5S B;  1ZXI A;  1AN8 A;  2TSS A;  2KVR A;  2DYO A;  1WX8 A;  3ZYY X;  2WWZ A;  3O65 B;  2WQY B;  1LO5 D;  4NY0 A;  4M0W B;  3T3N A;  2G45 B;  2WLB A;  1YJ1 A;  2EKI A;  1C3T A;  4HJG E;  2IO2 B;  5AUK A;  3PVL A;  3H8H A;  2KAC A;  1J0G A;  4N6E B;  4OZC A;  2KZR A;  1K50 A;  3RD2 A;  1SE4 A;  3N3K B;  1MG8 A;  5D6J B;  3PLU A;  2MH7 A;  1QOF A;  3MJ5 A;  4MSQ B;  4PS8 A;  5JXV A;  3SDL C;  2D3G A;  2A5U A;  3QAQ A;  4W9E A;  4HCN B;  2R61 A;  3PRP B;  4ZRJ A;  2MBB B;  1E90 A;  4YXD B;  2J42 A;  5BMI A;  2L32 A;  3TUO A;  3CMM B;  1SF0 A;  3A9J A;  2V1Y A;  2JZP A;  4IC7 B;  1RFK A;  3JVZ X;  4QAY A;  2J53 A;  1N61 A;  2I1K A;  1XLP A;  3TIX A;  3BIN A;  4L2Y A;  1IP9 A;  1YQ4 B;  1JW9 D;  4GOC A;  1I7H A;  3AB5 A;  4YL8 A;  1EWY C;  2NMQ A;  2D11 A;  3WCQ A;  2BWF A;  2DZK A;  3I63 C;  3AEG B;  2RDB C;  5HFY A;  5L83 A;  2RR9 A;  3DBH I;  4WUR A;  1I4P A;  4P16 A;  3NVZ A;  2CHX A;  3SHQ A;  3A9K A;  1WIA A;  2YLM A;  3R7Q A;  1E7P B;  4KKJ A;  1TT5 B;  1V1P A;  2GI9 A;  4TSS A;  3RPF C;  1ROE A;  4KIK B;  4PS3 A;  3DBR I;  2PLP A;  1WWT A;  2INP E;  2KN4 A;  2FAZ A;  1WGD A;  4F7Z A;  1WXQ A;  3PGE A;  4EEW A;  2OJR A;  4RNA A;  4BAX A;  2QMT A;  5JHA A;  2ON8 A;  3ECI A;  2N9X A;  3FC4 A;  2CHZ A;  2N1V A;  2X8X X;  3RNC C;  3W9C B;  1WJN A;  2ZPY A;  2LHD A;  4JE3 B;  3VRB B;  5J17 A;  2K39 A;  5HI1 A;  3OG5 A;  3AE3 B;  2ASQ A;  1WJ6 A;  1XCQ L;  2LVP A;  3RNF C;  5L95 C;  5D2M B;  1UNS A;  3C8Y A;  3KUC B;  3DBL B;  1F2R C;  1ZDV A;  1NEN B;  1WF9 A;  3RYT A;  1ZUD 2;  2DZI A;  4M8M A;  4PT5 A;  2PVO D;  3RNE C;  1OTR B;  1UBQ A;  4NAM A;  1SB3 C;  3DVG Y;  4RH6 A;  3ZRC A;  3DWG C;  5GXG B;  4W9D A;  2LWP A;  1AYF A;  5DPS A;  1L4D B;  2AL6 A;  3HHM A;  2KKC A;  1EWC A;  1HE8 A;  3ZNH B;  4ZHP A;  3ZNZ B;  2G4D B;  2HDE A;  1DOX A;  2W55 A;  3P1M A;  4LNO A;  4A9A A;  3B2G A;  1YN3 A;  3H7P B;  3EGR A;  4TQ0 A;  4ZDV A;  4FHJ A;  3W5V B;  3NY5 A;  1SXT A;  1D5Z C;  1ZPS A;  1MJD A;  2O6V D;  3EUB 2;  3N20 C;  3EFC A;  5AEK B;  3LYY A;  2DZJ A;  2WXR A;  4M02 A;  1P7E A;  1T5X D;  2JYE A;  3M95 A;  3TEX A;  2WYQ A;  4IDI A;  1IPG A;  1TIF A;  2W82 A;  1V86 A;  5CTR C;  2FID A;  3A33 B;  2EMT A;  4JPS A;  2H89 B;  2PW9 A;  1K52 A;  1KM7 A;  1KH0 A;  2FCN A;  3MJW A;  4OVV A;  4AWJ A;  2JF5 A;  4E71 A;  1U4A A;  1C4P A;  2C7N B;  2PE9 A;  3PHX B;  3KYD D;  4BKS D;  3SFD B;  4NQL B;  5C3J B;  3BII D;  1V49 A;  2MW5 A;  2RGF A;  1F77 A;  4BKT A;  2RMM A;  2QCZ A;  1ENF A;  4WWN A;  1UWM A;  2JXT A;  2ZCB A;  3N9Y C;  4RGM A;  3C19 A;  2BYT A;  4A90 A;  2YEP B;  5BYR A;  3VFK A;  1P3Q U;  1N5W A;  3N30 A;  4ACF A;  1F1H A;  1MVK A;  2INC C;  4HEA 1;  4GGQ A;  4EFO A;  4HJK A;  1WYG A;  3SFE B;  1C79 A;  1UWX A;  3PTF C;  4WQO B;  1R4N I;  2LHE A;  1EUV B;  1YQ3 B;  2WGS A;  1WXM A;  1IGC A;  1CQV A;  1WMH B;  3RUL A;  1WJ4 A;  3PRE A;  4WH4 A;  1SEB D;  4OZA A;  2KVZ A;  1T0R C;  2C7M B;  2MCN B;  2L7R A;  2EMS A;  2ZEQ A;  4AQ7 A;  3N1Z C;  4AUQ C;  3DCG A;  3OWE B;  4DDG D;  4EUT A;  3CST A;  1HZ5 A;  1FNV A;  2ACZ B;  2D3B A;  2IO3 B;  5EE0 A;  4RMA A;  2PVG C;  4WJO A;  2WDV B;  2MSE D;  4G11 A;  3TL5 A;  3IG3 A;  4K7W A;  5MPO A;  4JWU C;  2KK8 A;  1UGJ A;  2KDF B;  2KAJ A;  2L83 A;  3VXW A;  4TMA B;  5IAA C;  3APC A;  3HM6 X;  2AWT A;  1J19 A;  1VCB A;  3B2F A;  3UIO B;  4HWI B;  2FNJ B;  2GMI C;  4C56 C;  3T8M A;  1TTN A;  3JSV A;  2O2V B;  1ZE3 D;  2LRW A;  2MA9 B;  1E8Y A;  3ZXR A;  3UQB A;  1JAL A;  4I6L B;  1GB1 A;  1KLV A;  4LCD E;  3RN9 C;  4EZL A;  1OEY J;  3R2I A;  4NJ7 A;  2Q5W D;  4MEM A;  4GSW A;  4EE2 A;  1G6J A;  5IN7 A;  3EHV A;  3L16 A;  3KWV A;  1SGH A;  1Y8R C;  1RM6 C;  1C4C A;  1VZ7 A;  2KMC A;  1ESF A;  4X57 B;  2QDF A;  2FE8 A;  1VR9 A;  1WGH A;  1YX6 B;  4FBJ B;  1FRD A;  3PO0 A;  1F2R I;  1K53 A;  2LRU A;  1VZ8 A;  4DXA B;  3MC9 A;  1V8C A;  2JVC A;  1V6E A;  3KWL A;  2C7H A;  3ZJU A;  4MH0 E;  3Q8A A;  2CJO A;  1FD6 A;  2IO0 B;  3ALB A;  1ET9 A;  4ZRI A;  1I4X A;  4TQ1 A;  3WAM A;  3RZF A;  4XC2 A;  2WDQ B;  1WY8 A;  2VZK B;  3NJT A;  4RGO S;  4AJW A;  4RM9 A;  3U8Z A;  1R4M B;  4HKQ A;  2WU5 B;  4MGY E;  5JHB A;  3VVW B;  2OOB B;  1LXD A;  4PK1 A;  2ZNV B;  1N63 A;  3VTU A;  3DHG C;  3PPA A;  3P63 A;  4W9K A;  3W1Y A;  1E0Z A;  1UUP A;  3H7P A;  2N1W A;  3RNA C;  1MG4 A;  2QEJ C;  3ZJT A;  4FA6 A;  4REZ A;  2MBO A;  2MQJ A;  5JZE B;  2BTE A;  3U52 E;  1TZO A;  2NPT B;  4M8N A;  3HM3 A;  2GRI A;  2ZPN A;  2X38 A;  4WWP A;  3NS1 A;  2BVC A;  3HUI A;  4Q2J A;  1IBX B;  3VR9 B;  4HPM B;  3Q3J A;  1UGM A;  3UI3 A;  2QIL A;  1WGK A;  3ZRF A;  5E6O A;  1F9J A;  3PLV A;  1N6Z A;  2KJR A;  2KX0 A;  2M56 B;  2O6V B;  2GBM A;  1L6V A;  2V4I B;  2WXQ A;  1SE2 A;  2IDY A;  2ZVO A;  2J0K A;  3MHS D;  2K8H A;  1FMA D;  1ZP0 B;  2AQ1 B;  2PEA A;  4I6P A;  3FIL B;  4JL9 A;  4B0M A;  1KRH A;  3VTV A;  1L5P A;  3VR8 B;  2KJ6 A;  1MFW A;  2KTR B;  2M1M A;  5DCN A;  2INN E;  2NBW B;  5LXI B;  1SJE D;  1FPY A;  3FKY A;  4TKN A;  4II3 B;  1FCL A;  5IOI A;  2D07 B;  3UQA A;  4YTP B;  2DAF A;  3M63 B;  1RLF A;  3P4Q B;  2KJH B;  1YD8 U;  4MEL A;  1WZ0 A;  4RCO A;  2RSU A;  3HK0 A;  2IPK D;  3VDZ A;  5KHQ A;  2FUH B;  2HTM E;  3R66 C;  3VHT C;  1OQY A;  4B0E A;  3AEF B;  1JQ4 A;  3HIZ A;  4MAC A;  4CHK A;  2AL3 A;  4P1C C;  2KX3 A;  1DGJ A;  2K5P A;  2IY0 B;  2MP2 B;  5E6J A;  3Q69 A;  4YSZ B;  4GN1 A;  3PZD A;  1D5M C;  3ML8 A;  2DBY A;  1ZXH A;  4FHK A;  2QSD A;  2L1A A;  4ICV A;  4ZRQ A;  3VH3 B;  4IUM B;  2L52 A;  4HK2 A;  4O1N A;  5G5G A;  2CU1 A;  2N7E A;  4DBG A;  2OED A;  4GMV A;  4BBN F;  5AZH A;  3QWZ B;  4C4V A;  1HTO A;  2ZZP B;  3NRZ A;  1GNU A;  2SEB D;  4RF1 A;  3RZW C;  1BUI C;  4US8 A;  4RFB A;  4L23 A;  2JZ3 B;  1E7U A;  1L0V B;  4JX1 C;  2MJ3 A;  2V3N A;  5BO4 B;  1L0X B;  1RFA A;  2H88 B;  2MHJ A;  1I42 A;  1JML A;  1XLQ A;  4ZRP A;  4EZJ A;  4MM3 B;  4MJS A;  4USA A;  4FN2 A;  3UF8 A;  4HRO A;  5BYS A;  4WJQ A;  1OQR A;  5G2N A;  1FXI A;  4NAW A;  1RWS A;  2LJ5 A;  3KLS X;  3CWI A;  1Q10 A;  1GG3 A;  2WDR B;  1P1A A;  1JWU D;  1SE9 A;  2J4X A;  3AE1 B;  4EOY A;  1QZE A;  2KNB A;  2L0F A;  2KWV B;  1YJJ A;  2BS4 B;  4LJO B;  2D3C A;  1JWA D;  1YMH E;  4DWF A;  2MJE A;  3BZD B;  1CJE A;  1Z2M A;  1WRD B;  3NVY A;  3ZDM C;  2LEK A;  2L05 A;  3H7S A;  3HVZ A;  3RNB C;  2LUE A;  2LJI A;  2VH2 A;  2V0G A;  3SEB A;  4ITK A;  4G50 A;  3ABV B;  1MHH E;  1XO3 A;  3EFU A;  1T3Q A;  3BVG A;  1Q1O A;  2BPS A;  1AWD A;  2JXX A;  2Y3A A;  1VLB A;  3KYC D;  1T6B X;  2Y5P A;  3A1Q B;  1JWS D;  1V5T A;  3VUW A;  1GJZ A;  2QJL A;  2VZK D;  3U7Z A;  2CS4 A;  4K1R B;  3VAW A;  2DYM A;  3L17 A;  4NJC A;  1E9M A;  2JRI B;  4M00 A;  2WXK A;  2KMA A;  4YTM B;  1HXY D;  4WJP A;  3KW5 B;  1QT9 A;  1WR6 E;  3APF A;  1BXT A;  2KFK B;  4IKG A;  3IFW B;  3T3O A;  1SJH D;  1NDD A;  2GBR A;  2XNA C;  1T0Q C;  2BGF A;  1E8Z A;  1FXA A;  2LGD A;  2G4S A;  4RF0 A;  4WAA A;  1YX5 B;  2G3Q B;  2L0T A;  4E74 A;  4GDK A;  2NBU A;  5FKA C;  2IGG A;  4WWM A;  1KLG D;  4A3O A;  1V9J A;  3QA8 A;  3NZU A;  3IHP C;  1KOT A;  2NR2 A;  5CX3 A;  3J9C A;  4A8X C;  2KOX A;  3X23 A;  4FLH A;  2KHW B;  2WXF A;  4C80 A;  4DHJ B;  4CYE A;  1UF0 A;  1N5X A;  2N9L A;  1L0Y B;  2L3Z A;  4FAD A;  2FCS A;  3R7R A;  2DLB A;  1XLO A;  1TZ1 A;  3Q3F A;  1YOV B;  2IGH A;  3IT6 B;  2FUG 1;  3Q8B A;  3IVF A;  1DOI A;  3K9O B;  2MBH A;  1F52 A;  3DBL I;  3BK2 A;  4KZ0 A;  1HEZ E;  1C1Y B;  1LGR A;  1Q5W B;  2V3S A;  4AJY B;  3K9P B;  1X1M A;  1VDV A;  2KQ7 A;  4BKS A;  3CSF A;  4JQW C;  3RMK C;  3AE4 B;  1AW7 A;  2J0J A;  4B9K A;  3DWM A;  4JGH B;  1LM8 B;  2WXJ A;  3EEC A;  4RM8 A;  3W5U B;  2JT4 B;  4S0R A;  1E8X A;  3L13 A;  2CHW A;  2N7D A;  4ANU A;  1KF6 B;  1B9R A;  3T9L A;  4KDL B;  4M0W A;  5IO9 A;  2I2Y A;  4BFR A;  2M8S A;  3TEY A;  4H2A A;  2OJW A;  2RDH A;  2ZNV C;  1P0R A;  2D3A A;  3ZNI D;  3AUL A;  1H8C A;  3NZS A;  3MP9 A;  2SAK A;  3IAS 1;  1V97 A;  4KSK C;  3B9J A;  1P9D U;  2WX1 A;  2M0A A;  1CK1 A;  3TEW A;  3QCA A;  4D2K A;  4GDL B;  2WU2 B;  1WSP A;  1VRA B;  4YSY B;  4F1S A;  3P4R B;  3H1U A;  2KQ4 X;  3H6N A;  5HHD G;  2R2O A;  2E3T A;  3L10 B;  3ZO5 B;  2KLG A;  3GZN B;  5GMV A;  2KDM A;  4R3D A;  1JWB D;  2KFJ A;  4ARC A;  2DWQ A;  2WHI A;  2XK5 B;  1N62 A;  3RCZ A;  1DYQ A;  2MEK A;  4C7Y A;  4HRS A;  2JYT A;  5H8Y E;  1M4V A;  3BYY B;  2LGI A;  4BVU C;  4J6I A;  1GOZ A;  2JU6 X;  3AEE B;  3AU4 A;  3BVZ A;  1PGA A;  4KGS A;  4E3C A;  4LTU A;  3HVD A;  3PZ8 A;  3LB8 C;  4K3C A;  3I57 A;  4C00 A;  5IKC M;  2JX5 A;  5G5H A;  1LQB A;  1JRO A;  3PT2 B;  3ZGZ A;  5AZG A;  2MBE A;  4MT5 A;  1FEH A;  1JRP A;  4A20 A;  1WE6 A;  4KIK A;  3V6E B;  1K8R B;  3WAN A;  1EU3 A;  3SR6 A;  2K9X A;  3A9J B;  2ZW1 A;  2WDT B;  3L54 A;  2IZV B;  3AEA B;  3NS8 A;  2YVC A;  2BBC A;  1BML C;  3VQI A;  4HPP A;  3N32 A;  3DHI C;  4LDT B;  2C9W B;  1V5O A;  3ENE A;  1KFY B;  3KVF B;  3V60 A;  3AED B;  3VRA B;  3B08 A;  4ZYS A;  4MGK E;  3NVW A;  3N1Y C;  2UU7 A;  4B95 A;  3L08 A;  1R7S A;  4KGR A;  4XE0 A;  1WX7 A;  1EM7 A;  1WE7 A;  2KMM A;  4IW0 A;  3W1S C;  1XQQ A;  4KV2 A;  2EKE C;  2LGX A;  4ZRK A;  3A9K B;  4US9 A;  3TJP A;  1UBI A;  2AQ3 B;  2WP9 B;  3GP7 A;  1V1P B;  4W9H A;  2V9H A;  3TMP B;  2LXA A;  2KAN A;  2BYF A;  3QHT A;  2K8B A;  4S17 A;  1J7A A;  5FK9 C;  4EZK A;  2RD0 A;  1YQB A;  1V81 A;  2NCN A;  2K0P A;  3VUX A;  2A4Z A;  3U2S C;  1ZDX A;  5HKH A;  1WH3 A;  3PV1 A;  3QIJ A;  1WXA A;  4BOZ B;  3RUI B;  2D5G A;  1QLB B;  4M01 A;  1QIL A;  4GU2 A;  3Q14 C;  2LUM A;  4KX6 B;  2JRH A;  3AE5 B;  2N7J A;  3Q3M C;  4LNF A;  1RAX A;  4ASW C;  1E5W A;  4GB9 A;  4I6N B;  1P98 A;  5I4D A;  3V05 A;  4ICU A;  3AE6 B;  3P4S B;  4ZHO A;  1J8C A;  1I4G A;  3Q8E A;  2DAJ A;  4DHJ D;  5AZF A;  3EA6 A;  5D3I B;  1XT9 B;  3KQ4 A;  3QAR A;  4HPL B;  3LXF A;  3P4P B;  3AE2 B;  3DHH C;  5BMH A;  4W9G A;  1WM2 A;  3DVN U;  1FFV A;  3ZTC A;  4JWS C;  2MBQ A;  5DPT A;  2BKR B;  3ZKJ C;  3V62 A;  2L76 A;  2WXL A;  2DZM A;  2JY6 A;  3UIN B;  4WQM A;  1OQQ A;  2HJ1 A;  1SSN A;  3Q8F A;  1A70 A;  4G3X B;  2DYB A;  2V3P A;  4N9F 4;  4C7Z A;  2K6D B;  1XCT L;  4HDQ A;  3ZQ4 A;  4WWO A;  1TS2 A;  4NZL B;  3E9S A;  3I3T B;  5E6N A;  2JSV X;  2VRR B;  1R4M I;  4PS7 A;  2RDG A;  1WJU A;  3I9V 1;  1NI3 A;  1NYR A;  2MLB A;  2YEP F;  3TBL D;  3DVN V;  4MH8 A;  4J3O D;  1RRB A;  4URK A;  4XWW A;  1MPE A;  3I5J C;  3DPD A;  4ANW A;  3GE3 C;  3OJ4 B;  1SIJ A;  3ZJV A;  1TBE A;  1E6E B;  3QJZ A;  3ML9 A;  4YWG G;  1I4Q A;  1EO6 A;  3A4R A;  1I4R A;  3U30 A;  3NVV A;  3WAO A;  2Z0D B;  1S1Q B;  3ZNG C;  1HTQ A;  4LNK A;  3PRZ A;  2KC2 A;  2IND C;  4HKZ E;  1BT0 A;  2BWE S;  1ET6 A;  2PE6 B;  3P2B A;  2NTS A;  5AUI A;  1YNT E;  4OW0 A;  4NJ6 A;  3AV8 A;  3MTN B;  1WMH A;  4WAF A;  4XDC A;  1L6U A;  3AXC A;  1FM0 D;  4FUL A;  4LLG M;  5DPR A;  4KZC A;  2PTL A;  3WA0 A;  1L4Z B;  3SD5 A;  2K25 A;  3B0A A;  2JZZ A;  3V6C B;  1FFU A;  4DHZ E;  3M62 B;  1C9F A;  3AI5 A;  1ZGU B;  1WGY A;  2BKF A;  1QOA A;  1NI2 A;  3DBH B;  3P42 A;  4N59 A;  1T0Y A;  4CQN A;  2Z59 B;  3PSE B;  1E7V A;  2EEL A;  1YJI A;  2LMC A;  3DDC B;  2LXC A;  1B1Z A;  4XDD A;  4FXC A;  1E10 A;  5TR5 A;  3PZ7 A;  3C0R B;  4YSX B;  2LGS A;  1WI0 A;  2IYD B;  2MRP A;  2LFI A;  3DBR B;  1J7C A;  3DOW A;  3BYT B;  1TKY A;  2GBJ A;  3N1X C;  4K3B A;  5D94 A;  2JQR B;  4IM3 A;  2G9H D;  2KQS A;  2O2V A;  1GUA B;  3RT3 B;  3R8B A;  4MGZ E;  4CO7 A;  3GB1 A;  3U7D A;  2KWC A;  1XXG A;  1QF6 A;  2IGD A;  1NVI D;  3AEC B;  1UH6 A;  2GOW A;  1ZW7 A;  4MGI E;  2D10 A;  5T8I A;  3NUH B;  5EE3 A;  1QKZ A;  3WAP A;  1OFF A;  2GBN A;  4LDT D;  4XYC A;  1TS4 A;  1IUE A;  2W3S A;  2FCM A;  1AAR A;  2MX2 A;  2HD5 B;  4W9I A;  2K22 A;  4TV3 A;  4XGA B;  1FO4 A;  2BB5 A;  2WXO A;  2N4F A;  1ISN A;  2BS3 B;  3UGB B;  4AS1 A;  2DNF A;  2K6Q A;  2KD0 A;  4NNJ B;  4DDI D;  4W9C A;  4DHZ B;  5C1Z A;  1WXS A;  3MC0 B;  3ZIM A;  3JSV B;  2Z8L A;  5E6P A;  2Y5B B;  1JWM D;  3VTW A;  5D3D A;  2NTT A;  5J2R A;  1L2N A;  3AEB B;  4P6V F;  4EKU A;  2OHF A;  3OAW A;  3AH7 A;  3OLM D;  1SE3 A;  3Q6B A;  2K3U A;  4ARI A;  2J7Q B;  3FAH A;  2XEW A;  5CHW A;  1D5X C;  1FXT B;  4IWQ A;  1WGR A;  1GC7 A;  3ZW3 A;  3CIR B;  2LVO A;  1GC6 A;  2L8J A;  2IBI B;  2WS3 B;  3AE7 B;  4OHJ A;  2IY1 B;  3AM9 A;  1FNW A;  3UIP B;  1PDX A;  2NPT A;  2WXG A;  2N0S B;  3RFZ B;  1IGD A;  3ZXV A;  2CU3 A;  2J0M A;  2QHO A;  1J7B A;  4GXB A;  4OVZ A;  2CJN A;  4IWP A;  1IBX A;  2KT7 A;  2M4N A;  5IA7 A;  5CHV C;  1OEY A;  2KXJ A;  5EDS A;  1TYG B;  2IO1 B;  4B6W A;  3W2D A;  4BBN C;  3DBS A;  3U4E G;  1VJK A;  2KLC A;  2O6V A;  2HJ8 A;  5EE1 A;  2N9K A;  3BY4 B;  1PGB A;  3ONS A;  1V80 A;  1NBF C;  4W9J A;  5BMG A;  2KWU B;  3Q2A C;  1ACC A;  3FIL A;  1KTK A;  4HXD A;  1Y56 A;  1VD2 A;  3S2A A;  1C76 A;  2FBW B;  4KVG B;  2LZ6 A;  2KTR A;  2HTH A;  2CKH B;  4BKG A;  3MC8 A;  1KLU D;  1JRU A;  2ONQ A;  3ZVV A;  2DHZ A;  2IJ0 A;  1EF5 A;  1WRI A;  1R4N B;  3TCA A;  1WM3 A;  4KKI A;  4LJP B;  2GBK A;  3R3M A;  2WXP A;  3AE9 B;  4NPN A;  4YT0 B;  4HVB A;  2KDI A;  4MSM B;  2BB6 A;  2WXN A;  3AMZ A;  3AN1 A;  4IWO A;  1FIQ A;  1TKE A;  2UYZ B;  2WXM A;  3NHE B;  2VH1 A;  3ZUN A;  2N9P C;  4A3P A;  2MP2 A;  1H4R A;  3V3X A;  3BVM A;  4FJY A;  1V1O A;  2ICI A;  3BK1 A;  1CZP A;  1N60 A;  3APD A;  1WXV A;  1ZKH A;  2QC8 A;  2XBB C;  4PYU A;  2PMV A;  1V2Y A;  3W1S A;  2JWU A;  1GAQ B;  4N58 A;  1QQR A;  2DEN B;  3IXS A;  5G55 A;  2C5L C;  1DOY A;  2NVU I;  3CF6 E;  2ZCC A;  2HE7 A;  1PFD A;  4FJZ A;  2GLS A;  2KTF A;  2JWZ A;  3IBE A;  4HLE A;  1WGG A;  5TSS A;  2MJD A;  1MHX A;  3IT4 B;  4BZA A;  1KJT A;  2Z0E B;  4WIP A;  1STE A;  4IM2 A;  3H9D A;  3WIM A;  1GB4 A; 
#chains in the Genus database with same CATH homology
 2BYE A;  4HK2 A;  4IUM B;  3JYU A;  1WYW B;  2CU1 A;  2N7E A;  2I1J A;  4GU2 A;  4DBG A;  1OTR B;  2N9E B;  2JRH A;  2K8C A;  4NQK E;  1UBQ A;  2L00 B;  3DVG Y;  3OJ3 A;  4DK5 A;  1RAX A;  1WR1 A;  3NOB A;  3ZRC A;  4IG7 B;  4ASW C;  1E5W A;  3KH0 A;  2LD9 A;  4GMV A;  4GB9 A;  4I6N B;  4W9D A;  4BBN F;  5AZH A;  4BOS C;  1P98 A;  2LWP A;  2RPQ A;  3QWZ B;  5DPS A;  4MM3 A;  2AL6 A;  4ICU A;  3A4S C;  3HHM A;  2ZVN A;  2KKC A;  2ZZP B;  4KSL C;  1GNU A;  1SIF A;  4P7I A;  1J8C A;  3RZW C;  2DAJ A;  4DHJ D;  1HE8 A;  5AZF A;  3ZNH B;  2JZ3 B;  3ZNZ B;  2G4D B;  1XT9 B;  3V61 A;  3JW0 X;  3QAR A;  2D2Q A;  4HPL B;  1E7U A;  4AP4 C;  1WZ3 A;  5BO4 B;  4W9G A;  1WM2 A;  3DVN U;  5JH5 C;  1XD3 B;  1RFA A;  3H7P B;  3QK0 A;  3ZTC A;  4TQ0 A;  4ZDV A;  1I42 A;  2MBQ A;  4FHJ A;  5DPT A;  3NY5 A;  2O6V D;  2BKR B;  4K7U A;  4W9L A;  5AEK B;  1Q0W B;  3ZKJ C;  2KDB A;  4EZJ A;  3V62 A;  3L0W B;  2L76 A;  4FN2 A;  2DZM A;  2PJH A;  2JY6 A;  4MJS A;  1M94 A;  3UF8 A;  3UIN B;  2DZJ A;  1WX9 A;  3M3J A;  2FCQ A;  4G3X B;  3M95 A;  4WJQ A;  2DYB A;  2WYQ A;  4N9F 4;  2K6D B;  5G2N A;  4HDQ A;  4NAW A;  4WWO A;  2WX0 A;  2UWQ A;  3GZN I;  3QC8 B;  4K7S A;  4IM0 A;  1IPG A;  2LJ5 A;  3I3T B;  2M17 A;  1GG3 A;  2VRR B;  5E6N A;  1P1A A;  1R4M I;  1SE9 A;  3AU5 A;  3GOE A;  1V86 A;  5CTR C;  4PS7 A;  4ANX A;  4EOY A;  1WJU A;  1QZE A;  5CHF A;  2KNB A;  2MLB A;  2L0F A;  2KWV B;  2B3A A;  2FID A;  4LJO B;  4JLC A;  3DVN V;  3A1Q A;  3A33 B;  4K81 A;  3TBL D;  2EMT A;  1RRB A;  4URK A;  1KM7 A;  2V4L A;  4ANV A;  4MJS B;  2FCN A;  2BYV E;  3MJW A;  3DQV A;  3DPD A;  4OVV A;  4AWJ A;  4DWF A;  2JF5 A;  4ANW A;  4E71 A;  1Z2M A;  3OJ4 B;  1U4A A;  2C7N B;  1WRD B;  1TBE A;  3ZDM C;  2PE9 A;  3PHX B;  3QJZ A;  2AYO B;  3KYD D;  3ML9 A;  4BKS D;  2L05 A;  3H7S A;  1EO6 A;  2LUE A;  3A4R A;  4NQL B;  3U30 A;  4NAW B;  3WAO A;  1V49 A;  2Z0D B;  2MW5 A;  1S1Q B;  4HDO A;  3ZNG C;  4KDI C;  1PQS A;  4G50 A;  4XX5 A;  5C23 A;  3EFU A;  2RGF A;  3PRZ A;  1Q1O A;  2KC2 A;  4BKT A;  1BT0 A;  2BWE S;  2BPS A;  2JXX A;  2PE6 B;  3P2B A;  3KYC D;  4WWN A;  3A1Q B;  4NJ6 A;  1I35 A;  2KFK A;  3MTN B;  1WMH A;  1V5T A;  2ZCB A;  2KC1 A;  3VUW A;  1GJZ A;  2LVQ A;  3AXC A;  3B1L X;  4XZ4 A;  2JUO A;  4FUL A;  2CS4 A;  1P3Q U;  4K1R B;  3VAW A;  2DYM A;  3VFK A;  3N30 A;  5DPR A;  3L17 A;  1UD7 A;  4KZC A;  3KUD B;  3WA0 A;  3SD5 A;  2K25 A;  3B0A A;  2JRI B;  2JZZ A;  3V6C B;  3VH4 B;  4DHZ E;  1S3S G;  2KMA A;  3M62 B;  4GGQ A;  4EFO A;  4HJK A;  3D32 A;  3ZDT A;  3PRM B;  4WJP A;  3AI5 A;  1ZGU B;  1WGY A;  3WAL A;  3PTF C;  4WQO B;  2BKF A;  1R4N I;  2NS5 A;  3KW5 B;  1NI2 A;  1EUV B;  1A5R A;  2LAS A;  3X0W A;  1T0Y A;  3SU8 X;  2PPH A;  1WR6 E;  1WXM A;  3APF A;  1TGZ B;  2KFK B;  2Z59 B;  1WMH B;  3RUL A;  3IFW B;  5LLI A;  3PSE B;  3ZLZ A;  1WJ4 A;  1E7V A;  3KUZ A;  3PRE A;  3DDC B;  2LXC A;  1NDD A;  2GBR A;  2BGF A;  2CR5 A;  1E8Z A;  2LGD A;  1IYF A;  2G4S A;  5TR5 A;  3C0R B;  4WAA A;  1YX5 B;  2G3Q B;  2L0T A;  3PS6 A;  4GDK A;  4E74 A;  1WI0 A;  4AOF A;  4PYZ A;  2C7M B;  2MCN B;  2IYD B;  2MRP A;  1D3Z A;  5DPW A;  2L7R A;  5LXH A;  2NBU A;  2EMS A;  2ZEQ A;  2LGY A;  3DOW A;  2NBV B;  4AUQ C;  3DCG A;  2GBJ A;  3VUY A;  4DDG D;  4EUT A;  2JPH A;  4A3O A;  2KDE B;  1V9J A;  3QA8 A;  4IM3 A;  5D94 A;  2KQS A;  2O2V A;  3NZU A;  1GUA B;  3CST A;  3RT3 B;  1CMX B;  1E8W A;  2IO3 B;  4MGZ E;  4CO7 A;  5KHO A;  4RMA A;  3U7D A;  3IHP C;  1KOT A;  2KWC A;  2NR2 A;  4WJO A;  2MSE D;  4G11 A;  5CX3 A;  2K1F A;  4II2 B;  3TL5 A;  3IG3 A;  2KOX A;  3X23 A;  1UH6 A;  1YIW A;  2GOW A;  4FLH A;  4K7W A;  4MDK E;  3ZTD A;  2FIF A;  2KHW B;  2KK8 A;  4DHJ B;  1ZW7 A;  2KDF B;  4GDK B;  4MGI E;  2LI5 A;  3VXW A;  4CYE A;  3EC8 A;  2D10 A;  2L3Z A;  4FAD A;  3PHW B;  2REX A;  5IAA C;  2FCS A;  3APC A;  3R7R A;  3WAP A;  3HM6 X;  1L7Y A;  2GBN A;  2AWT A;  3LDZ E;  1TZ1 A;  1J19 A;  1VCB A;  4LDT D;  3UIO B;  2ZJD A;  2FNJ B;  2GMI C;  2KN5 A;  4HWI B;  3Q3F A;  3T8M A;  1TTN A;  3JSV A;  4G0N B;  2O2V B;  5D7G A;  3IVF A;  4JIO U;  2KO3 A;  2LRW A;  3K9O B;  2MBH A;  2FCM A;  4F8C B;  2MA9 B;  1E8Y A;  2BF8 B;  3DBL I;  4W9F A;  1AAR A;  2MWS B;  2MX2 A;  4KZ0 A;  3UQB A;  2M0X A;  3QX1 A;  2HD5 B;  1C1Y B;  4W9I A;  2DX5 B;  2W9N A;  4I6L B;  1Q5W B;  4HCP B;  2V3S A;  1KLV A;  4LCD E;  4TV3 A;  4AJY B;  3K9P B;  4EZL A;  1OEY J;  1X1M A;  2KQ7 A;  2N4F A;  4NJ7 A;  4BKS A;  4MEM A;  1UZX B;  3CSF A;  1ISN A;  4GSW A;  4JQW C;  5J18 A;  1G6J A;  2AEH A;  3UGB B;  2J0J A;  4B9K A;  3EHV A;  3L16 A;  1SGH A;  2K6Q A;  2KD0 A;  4JGH B;  1LM8 B;  4NNJ B;  1Y8R C;  3LJ3 A;  4W9C A;  4DDI D;  4DHZ B;  5C1Z A;  4GDL A;  3EEC A;  4RM8 A;  1LFD A;  2KMC A;  1WXS A;  2JT4 B;  3ZIM A;  3JSV B;  1E8X A;  1OGW A;  3L13 A;  2CHW A;  5E6P A;  4TUU A;  4X57 B;  1EF1 A;  2N7D A;  2Y5B B;  4ANU A;  3T9L A;  3VTW A;  4KDL B;  1WGH A;  5J2R A;  4BFR A;  2M8S A;  1YX6 B;  2C60 A;  1L2N A;  4FJV B;  4FBJ B;  4EKU A;  2ZNV C;  3OAW A;  1P0R A;  1WFY A;  2R2Q A;  3OLM D;  5FR6 A;  1UEL A;  2LRU A;  3DVG X;  3ZNI D;  3AUL A;  1H8C A;  4GIV A;  4DXA B;  3NZS A;  4WJN A;  2JVC A;  3QQ8 B;  1V6E A;  4KSK C;  4OVU A;  1P9D U;  2C7H A;  2J7Q B;  2WX1 A;  2XK5 A;  4ZYN A;  4MH0 E;  2XEW A;  3QCA A;  1Z5S B;  5CHW A;  4GDL B;  2KVR A;  2DYO A;  1FXT B;  2IO0 B;  1WX8 A;  3ALB A;  4IWQ A;  1WGR A;  1GC7 A;  3ZW3 A;  4F1S A;  2WWZ A;  3O65 B;  4ZRI A;  2LVO A;  3H1U A;  4TQ1 A;  3WAM A;  3H6N A;  4NY0 A;  4M0W B;  1GC6 A;  2G45 B;  2R2O A;  3RZF A;  3L10 B;  4XC2 A;  1YJ1 A;  1C3T A;  2L8J A;  2IO2 B;  3ZO5 B;  2IBI B;  1WY8 A;  2KLG A;  3PVL A;  4AJW A;  5GMV A;  2IY1 B;  4RM9 A;  3U8Z A;  1J0G A;  2KZR A;  2KFJ A;  3UIP B;  3RD2 A;  2NPT A;  4MGY E;  5JHB A;  3N3K B;  3VVW B;  2OOB B;  1MG8 A;  1LXD A;  2XK5 B;  2ZNV B;  5D6J B;  3PLU A;  3RCZ A;  2J0M A;  2QHO A;  4MSQ B;  4PS8 A;  4GXB A;  3SDL C;  2D3G A;  3VTU A;  3PPA A;  4IWP A;  2A5U A;  4W9K A;  3W1Y A;  2M4N A;  3QAQ A;  5IA7 A;  5CHV C;  1OEY A;  4W9E A;  4BVU C;  2KXJ A;  3H7P A;  4HCN B;  4J6I A;  5EDS A;  2IO1 B;  3PRP B;  3AU4 A;  2N1W A;  4ZRJ A;  2MBB B;  4B6W A;  1E90 A;  4BBN C;  3DBS A;  2KLC A;  2O6V A;  4E3C A;  2HJ8 A;  3CMM B;  3A9J A;  4FA6 A;  3BY4 B;  2MBO A;  2MQJ A;  5JZE B;  2V1Y A;  3ONS A;  4IC7 B;  1V80 A;  2NPT B;  4M8N A;  3JVZ X;  3HM3 A;  1NBF C;  4W9J A;  2KWU B;  2I1K A;  2ZPN A;  4HXD A;  4WWP A;  1VD2 A;  1LQB A;  3TIX A;  3S2A A;  3BIN A;  1IP9 A;  3PT2 B;  4KVG B;  4HPM B;  5AZG A;  2MBE A;  3Q3J A;  1UGM A;  4GOC A;  2LZ6 A;  2KTR A;  4A20 A;  1WE6 A;  4KIK A;  4YL8 A;  3V6E B;  2HTH A;  2CKH B;  1K8R B;  4BKG A;  3WAN A;  3ZRF A;  2D11 A;  2BWF A;  5E6O A;  1F9J A;  1JRU A;  2KJR A;  2KX0 A;  3PLV A;  2O6V B;  2DHZ A;  2GBM A;  3ZVV A;  1EF5 A;  2DZK A;  3A9J B;  2WDT B;  3L54 A;  2IZV B;  2ZVO A;  3NS8 A;  2J0K A;  2YVC A;  5L83 A;  2RR9 A;  3TCA A;  3MHS D;  3DBH I;  2K8H A;  1WM3 A;  2PEA A;  3VQI A;  4I6P A;  2CHX A;  3SHQ A;  4LJP B;  3N32 A;  3A9K A;  2GBK A;  3R3M A;  4JL9 A;  2C9W B;  1V5O A;  4LDT B;  1WIA A;  2YLM A;  3ENE A;  3VTV A;  4NPN A;  3KVF B;  3R7Q A;  4HVB A;  3V60 A;  2KDI A;  2KJ6 A;  3B08 A;  4MSM B;  2KTR B;  2M1M A;  4KIK B;  4MGK E;  5DCN A;  4IWO A;  4PS3 A;  4B95 A;  2NBW B;  3L08 A;  5LXI B;  2UYZ B;  3DBR I;  4TKN A;  4II3 B;  3NHE B;  3ZUN A;  2N9P C;  4A3P A;  2D07 B;  1WX7 A;  1WGD A;  2FAZ A;  2MP2 A;  3UQA A;  1H4R A;  4F7Z A;  2DAF A;  1WE7 A;  3PGE A;  4FJY A;  3M63 B;  4IW0 A;  3W1S C;  4EEW A;  2OJR A;  1RLF A;  1XQQ A;  4KV2 A;  2EKE C;  2LGX A;  4ZRK A;  5JHA A;  3A9K B;  2KJH B;  1WXV A;  3APD A;  3ECI A;  1ZKH A;  2N9X A;  1YD8 U;  3TJP A;  2CHZ A;  1UBI A;  2XBB C;  4PYU A;  2N1V A;  4MEL A;  1V2Y A;  3W1S A;  1WZ0 A;  2RSU A;  4W9H A;  1WJN A;  3TMP B;  2DEN B;  2ZPY A;  5J17 A;  2LXA A;  5G55 A;  3HK0 A;  2C5L C;  2K39 A;  3VDZ A;  2KAN A;  5KHQ A;  2BYF A;  2FUH B;  2NVU I;  3CF6 E;  3QHT A;  2ZCC A;  2ASQ A;  1WJ6 A;  2HE7 A;  2K8B A;  3R66 C;  3VHT C;  1OQY A;  2LVP A;  4FJZ A;  4EZK A;  2KTF A;  3HIZ A;  4CHK A;  2RD0 A;  2AL3 A;  2JWZ A;  3IBE A;  1YQB A;  1WGG A;  4HLE A;  2KX3 A;  2IY0 B;  5L95 C;  2MP2 B;  5D2M B;  1V81 A;  2NCN A;  3VUX A;  4GN1 A;  1KJT A;  2A4Z A;  2Z0E B;  3ML8 A;  3PZD A;  3KUC B;  5HKH A;  1WH3 A;  4FHK A;  3PV1 A;  3QIJ A;  1WF9 A;  1WXA A;  3RYT A;  4ICV A;  4BOZ B;  4IM2 A;  3RUI B;  3H9D A;  3WIM A;  2DZI A;  4M8M A;  3VH3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...