2KJRA

Solution nmr structure of the n-terminal ubiquitin-like domain from tubulin-binding cofactor b, cg11242, from drosophila melanogaster. northeast structural genomics consortium target fr629a (residues 8-92)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
95
structure length
95
Chain Sequence
MGHHHHHHSHGKSDFIKVNVSNSHNDAVAFEVKLAKDLTVAQLKTKLEILTGGCAGTMKVQVFKGDTCVSTMDNNDAQLGYYANSDGLRLHVVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the N-terminal Ubiquitin-like Domain from Tubulin-binding Cofactor B, CG11242, from Drosophila melanogaster. Northeast Structural Genomics Consortium Target FR629A (residues 8-92)
rcsb
source organism Drosophila melanogaster
molecule tags Chaperone
molecule keywords CG11242
total genus 16
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kjrA01
1GC7A 2FIDA 4IC7B 4BBNF 2V3SA 1E8YA 2KTRA 1TZ1A 2N9PC 1V49A 3M63B 1R4NI 3X0WA 1S3SG 1TTNA 1WE7A 1P1AA 1PQSA 1V86A 2KX3A 1WXMA 2NBUA 2LJ5A 1GJZA 2I1KA 3A1QB 3OJ3A 2KANA 4EFOA 5JHBA 4URKA 4W9JA 2IY0B 3UF8A 2KKCA 1P98A 1YD8U 5LXHA 2A5UA 2OOBB 2QHOA 1E5WA 4AUQC 1UGMA 2DAJA 3A1QA 2MQJA 3N30A 4RMAA 3ONSA 3DBLI 2LXAA 1OEYA 3M62B 3ZO5B 1IP9A 2KTRB 1WR6E 2GOWA 2LVPA 4HPMB 2XBBC 1V6EA 2KO3A 1WR1A 2CHZA 5CHVC 3L54A 2HD5B 2V4LA 2C7NB 3JVZX 1WXVA 5CX3A 5E6PA 1TGZB 1G6JA 4AWJA 4K7SA 4II3B 4GGQA 1WJUA 4F8CB 3ENEA 4JQWC 3ZVVA 1YIWA 1WJNA 4GXBA 5GMVA 1OQYA 2KK8A 1WFYA 4ZRKA 2HTHA 2LWPA 3H7SA 4KV2A 2J0MA 4B9KA 2GBJA 3IBEA 3PT2B 3MTNB 3APDA 4GDLA 1EF5A 1KLVA 1E7UA 4W9CA 1P3QU 4X57B 3DVNU 4ICVA 2KWCA 2N7DA 5FR6A 2HJ8A 2PE9A 4GU2A 4W9KA 3VVWB 2GBRA 1A5RA 2L76A 1WI0A 2XK5B 2PE6B 1F9JA 4HJKA 4WWPA 5JH5C 2K6QA 4HXDA 2DHZA 3W1YA 3ZW3A 4HCNB 4ZYNA 3V6CB 2EMTA 2BYFA 2LGYA 4J6IA 2MWSB 2FCNA 2AEHA 1QZEA 2FAZA 3KUDB 4GMVA 1E90A 3PGEA 3K9PB 2KNBA 3I3TB 2AL6A 2G45B 4DDID 3ECIA 2D07B 2D11A 2LVQA 2ZEQA 2DX5B 1RAXA 2ZNVC 3ALBA 1FXTB 4MEMA 4WJOA 2IYDB 3PREA 5E6OA 3GZNI 3ML8A 1BT0A 4JIOU 4CYEA 5KHOA 1WM3A 2LGDA 4M8MA 3T8MA 2R2QA 2K25A 3DCGA 4W9EA 3JSVA 3WAPA 2XEWA 3ZNZB 1WJ6A 2O6VA 3DQVA 3R7RA 1WMHA 2BF8B 2KC1A 3HK0A 3UIPB 5KHQA 4OVVA 2YVCA 3Q3JA 5JZEB 1H8CA 3M3JA 1SIFA 4DWFA 2EKEC 1EO6A 4FHKA 4MH0E 4EEWA 4M8NA 4LDTB 1WXAA 5DPSA 3DBSA 5HKHA 4MELA 3WA0A 3VTUA 1ZGUB 4K1RB 2G4DB 2N9XA 2WWZA 5AZFA 4A3OA 2L3ZA 1YJ1A 2DZJA 2LZ6A 4W9LA 4FJVB 3P2BA 3L17A 4MGKE 1RLFA 4KZCA 2ZVNA 2ZPNA 3LDZE 1WX8A 2M1MA 3PHXB 4HCPB 3DBHI 4MSQB 3KUCB 2IY1B 2KQ7A 3PRZA 5DPRA 3T9LA 2NCNA 4BKTA 3DVGX 4HVBA 3R3MA 4IW0A 1D3ZA 3EHVA 3PHWB 5TR5A 5DCNA 4ASWC 2KLGA 3A4RA 3ZKJC 2JRHA 4WJPA 4PYZA 2MBBB 3H9DA 3NHEB 2Y5BB 3QJZA 3WALA 3JYUA 3PLUA 4KSLC 3SU8X 4BOSC 4WWOA 4W9IA 4GB9A 1UZXB 1V5TA 2ZPYA 5LLIA 1I35A 2GBKA 3QA8A 2C5LC 1NDDA 2JXXA 3PRPB 2BKFA 2O2VA 4DK5A 3PV1A 4IWOA 3PLVA 2CR5A 2JUOA 4I6LB 2M17A 4XZ4A 5CTRC 1LFDA 1XQQA 3BY4B 4WJQA 1WGGA 2GBMA 4FHJA 2AYOB 4KSKC 1Z2MA 2IBIB 3KVFB 5CHWA 3TIXA 1J19A 3PRMB 4IM2A 3ZRFA 3PS6A 2RD0A 2JPHA 2A4ZA 3U30A 4FN2A 4F1SA 4FADA 5IAAC 1L7YA 1NI2A 5BO4B 4NQKE 1WZ0A 1U4AA 2KJHB 4KZ0A 3VUYA 1OGWA 2BYEA 3HHMA 2L7RA 2Z0EB 3HIZA 4FULA 2D3GA 3JW0X 3TMPB 3VAWA 2LI5A 3W1SC 3N3KB 3SD5A 1ZKHA 1GG3A 4KDLB 3VXWA 1WRDB 4F7ZA 3A9JB 4B95A 3W1SA 2L0FA 3MJWA 1X1MA 2LGXA 3APFA 3UGBB 3ZTDA 2IO3B 3KUZA 3A9KA 3PSEB 3B08A 3QWZB 5D7GA 1ZW7A 1WMHB 2L05A 2LUEA 4BOZB 1E8ZA 3L16A 3VHTC 1IYFA 5DPTA 3V60A 1CMXB 3RD2A 4NJ7A 2JRIB 3VH3B 4DHZB 4BVUC 1UELA 3ZNHB 2LVOA 2VRRB 3BINA 4KIKB 4NAWA 2PEAA 2B3AA 3UINB 4IUMB 2DENB 4GDLB 4BKSA 4MM3A 2J0KA 2KDIA 4FBJB 3DVGY 3H7PA 4HK2A 4JLCA 2L0TA 1WGHA 1SGHA 2DZKA 2RPQA 1MG8A 4HLEA 2MP2B 2REXA 1V81A 2N7EA 2KMCA 1Q1OA 3X23A 2O6VB 2IO2B 2KTFA 4N9F4 3RYTA 5EDSA 2CHWA 1P0RA 3SHQA 2FNJB 2KC2A 2UYZB 1KOTA 4TV3A 3L10B 4DHJB 3HM6X 4M0WB 5J17A 4LDTD 3VQIA 3VUWA 4JL9A 4B6WA 3IVFA 4W9HA 2PJHA 4ANVA 4NNJB 4KDIC 2RR9A 3ZNGC 4DBGA 3WIMA 2MBEA 2M4NA 2D2QA 3ZRCA 3C0RB 2JT4B 3OJ4B 3IHPC 4IM3A 4NY0A 3U8ZA 1XD3B 1WGDA 2N1VA 3NZUA 2KQSA 1YX5B 4PYUA 3DVNV 2CHXA 3EECA 2WYQA 4BKSD 1GNUA 4ZRIA 4WQOB 2GBNA 3OAWA 2JVCA 2KD0A 1WY8A 3CMMB 4DHJD 3EC8A 3KYDD 1H4RA 3AULA 4TKNA 2MSED 3GOEA 4XC2A 2MBHA 1T0YA 2JY6A 3WANA 2DYMA 2WDTB 2NS5A 4LCDE 4NPNA 2JF5A 2YLMA 2ZNVB 3U7DA 4E3CA 4DHZE 1C1YB 2LRUA 2JZZA 2D10A 2KJ6A 2LASA 4TQ1A 4A20A 2MX2A 2OJRA 1P9DU 1J0GA 4EUTA 3SDLC 3EFUA 3VUXA 5AZGA 2DZMA 3MHSD 3VFKA 1R4MI 4TUUA 3AU5A 3IG3A 3M95A 3OLMD 2DYBA 4G0NB 1WZ3A 2RGFA 1L2NA 2O2VB 2ZJDA 3ZUNA 2C9WB 3H6NA 1WXSA 1WF9A 4RM9A 4ANWA 3D32A 3UQBA 1WIAA 3VH4B 4I6PA 4KIKA 4NAWB 3LJ3A 1UH6A 2IO1B 1RFAA 3DPDA 2JWZA 4GN1A 3K9OB 4ANXA 2KVRA 3ZNID 1WJ4A 3RUIB 3QCAA 2I1JA 1HE8A 4HWIB 3APCA 4MGIE 4NQLB 1LQBA 2IZVB 4W9FA 2R2OA 1LM8B 3V6EB 1WM2A 1M94A 3VTWA 4II2B 2MBQA 2K8HA 4FJYA 5L83A 1JRUA 1I42A 2CU1A 1KJTA 2K6DB 2WX0A 4CHKA 2BKRB 5J2RA 1Q0WB 2N4FA 3UIOB 3KH0A 4AJWA 2MCNB 3S2AA 3IFWB 1ISNA 2J7QB 4MDKE 4BFRA 4E71A 1WE6A 2KFJA 2CKHB 2K8CA 4IM0A 1WGYA 5E6NA 1EUVB 4YL8A 1OEYJ 4P7IA 2L00B 1J8CA 4IWPA 3N32A 3TCAA 4BKGA 2MP2A 4IG7B 1V5OA 3A9KB 3CSTA 3ZTCA 4MJSA 1AARA 4JGHB 2KWUB 4DDGD 4RM8A 2NPTB 1EF1A 3PVLA 2O6VD 1UD7A 2C7HA 4MSMB 1IPGA 5L95C 2FCQA 4FA6A 2IO0B 2KJRA 1E8XA 2FIFA 2DZIA 1V9JA 4KVGB 2KXJA 4GDKA 4EZKA 1WYWB 2G3QB 2V1YA 3RZFA 3AXCA 3HM3A 1Q5WB 4PS7A 4A3PA 4TQ0A 3L0WB 1XT9B 2MBOA 3NS8A 5CHFA 2MLBA 3CF6E 1C3TA 2BGFA 4OVUA 2C7MB 3PPAA 2KZRA 2KFKB 4AOFA 4IWQA 1WX7A 3QARA 1S1QB 5G55A 2UWQA 4ZDVA 5IA7A 2KDEB 4FJZA 2MA9B 5C23A 3QQ8B 3H7PB 3PTFC 3VTVA 3QIJA 1NBFC 2DYOA 2MRPA 1E7VA 3Q3FA 4MGZE 3L08A 2XK5A 3RT3B 2KWVB 4G11A 3QK0A 2CS4A 2KN5A 2W9NA 2EMSA 3ML9A 4K7WA 2JZ3B 2KLCA 4GSWA 4PS3A 5D94A 4G50A 3H1UA 2GMIC 4K81A 1V80A 1SE9A 4MJSB 2ASQA 1VCBA 4XX5A 4PS8A 4ANUA 4AP4C 2KHWB 1UBQA 2N9EB 3A9JA 4EZLA 1LXDA 2K1FA 3ZDMC 2DAFA 2BWES 1OTRB 4K7UA 3RULA 1E8WA 2KFKA 4HDOA 2BPSA 2L8JA 3JSVB 3WAMA 4LJPB 1RRBA 4ICUA 1V2YA 2NR2A 4G3XB 4HDQA 4E74A 2WX1A 4EZJA 4CO7A 2M8SA 3NZSA 2ZCCA 3WAOA 2RSUA 2LRWA 3AU4A 3RCZA 1GC6A 4GDKB 1VD2A 1YQBA 4W9GA 1Z5SB 2KMAA 2BWFA 2HE7A 3AI5A 1K8RB 2K8BA 2Z0DB 4NJ6A 4LJOB 2C60A 4EOYA 3CSFA 2LXCA 1KM7A 3TBLD 2NPTA 3V61A 4BBNC 3A4SC 3ZLZA 2BYVE 4WWNA 4WAAA 3QAQA 3O65B 1Y8RC 2AWTA 4FLHA 3NOBA 2G4SA 2M0XA 3UQAA 3NY5A 5AZHA 4AJYB 3VDZA 3KYCD 2KDFB 3B1LX 4EKUA 2KX0A 3R66C 2N1WA 1WGRA 2PPHA 5LXIB 3L13A 1GUAB 3KW5B 4GIVA 4I6NB 2Z59B 2ZZPB 3QHTA 4GOCA 2NBVB 5D2MB 3TL5A 4DXAB 2LD9A 4WJNA 5AEKB 2NBWB 3DOWA 3ZDTA 5C1ZA 2ZVOA 4W9DA 3DBRI 1YX6B 2KDBA 3ZIMA 3RZWC 3B0AA 1UBIA 5D6JB 4MGYE 3TJPA 5JHAA 5J18A 2NVUI 1WX9A 3QC8B 4HPLB 4ZRJA 2FCSA 2ZCBA 2FUHB 3A33B 2FCMA 2K39A 3DDCB 3V62A 5G2NA 3R7QA 5DPWA 2J0JA 1WH3A 3QX1A 2AL3A 2MW5A 3PZDA 2KOXA 1TBEA
chains in the Genus database with same CATH superfamily
2FIDA 1E8YA 1TZ1A 3X0WA 1S3SG 2K22A 1FCLA 2NBUA 4EFOA 1L0YB 3A1QB 1YJIA 4XDCA 1P98A 1MFWA 3FC4A 2MQJA 3PZ8A 3N1ZC 3BVMA 1OEYA 3ZO5B 1KTKA 1N63A 1WR6E 2GOWA 1V6EA 5CHVC 4RNAA 2HD5B 2C7NB 1C79A 2FBWB 1G6JA 4II3B 4F8CB 1OQRA 4JQWC 1YIWA 1WJNA 1JW9D 2KK8A 1PDXA 2LWPA 3Q8BA 4B9KA 2GBJA 1QKZA 1KLVA 1E7UA 2BVCA 4ICVA 5FR6A 2N7DA 2PE9A 4W9KA 1A5RA 1UNSA 3AEFB 2XK5B 2PE6B 4WWPA 5JH5C 3DBRB 4HCNB 4ZYNA 3MJ5A 1N61A 3ZXRA 2LGYA 3KUDB 4YTPB 4GMVA 3K9PB 2KNBA 3PZ7A 5EE1A 2D11A 2DX5B 1HQRD 3NZ3A 3I57A 2LHDA 3ML8A 3T8MA 3WAPA 2K25A 4ZHPA 3I63C 3AEGB 3R7RA 1F2RC 1WMHA 3HK0A 1FMAD 5KHQA 2K0PA 4FHKA 4MH0E 4EEWA 1YQ4B 3C8YA 5HKHA 1E0ZA 2JWUA 1ZGUB 1XCTL 1FIQA 3I9V1 2WWZA 2L3ZA 2INCC 1NEKB 1D5ZC 4M0WA 1PGBA 1V8CA 3L17A 4KZCA 3B2FA 3MC8A 2MHJA 2KQ7A 3PRZA 5DPRA 3T9LA 1QOGA 3Q8CA 3AE1B 2JRHA 3H9DA 3WALA 4W9IA 1FD6A 1UZXB 1V5TA 2EKIA 3QA8A 4RGNA 1IBXA 2JXXA 3PRPB 1V1PA 2O2VA 5AUIA 4IWOA 1TS5A 2BW2A 2JUOA 3BYTB 1XQQA 2YEPB 4WJQA 5CHWA 3SEBA 2IBIB 1SXTA 3PRMB 3ZXVA 2RD0A 1SSNA 1E7PB 3IAM1 2A4ZA 4LLGM 2GB1A 3U30A 3ZGZA 4FN2A 2PW9A 1L7YA 1NI2A 5BO4B 3B9JA 3HVDA 1WZ0A 3HIZA 2D3GA 2W82A 1WXQA 3FAHA 3W1SC 1I4RA 3VXWA 1WRDB 3MJWA 1X1MA 2LGXA 3AEDB 2IO3B 5H8YE 2NMQA 3B08A 1WMHB 1E8ZA 3GE8C 1TY2A 3VHTC 1CMXB 3RD2A 1UELA 3ZNHB 3BINA 2DWQA 2WXNA 2PEAA 2B3AA 4GDLB 4BKSA 4MM3A 2J0KA 4YT0B 3DVGY 4HK2A 2RPQA 1MG8A 2WHIA 4BAXA 2KMCA 1Q1OA 1GB1A 3RYTA 5EDSA 2FNJB 3HM6X 4LDTD 4B6WA 3OWEB 2CU3A 3IVFA 3NS1A 2K5PA 1CQVA 3ZNGC 4DBGA 2MBEA 2JQRB 3ZRCA 1C76A 1RWSA 4NY0A 4IM3A 3U8ZA 4D2KA 3NZUA 1I4HA 1WGKA 2H88B 3HVZA 4PYUA 1HA5A 3DVNV 2WYQA 4BKSD 1L0XB 4ZRIA 4A90A 3N9YC 3AE8B 3KYDD 1T0SC 4TKNA 3AV8A 3GOEA 3N1XC 3WANA 4LCDE 3NUHB 4J3OD 2ZNVB 2E6XA 1M4VA 2LRUA 4RFBA 2D10A 4A20A 1K50A 2OJRA 1P9DU 1ZDVA 4JE3B 2V9HA 1R4MI 2AX5A 2NTSA 3IG3A 3M95A 4YSYB 2C9WB 1L4DB 3D32A 1C4AA 2WP9B 3VH4B 4NAWB 2KDMA 2IO1B 1RFAA 2JWZA 4GN1A 5D3IB 4ANXA 1TT5B 2I1JA 4HWIB 1FM0D 1WM2A 1C78A 4FJYA 5L83A 2K6DB 2WX0A 1KRHA 1D4BA 3KH0A 1ISNA 2J7QB 1SE4A 1WE6A 2KFJA 3P4QB 1FFVA 4IM0A 4LK0M 4P7IA 3AN1A 4IWPA 3N32A 4BKGA 2MP2A 4IG7B 2TSSA 4L2YA 3ZTCA 4MJSA 2ON8A 1AARA 2KWUB 4RM8A 4HRSA 3N1YC 3NRZA 1E8XA 3L4PA 4GDKA 3E56A 2K9XA 2V1YA 3RZFA 4A3PA 1YJJA 2MBOA 2QDFA 2MLBA 1C3TA 1KF6B 1BMLC 4WH4A 2KZRA 1JQ4A 2KFKB 4YWGG 1WX7A 3KWVA 4FJZA 1SF0A 2MA9B 1ZP0B 3CWIA 5C23A 3H7PB 4RF1A 3IAS1 2RDBC 4C56C 1VDVA 3Q3FA 4L1BA 3RPFC 2IGHA 3RMKC 3RT3B 2KN5A 3Q69A 3ML9A 3V05A 2DBYA 1V80A 1SE9A 1CK1A 2ASQA 1VCBA 4XX5A 1P7FA 3Q8FA 1I4GA 2KACA 3ZDMC 4OZBA 1MHXA 1TS2A 2BPSA 4REZA 4ICUA 4PK1A 4DQOC 1HTOA 2RSUA 1J7AA 3RCZA 1VD2A 1Z5SB 2BS4B 4H2AA 2HE7A 2WS3B 2WXHA 4LJOB 1TY0A 1XLPA 3BWUD 3V61A 1VR9A 1K52A 3A4SC 3ZLZA 4WWNA 4WAAA 2AWTA 3IT6B 2INPE 3VDZA 2KAJA 3VRBB 4EKUA 2BT6A 3R66C 2N1WA 1WGRA 3KW5B 4I6NB 2Z59B 2ZZPB 1QOAA 2LUMA 4GOCA 2NBVB 2LD9A 4WJNA 3ZDTA 5C1ZA 2ZVOA 2J52A 2WU5B 3RZWC 3B0AA 1UBIA 1HZ6A 4MGYE 1T3QA 1DOYA 4WAFA 1WX9A 4ZRJA 2K39A 1WWTA 1RYJA 5G2NA 2MW5A 2L1AA 4EE2A 2W54A 4BBNF 1KLGD 2MEKA 2KTRA 4IKGA 4OHJA 4K3CA 1WE7A 4MACA 2CJNA 1E6EB 2LJ5A 4YSXB 3AEEB 3OJ3A 5JHBA 4TMAB 4W9JA 2WXFA 4LNOA 3ZQ4A 5IP4D 1QLBB 1E5WA 1XCQL 2SEBD 4JPSA 1TJEA 4RMAA 3P4RB 1YN3A 3DBLI 3HUIA 2KTRB 2IGGA 4L23A 2V4LA 1WXVA 5CX3A 2LGSA 5G5HA 4LNIA 2RDGA 3ZVVA 3AE6B 5LNK1 4GXBA 4ZRKA 1I4PA 3H7SA 4KV2A 1TKYA 2QJLA 2WXQA 2JXTA 2J4XA 4RCOA 1IBXB 3VVWB 1IGCA 3MHZA 1F9JA 1EU3A 4HJKA 1FRDA 2L32A 3R2TA 4RGTA 2N0SB 3V6CB 2EMTA 4J6IA 2WXLA 2FAZA 1V1OA 1E90A 4ZRPA 3I3TB 1E10A 4DDID 3ECIA 2LVQA 1ACCA 2ZNVC 5TSSA 2HTME 4MEMA 3PREA 5BYRA 3GZNI 4OW0A 4CYEA 1J7CA 2RMMA 4M8MA 3DCGA 3JSVA 3ZNZB 2XEWA 1WJ6A 2O6VA 2WQYB 2KQ4X 2V3PA 2KC1A 3UIPB 1AWDA 4OVVA 2WDVB 1PYWD 4ITKA 1EO6A 2BBCA 4LDTB 3DBSA 3WA0A 4N6EB 2DZJA 4US9A 3NVVA 3IXSA 4BZAA 3P2BA 1FNWA 2J53A 1RLFA 2ZVNA 3PHXB 3KUCB 2IY1B 3Q6BA 4M01A 3DVGX 4KGTA 3R3MA 3PHWB 4WJPA 2R61A 4LNFA 3NHEB 2Y5BB 2Y5CA 3PLUA 1XO3A 4BOSC 2ZPYA 5LLIA 4K3BA 2QSDA 4AQ7A 1NDDA 3W5UB 2BKFA 5EE0A 3PV1A 4ZOHC 2IPKD 2GLSA 4XZ4A 1LFDA 1TIFA 4KSKC 4FHJA 4B0EA 2LEKA 1VJKA 4FADA 5IAAC 1YMHE 4NQKE 4XDDA 1OGWA 1FEHA 2BYEA 3HHMA 3RNGC 4FULA 1T5XD 3TMPB 4NAMA 2JZPA 1GG3A 3C19A 4F7ZA 2BB5A 3A9JB 1MHHE 3APFA 3BVZA 3KUZA 3PSEB 2L05A 2KWDA 3URYA 4IDIA 1ZE3D 4TSSA 3V60A 2WNMA 1OFFA 5BMHA 1NENB 1QT9A 2D3AA 2LVOA 2VRRB 3NVWA 3UINB 2DENB 2AQ2B 2E3TA 1XXGA 3EA6A 2REXA 1V81A 1I7HA 3X23A 2PKOA 1J7BA 2KTFA 4Q2JA 2CHWA 1N5XA 1KOTA 2PJHA 3NJTA 2RR9A 1CZPA 3WIMA 5IN7A 2JT4B 3OJ4B 2D3CA 3DWGC 4S17A 1XD3B 2KQSA 3LXFA 2CHXA 2VZKD 4AS1A 1E9MA 1GNUA 2N9KA 2MJ3A 3AE7B 4JWUC 3OAWA 2JVCA 2KD0A 1WY8A 2MJDA 2HDEA 5G5GA 1ENFA 2RPVA 1KLUD 1MJDA 3EC8A 1ESFA 1H4RA 4A6QA 4DXFA 2MBHA 2WDTB 4NPNA 1MI0A 2YLMA 4RF0A 3U7DA 4KX6B 4N58A 1C1YB 1JWAD 1L0VB 1TKGA 3MHSD 3P63A 4TUUA 2DYBA 3ETRA 4G0NB 5BYSA 1L2NA 1V1PB 2O2VB 4ANWA 1WIAA 3Q8EA 2N7JA 4KIKA 3LJ3A 1UH6A 5FR3A 2KVRA 2W3SA 2ZW0A 4MGIE 4NQLB 4N59A 2AQ1B 4KGSA 1V97A 3VTWA 2LMCA 4A8XC 2IJ0A 2CU1A 2QILA 4CHKA 4XWTA 3AE3B 2N4FA 3UIOB 1SB3C 4P1BC 2MCNB 3S2AA 3IFWB 4E71A 2K8CA 4RH6A 1FRRA 1T6BX 1XLQA 1OEYJ 5IOIA 1TS3A 1MPEA 1V5OA 2LHEA 1L5PA 3PVLA 2PTLA 1IPGA 2D3BA 2IO0B 2KJRA 2XN9C 1KH0A 2BQQA 2KXJA 1WYWB 2G3QB 1SJED 3N20C 1XLNA 2QC8A 3HM3A 4HROA 4TQ0A 3NS8A 1XT9B 5CHFA 1VRAB 1D5MC 3CF6E 3PPAA 3IT4B 2QMTA 1EM7A 2UWQA 4ZDVA 1F77A 3VTVA 1NBFC 3DHHC 5MPOA 2XK5A 1SE2A 4G11A 3QK0A 2CS4A 2W9NA 1C4CA 1T0RC 2KLCA 4GSWA 1Y56A 4G50A 3H1UA 1HZ5A 4K81A 4MJSB 4PS8A 4ANUA 4AP4C 1HEZE 2KHWB 2N9EB 3ZJVA 4EZLA 2ONQA 2K1FA 2DAFA 1F1HA 4K7UA 2V0GA 1NI3A 1TZOA 2WXIA 1ET9A 2DLBA 4LJPB 1V2YA 2NR2A 4G3XB 4HDQA 2QEJC 4CO7A 2M8SA 1UF0A 4M00A 4YTMB 3AU4A 5C3JB 1YQBA 4WURA 2K8BA 2C60A 2LXCA 3TBLD 2PVOD 1K51A 2BYVE 3QAQA 2M0XA 2WXKA 3UI3A 3KYCD 3P4PB 4ARIA 2KDFB 2KX0A 5LXIB 4GIVA 5JXVA 4DXAB 5AEKB 3DOWA 3KQ4A 3MP9A 3ZIMA 2WGSA 5J18A 2NVUI 3QC8B 4US8A 1DOXA 2FUHB 3V62A 3PZDA 2BS3B 1GC7A 4P1CC 1TKEA 2V3SA 2N9PC 3TEXA 1R4NI 4LNKA 1P1AA 1IGDA 1V86A 1GJZA 1ZXIA 2I1KA 1C77A 1K53A 2IY0B 3UF8A 2KKCA 5LXHA 3KWLA 2A5UA 4HJGE 4AUQC 1UGMA 3A1QA 3N30A 2WLBA 1ZUD2 4P16A 2BTEA 2LXAA 2KN4A 3M62B 1IP9A 2INDC 1YOVB 2XBBC 3VR9B 1WR1A 2B76B 3L54A 3ZYYX 3JVZX 1PGAA 1TGZB 4AWJA 4GGQA 4JX1C 3AE5B 3ENEA 2DNFA 1QOFA 1OQYA 2HTHA 1ZOYB 2GRIA 3AEAB 3IBEA 3PT2B 3R2IA 3MTNB 3APDA 4GDLA 2D5GA 1P3QU 4OZAA 3DVNU 2KWCA 3GZNB 2HJ8A 4C4VB 5GXGB 2K6QA 3ZW3A 2UU7A 1ZDXA 1HTQA 2BYFA 1BUIC 2KYWA 3AM9A 2G45B 2V4IB 2D07B 2ZEQA 1L6UA 3EFCA 4WJOA 2IYDB 5E6OA 1WM3A 4ZRQA 3MC0B 3TEYA 2OHFA 2R2QA 3DQVA 4KGRA 2IDYA 4FXCA 2YVCA 1H8CA 1WRIA 3M3JA 1SIFA 4DWFA 4A55A 4MELA 4C7YA 5C2TB 2N9XA 5AZFA 2V3NA 1YJ1A 2LZ6A 2JSVX 4AJWA 2ZPNA 1WX8A 3DBHI 4MSQB 3J9CA 1QF6A 4IW0A 1D3ZA 2BB6A 1B9RA 5TR5A 4ASWC 2KLGA 3A4RA 4WWOA 4GB9A 1TYGB 5T8IA 3FKYA 1I35A 3MC9A 3BIID 2GBKA 3DHGC 4DK5A 5I4DA 3PLVA 2CR5A 2M17A 5CTRC 1WGGA 2GBMA 1XEEA 2AYOB 3KVFB 5EE3A 1T0QC 4IM2A 3ZRFA 2JPHA 4F1SA 1FFUA 1U4AA 2KJHB 3AE9B 2L7RA 2Z0EB 3VAWA 1XF5L 2LJIA 1ZKHA 4KDLB 3DWMA 3W1SA 2L0FA 3ZTDA 3Q3MC 3A9KA 5AUKA 3SR6A 4LNNA 4RGOS 4BOZB 2N9LA 3L16A 3AEBB 2BS2B 2JRIB 1YN4A 4KIKB 2M19A 4IUMB 1ZXHA 4NJCA 1F2RI 2DZKA 2MP2B 2ACZB 3BYYB 2IO2B 4N9F4 2PMVA 4DXGA 1Q10A 1P0RA 3SHQA 2LGIA 2KC2A 2UYZB 3L10B 4DHJB 2VH1A 1VZ6A 3VUWA 2RDHA 4JL9A 4P6VF 4YXDB 4KDIC 2M0AA 1N62A 1GOZA 1FXAA 2M4NA 2D2QA 2H89B 4WIPA 2I2YA 1YX5B 3Q3NC 4WQOB 2GBNA 2ICIA 4O1NA 1DYQA 3CMMB 1N5WA 2MSED 4XC2A 1T0YA 2DYMA 2JF5A 4DHZE 2L52A 2JZZA 2KJ6A 3OG5A 3R8BA 2IGDA 1PFDA 3SDLC 2W3RA 3EFUA 3VUXA 3VFKA 2DZMA 2Y3AA 2W55A 3OLMD 1WZ3A 2RGFA 2ZJDA 3ZUNA 3H6NA 3U4EG 5IO9A 4I6PA 3DPDA 5IKCM 3U7ZA 2QIEB 3LB8C 4PT5A 3RUIB 3QCAA 4W9FA 3V6EB 2I38A 1LM8B 2R2OA 1M94A 3EGRA 4A9AA 1I42A 1KJTA 5BMIA 1Q0WB 2AQ3B 4MDKE 3RI7C 4B0MA 3E9SA 1JWUD 1WGYA 4XWWA 1EUVB 1N60A 4KKIA 3TCAA 3GP7A 1VZ7A 1SIJA 3CSTA 4DDGD 4MM3B 2O6VD 2LFIA 2C7HA 5HFYA 2PVGC 5L95C 2BYTA 1JMLA 1PGXA 2FIFA 2DZIA 1V9JA 3P42A 3KLSX 1JWSD 1Q5WB 1NYQA 4KKJA 3AE4B 4C80A 2WDQB 2BGFA 4OVUA 4AOFA 3NG0A 2KVZA 1S1QB 1STEA 5G55A 5IA7A 1FXIA 1QQRA 3QQ8B 3PTFC 5E6JA 2FE8A 4MGZE 3L08A 2EMSA 4K7WA 5D94A 4PS3A 2WXOA 2GMIC 3A9JA 1UBQA 1P7EA 1GB4A 1OTRB 4XYCA 3RNCC 3RULA 2KFKA 1JCKB 1WSPA 1A70A 2EELA 1L4ZB 3O13A 2L83A 1VLBA 2M56B 4EZJA 2WX1A 3RNEC 3NZSA 3WAOA 5FKAC 2LRWA 1GC6A 2OJWA 4GDKB 2KMAA 4LTUA 2BWFA 3AI5A 1K8RB 2Z0DB 2INNE 4EOYA 4BBNC 3O65B 3UQAA 4FLHA 2G4SA 2KMMA 4WWMA 1YQ3B 3NY5A 3U52E 2Q5WD 3B1LX 1FNUA 1UWMA 3L13A 3AMZA 3QHTA 3TL5A 1MG4A 1AYFA 4W9DA 4UDUC 5JHAA 3TEWA 1UUPA 2FCSA 2ZCBA 3A33B 2FCMA 2JYTA 1C4PA 3R7QA 5DPWA 1WH3A 2AL3A 2KOXA 5EE9A 1TBEA 4IC7B 3M63B 1V49A 3TSSA 1TTNA 2ZW1A 1PQSA 2KX3A 1DOIA 1WXMA 3BVGA 2KANA 4URKA 4QAYA 1FNVA 1YD8U 3VRAB 2OOBB 2QHOA 1XLOA 2DAJA 4ACFA 3ONSA 3WCQA 1OQQA 3RNAC 1LO5D 3AH7A 3H8HA 3TEZA 4HPMB 2LVPA 2KO3A 2CHZA 3VR8B 5E6PA 3EUB2 4K7SA 2GI9A 2CJOA 1WJUA 4HKZE 5GMVA 1WFYA 3I5JC 4M02A 2J0MA 3Q14C 4GLSC 1B1ZA 1EF5A 1F52A 3FILA 4W9CA 4X57B 4ARCA 4GU2A 2GBRA 2L76A 1JRPA 1WI0A 4HXDA 2DHZA 3W1YA 2MWSB 2FCNA 2AEHA 1QZEA 4HKQA 3PGEA 1D5XC 2AL6A 3Q8AA 4NZLB 3BZDB 1RAXA 3ALBA 1FXTB 1NYRA 4C00A 2KT7A 1BT0A 4JIOU 5KHOA 2LGDA 3Q2AC 1PUTA 4W9EA 1AW7A 2BF8B 2QCZA 3ZJTA 3Q3JA 5JZEB 1R4NB 2EKEC 1JROA 1ZPSA 4M8NA 1WXAA 5DPSA 1FO4A 3VTUA 4K1RB 2G4DB 4A3OA 3MFGA 2G1EA 4W9LA 4FJVB 2YEPF 3PO0A 4MGKE 3LDZE 4HCPB 2M1MA 2NCNA 4BKTA 4HVBA 3BK1A 1AN8A 3EHVA 3V3XA 2FUG1 5DCNA 3ZKJC 1LGRA 4PYZA 2MBBB 3QJZA 3JYUA 4KSLC 3SU8X 3ABVB 2MJEA 4OVZA 4ZYSA 4XGAB 1BXTA 2WXPA 2C5LC 2X38A 3NVYA 4HEA1 3Q3OC 2Y5PA 1UGJA 4I6LB 2J42A 2JYEA 3BY4B 3RN9C 3TIXA 1WYGA 1Z2MA 1J19A 3W2DA 3DBHB 3PS6A 1VZ8A 2WXJA 4KZ0A 3VUYA 3JW0X 2LI5A 3N3KB 3SD5A 3W9CB 3W5VB 1YN5A 1TS4A 4B95A 3UGBB 4WQMA 2JU6X 3QWZB 5D7GA 1ZW7A 2WXGA 4OZCA 2LUEA 3GS2A 1IYFA 5DPTA 4C4VA 4HPPA 2HJ1A 4NJ7A 1GPXA 3VH3B 4DHZB 3RFZB 3SFDB 4BVUC 4NAWA 4CQNA 2KDIA 4FBJB 3H7PA 4JLCA 1N6ZA 1EWCA 2L0TA 1WGHA 1SGHA 4HLEA 2N7EA 3GB1A 2O6VB 4YTNB 3HRDD 2SAKA 4ZHOA 4TV3A 4M0WB 5J17A 3VQIA 4RGMA 4W9HA 4ANVA 4NNJB 2OEDA 2WXRA 1D6EC 3B2GA 3C0RB 1CJEA 3IHPC 3AB5A 1HXYD 1WGDA 2N1VA 4IOIE 1SJHD 1QILA 3EECA 4DHJD 3BK2A 4R3DA 1RM6C 3AULA 3AE2B 5H92C 2JY6A 2X8XX 2NS5A 3NVZA 4E3CA 2LASA 4TQ1A 2MX2A 1GAQB 1FCCC 1J0GA 1JWMD 4EUTA 2XNAC 5AZGA 1R7SA 3AU5A 4C7ZA 1ROEA 3DHIC 1WXSA 1WF9A 4RM9A 3UQBA 1RFKA 2WDRB 3K9OB 5HG2A 3ZNID 2Z8LA 1WJ4A 3FILB 1HE8A 3APCA 1LQBA 2IZVB 1QOBA 4II2B 2MBQA 2K8HA 3TUOA 1KFYB 1JRUA 2VZKB 2BKRB 5J2RA 5BMGA 1L6VA 4BFRA 1MVKA 2K3UA 2CKHB 5E6NA 1EU4A 4YL8A 1J8CA 2L00B 1I4QA 5HHDG 3T3NA 3A9KB 1DGJA 1SEBD 4JGHB 3P4SB 2NPTB 1EF1A 3P1MA 1UD7A 4MSMB 1I4XA 2FCQA 4FA6A 4KVGB 4EZKA 1ET6A 3AXCA 4PS7A 3L0WB 3U2SC 5FK9C 2PLPA 1SBBB 4YSZB 2C7MB 5D3DA 4IWQA 3QARA 3DBLB 2KDEB 4MH8A 3QIJA 2G9HD 2DYOA 2MRPA 1E7VA 1IUEA 1UWXA 1F0ZA 5BYQA 1SE3A 2KWVB 4MT5A 2JZ3B 2WU2B 3CIRB 3RNFC 1LXDA 2BWES 1YNTE 1E8WA 4HDOA 4JWSC 1EWYC 2MH7A 2L8JA 3JSVB 3WAMA 1RRBA 4E74A 3GE3C 3AECB 2ZCCA 1JALA 1NVID 1R4MB 3LYYA 4W9GA 1FPYA 2VH2A 4NJ6A 4S0RA 2WXMA 3CSFA 1KM7A 2NPTA 1Y8RC 3NOBA 5AZHA 4AJYB 2PPHA 1GUAB 1JWBD 3T3OA 5D2MB 2NBWB 2PIAA 1C9FA 4XE0A 5HI1A 2NTTA 3RNBC 4USAA 3DBRI 1YX6B 2KDBA 5D6JB 3TJPA 2JX5A 4HPLB 3DDCB 3SFEB 2J0JA 3QX1A 3ZJUA
chains in the Genus database with same CATH topology
1GC7A 2FIDA 4IC7B 4BBNF 2V3SA 1E8YA 2KTRA 1TZ1A 2N9PC 1V49A 3M63B 1R4NI 3X0WA 1S3SG 1TTNA 1WE7A 1P1AA 1PQSA 1V86A 2KX3A 1WXMA 2NBUA 2LJ5A 1GJZA 2I1KA 3A1QB 3OJ3A 2KANA 4EFOA 5JHBA 4URKA 4W9JA 2IY0B 3UF8A 2KKCA 1P98A 1YD8U 5LXHA 2A5UA 2OOBB 2QHOA 1E5WA 4AUQC 1UGMA 2DAJA 3A1QA 2MQJA 3N30A 4RMAA 3ONSA 3DBLI 2LXAA 1OEYA 3M62B 3ZO5B 1IP9A 2KTRB 1WR6E 2GOWA 2LVPA 4HPMB 2XBBC 1V6EA 2KO3A 1WR1A 2CHZA 5CHVC 3L54A 2HD5B 2V4LA 2C7NB 3JVZX 1WXVA 5CX3A 5E6PA 1TGZB 1G6JA 4AWJA 4K7SA 4II3B 4GGQA 1WJUA 4F8CB 3ENEA 4JQWC 3ZVVA 1YIWA 1WJNA 4GXBA 5GMVA 1OQYA 2KK8A 1WFYA 4ZRKA 2HTHA 2LWPA 3H7SA 4KV2A 2J0MA 4B9KA 2GBJA 3IBEA 3PT2B 3MTNB 3APDA 4GDLA 1EF5A 1KLVA 1E7UA 4W9CA 1P3QU 4X57B 3DVNU 4ICVA 2KWCA 2N7DA 5FR6A 2HJ8A 2PE9A 4GU2A 4W9KA 3VVWB 2GBRA 1A5RA 2L76A 1WI0A 2XK5B 2PE6B 1F9JA 4HJKA 4WWPA 5JH5C 2K6QA 4HXDA 2DHZA 3W1YA 3ZW3A 4HCNB 4ZYNA 3V6CB 2EMTA 2BYFA 2LGYA 4J6IA 2MWSB 2FCNA 2AEHA 1QZEA 2FAZA 3KUDB 4GMVA 1E90A 3PGEA 3K9PB 2KNBA 3I3TB 2AL6A 2G45B 4DDID 3ECIA 2D07B 2D11A 2LVQA 2ZEQA 2DX5B 1RAXA 2ZNVC 3ALBA 1FXTB 4MEMA 4WJOA 2IYDB 3PREA 5E6OA 3GZNI 3ML8A 1BT0A 4JIOU 4CYEA 5KHOA 1WM3A 2LGDA 4M8MA 3T8MA 2R2QA 2K25A 3DCGA 4W9EA 3JSVA 3WAPA 2XEWA 3ZNZB 1WJ6A 2O6VA 3DQVA 3R7RA 1WMHA 2BF8B 2KC1A 3HK0A 3UIPB 5KHQA 4OVVA 2YVCA 3Q3JA 5JZEB 1H8CA 3M3JA 1SIFA 4DWFA 2EKEC 1EO6A 4FHKA 4MH0E 4EEWA 4M8NA 4LDTB 1WXAA 5DPSA 3DBSA 5HKHA 4MELA 3WA0A 3VTUA 1ZGUB 4K1RB 2G4DB 2N9XA 2WWZA 5AZFA 4A3OA 2L3ZA 1YJ1A 2DZJA 2LZ6A 4W9LA 4FJVB 3P2BA 3L17A 4MGKE 1RLFA 4KZCA 2ZVNA 2ZPNA 3LDZE 1WX8A 2M1MA 3PHXB 4HCPB 3DBHI 4MSQB 3KUCB 2IY1B 2KQ7A 3PRZA 5DPRA 3T9LA 2NCNA 4BKTA 3DVGX 4HVBA 3R3MA 4IW0A 1D3ZA 3EHVA 3PHWB 5TR5A 5DCNA 4ASWC 2KLGA 3A4RA 3ZKJC 2JRHA 4WJPA 4PYZA 2MBBB 3H9DA 3NHEB 2Y5BB 3QJZA 3WALA 3JYUA 3PLUA 4KSLC 3SU8X 4BOSC 4WWOA 4W9IA 4GB9A 1UZXB 1V5TA 2ZPYA 5LLIA 1I35A 2GBKA 3QA8A 2C5LC 1NDDA 2JXXA 3PRPB 2BKFA 2O2VA 4DK5A 3PV1A 4IWOA 3PLVA 2CR5A 2JUOA 4I6LB 2M17A 4XZ4A 5CTRC 1LFDA 1XQQA 3BY4B 4WJQA 1WGGA 2GBMA 4FHJA 2AYOB 4KSKC 1Z2MA 2IBIB 3KVFB 5CHWA 3TIXA 1J19A 3PRMB 4IM2A 3ZRFA 3PS6A 2RD0A 2JPHA 2A4ZA 3U30A 4FN2A 4F1SA 4FADA 5IAAC 1L7YA 1NI2A 5BO4B 4NQKE 1WZ0A 1U4AA 2KJHB 4KZ0A 3VUYA 1OGWA 2BYEA 3HHMA 2L7RA 2Z0EB 3HIZA 4FULA 2D3GA 3JW0X 3TMPB 3VAWA 2LI5A 3W1SC 3N3KB 3SD5A 1ZKHA 1GG3A 4KDLB 3VXWA 1WRDB 4F7ZA 3A9JB 4B95A 3W1SA 2L0FA 3MJWA 1X1MA 2LGXA 3APFA 3UGBB 3ZTDA 2IO3B 3KUZA 3A9KA 3PSEB 3B08A 3QWZB 5D7GA 1ZW7A 1WMHB 2L05A 2LUEA 4BOZB 1E8ZA 3L16A 3VHTC 1IYFA 5DPTA 3V60A 1CMXB 3RD2A 4NJ7A 2JRIB 3VH3B 4DHZB 4BVUC 1UELA 3ZNHB 2LVOA 2VRRB 3BINA 4KIKB 4NAWA 2PEAA 2B3AA 3UINB 4IUMB 2DENB 4GDLB 4BKSA 4MM3A 2J0KA 2KDIA 4FBJB 3DVGY 3H7PA 4HK2A 4JLCA 2L0TA 1WGHA 1SGHA 2DZKA 2RPQA 1MG8A 4HLEA 2MP2B 2REXA 1V81A 2N7EA 2KMCA 1Q1OA 3X23A 2O6VB 2IO2B 2KTFA 4N9F4 3RYTA 5EDSA 2CHWA 1P0RA 3SHQA 2FNJB 2KC2A 2UYZB 1KOTA 4TV3A 3L10B 4DHJB 3HM6X 4M0WB 5J17A 4LDTD 3VQIA 3VUWA 4JL9A 4B6WA 3IVFA 4W9HA 2PJHA 4ANVA 4NNJB 4KDIC 2RR9A 3ZNGC 4DBGA 3WIMA 2MBEA 2M4NA 2D2QA 3ZRCA 3C0RB 2JT4B 3OJ4B 3IHPC 4IM3A 4NY0A 3U8ZA 1XD3B 1WGDA 2N1VA 3NZUA 2KQSA 1YX5B 4PYUA 3DVNV 2CHXA 3EECA 2WYQA 4BKSD 1GNUA 4ZRIA 4WQOB 2GBNA 3OAWA 2JVCA 2KD0A 1WY8A 3CMMB 4DHJD 3EC8A 3KYDD 1H4RA 3AULA 4TKNA 2MSED 3GOEA 4XC2A 2MBHA 1T0YA 2JY6A 3WANA 2DYMA 2WDTB 2NS5A 4LCDE 4NPNA 2JF5A 2YLMA 2ZNVB 3U7DA 4E3CA 4DHZE 1C1YB 2LRUA 2JZZA 2D10A 2KJ6A 2LASA 4TQ1A 4A20A 2MX2A 2OJRA 1P9DU 1J0GA 4EUTA 3SDLC 3EFUA 3VUXA 5AZGA 2DZMA 3MHSD 3VFKA 1R4MI 4TUUA 3AU5A 3IG3A 3M95A 3OLMD 2DYBA 4G0NB 1WZ3A 2RGFA 1L2NA 2O2VB 2ZJDA 3ZUNA 2C9WB 3H6NA 1WXSA 1WF9A 4RM9A 4ANWA 3D32A 3UQBA 1WIAA 3VH4B 4I6PA 4KIKA 4NAWB 3LJ3A 1UH6A 2IO1B 1RFAA 3DPDA 2JWZA 4GN1A 3K9OB 4ANXA 2KVRA 3ZNID 1WJ4A 3RUIB 3QCAA 2I1JA 1HE8A 4HWIB 3APCA 4MGIE 4NQLB 1LQBA 2IZVB 4W9FA 2R2OA 1LM8B 3V6EB 1WM2A 1M94A 3VTWA 4II2B 2MBQA 2K8HA 4FJYA 5L83A 1JRUA 1I42A 2CU1A 1KJTA 2K6DB 2WX0A 4CHKA 2BKRB 5J2RA 1Q0WB 2N4FA 3UIOB 3KH0A 4AJWA 2MCNB 3S2AA 3IFWB 1ISNA 2J7QB 4MDKE 4BFRA 4E71A 1WE6A 2KFJA 2CKHB 2K8CA 4IM0A 1WGYA 5E6NA 1EUVB 4YL8A 1OEYJ 4P7IA 2L00B 1J8CA 4IWPA 3N32A 3TCAA 4BKGA 2MP2A 4IG7B 1V5OA 3A9KB 3CSTA 3ZTCA 4MJSA 1AARA 4JGHB 2KWUB 4DDGD 4RM8A 2NPTB 1EF1A 3PVLA 2O6VD 1UD7A 2C7HA 4MSMB 1IPGA 5L95C 2FCQA 4FA6A 2IO0B 2KJRA 1E8XA 2FIFA 2DZIA 1V9JA 4KVGB 2KXJA 4GDKA 4EZKA 1WYWB 2G3QB 2V1YA 3RZFA 3AXCA 3HM3A 1Q5WB 4PS7A 4A3PA 4TQ0A 3L0WB 1XT9B 2MBOA 3NS8A 5CHFA 2MLBA 3CF6E 1C3TA 2BGFA 4OVUA 2C7MB 3PPAA 2KZRA 2KFKB 4AOFA 4IWQA 1WX7A 3QARA 1S1QB 5G55A 2UWQA 4ZDVA 5IA7A 2KDEB 4FJZA 2MA9B 5C23A 3QQ8B 3H7PB 3PTFC 3VTVA 3QIJA 1NBFC 2DYOA 2MRPA 1E7VA 3Q3FA 4MGZE 3L08A 2XK5A 3RT3B 2KWVB 4G11A 3QK0A 2CS4A 2KN5A 2W9NA 2EMSA 3ML9A 4K7WA 2JZ3B 2KLCA 4GSWA 4PS3A 5D94A 4G50A 3H1UA 2GMIC 4K81A 1V80A 1SE9A 4MJSB 2ASQA 1VCBA 4XX5A 4PS8A 4ANUA 4AP4C 2KHWB 1UBQA 2N9EB 3A9JA 4EZLA 1LXDA 2K1FA 3ZDMC 2DAFA 2BWES 1OTRB 4K7UA 3RULA 1E8WA 2KFKA 4HDOA 2BPSA 2L8JA 3JSVB 3WAMA 4LJPB 1RRBA 4ICUA 1V2YA 2NR2A 4G3XB 4HDQA 4E74A 2WX1A 4EZJA 4CO7A 2M8SA 3NZSA 2ZCCA 3WAOA 2RSUA 2LRWA 3AU4A 3RCZA 1GC6A 4GDKB 1VD2A 1YQBA 4W9GA 1Z5SB 2KMAA 2BWFA 2HE7A 3AI5A 1K8RB 2K8BA 2Z0DB 4NJ6A 4LJOB 2C60A 4EOYA 3CSFA 2LXCA 1KM7A 3TBLD 2NPTA 3V61A 4BBNC 3A4SC 3ZLZA 2BYVE 4WWNA 4WAAA 3QAQA 3O65B 1Y8RC 2AWTA 4FLHA 3NOBA 2G4SA 2M0XA 3UQAA 3NY5A 5AZHA 4AJYB 3VDZA 3KYCD 2KDFB 3B1LX 4EKUA 2KX0A 3R66C 2N1WA 1WGRA 2PPHA 5LXIB 3L13A 1GUAB 3KW5B 4GIVA 4I6NB 2Z59B 2ZZPB 3QHTA 4GOCA 2NBVB 5D2MB 3TL5A 4DXAB 2LD9A 4WJNA 5AEKB 2NBWB 3DOWA 3ZDTA 5C1ZA 2ZVOA 4W9DA 3DBRI 1YX6B 2KDBA 3ZIMA 3RZWC 3B0AA 1UBIA 5D6JB 4MGYE 3TJPA 5JHAA 5J18A 2NVUI 1WX9A 3QC8B 4HPLB 4ZRJA 2FCSA 2ZCBA 2FUHB 3A33B 2FCMA 2K39A 3DDCB 3V62A 5G2NA 3R7QA 5DPWA 2J0JA 1WH3A 3QX1A 2AL3A 2MW5A 3PZDA 2KOXA 1TBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GC7 A;  2FID A;  4IC7 B;  4BBN F;  2V3S A;  1E8Y A;  2KTR A;  1TZ1 A;  2N9P C;  1V49 A;  3M63 B;  1R4N I;  3X0W A;  1S3S G;  1TTN A;  1WE7 A;  1P1A A;  1PQS A;  1V86 A;  2KX3 A;  1WXM A;  2NBU A;  2LJ5 A;  1GJZ A;  2I1K A;  3A1Q B;  3OJ3 A;  2KAN A;  4EFO A;  5JHB A;  4URK A;  4W9J A;  2IY0 B;  3UF8 A;  2KKC A;  1P98 A;  1YD8 U;  5LXH A;  2A5U A;  2OOB B;  2QHO A;  1E5W A;  4AUQ C;  1UGM A;  2DAJ A;  3A1Q A;  2MQJ A;  3N30 A;  4RMA A;  3ONS A;  3DBL I;  2LXA A;  1OEY A;  3M62 B;  3ZO5 B;  1IP9 A;  2KTR B;  1WR6 E;  2GOW A;  2LVP A;  4HPM B;  2XBB C;  1V6E A;  2KO3 A;  1WR1 A;  2CHZ A;  5CHV C;  3L54 A;  2HD5 B;  2V4L A;  2C7N B;  3JVZ X;  1WXV A;  5CX3 A;  5E6P A;  1TGZ B;  1G6J A;  4AWJ A;  4K7S A;  4II3 B;  4GGQ A;  1WJU A;  4F8C B;  3ENE A;  4JQW C;  3ZVV A;  1YIW A;  1WJN A;  4GXB A;  5GMV A;  1OQY A;  2KK8 A;  1WFY A;  4ZRK A;  2HTH A;  2LWP A;  3H7S A;  4KV2 A;  2J0M A;  4B9K A;  2GBJ A;  3IBE A;  3PT2 B;  3MTN B;  3APD A;  4GDL A;  1EF5 A;  1KLV A;  1E7U A;  4W9C A;  1P3Q U;  4X57 B;  3DVN U;  4ICV A;  2KWC A;  2N7D A;  5FR6 A;  2HJ8 A;  2PE9 A;  4GU2 A;  4W9K A;  3VVW B;  2GBR A;  1A5R A;  2L76 A;  1WI0 A;  2XK5 B;  2PE6 B;  1F9J A;  4HJK A;  4WWP A;  5JH5 C;  2K6Q A;  4HXD A;  2DHZ A;  3W1Y A;  3ZW3 A;  4HCN B;  4ZYN A;  3V6C B;  2EMT A;  2BYF A;  2LGY A;  4J6I A;  2MWS B;  2FCN A;  2AEH A;  1QZE A;  2FAZ A;  3KUD B;  4GMV A;  1E90 A;  3PGE A;  3K9P B;  2KNB A;  3I3T B;  2AL6 A;  2G45 B;  4DDI D;  3ECI A;  2D07 B;  2D11 A;  2LVQ A;  2ZEQ A;  2DX5 B;  1RAX A;  2ZNV C;  3ALB A;  1FXT B;  4MEM A;  4WJO A;  2IYD B;  3PRE A;  5E6O A;  3GZN I;  3ML8 A;  1BT0 A;  4JIO U;  4CYE A;  5KHO A;  1WM3 A;  2LGD A;  4M8M A;  3T8M A;  2R2Q A;  2K25 A;  3DCG A;  4W9E A;  3JSV A;  3WAP A;  2XEW A;  3ZNZ B;  1WJ6 A;  2O6V A;  3DQV A;  3R7R A;  1WMH A;  2BF8 B;  2KC1 A;  3HK0 A;  3UIP B;  5KHQ A;  4OVV A;  2YVC A;  3Q3J A;  5JZE B;  1H8C A;  3M3J A;  1SIF A;  4DWF A;  2EKE C;  1EO6 A;  4FHK A;  4MH0 E;  4EEW A;  4M8N A;  4LDT B;  1WXA A;  5DPS A;  3DBS A;  5HKH A;  4MEL A;  3WA0 A;  3VTU A;  1ZGU B;  4K1R B;  2G4D B;  2N9X A;  2WWZ A;  5AZF A;  4A3O A;  2L3Z A;  1YJ1 A;  2DZJ A;  2LZ6 A;  4W9L A;  4FJV B;  3P2B A;  3L17 A;  4MGK E;  1RLF A;  4KZC A;  2ZVN A;  2ZPN A;  3LDZ E;  1WX8 A;  2M1M A;  3PHX B;  4HCP B;  3DBH I;  4MSQ B;  3KUC B;  2IY1 B;  2KQ7 A;  3PRZ A;  5DPR A;  3T9L A;  2NCN A;  4BKT A;  3DVG X;  4HVB A;  3R3M A;  4IW0 A;  1D3Z A;  3EHV A;  3PHW B;  5TR5 A;  5DCN A;  4ASW C;  2KLG A;  3A4R A;  3ZKJ C;  2JRH A;  4WJP A;  4PYZ A;  2MBB B;  3H9D A;  3NHE B;  2Y5B B;  3QJZ A;  3WAL A;  3JYU A;  3PLU A;  4KSL C;  3SU8 X;  4BOS C;  4WWO A;  4W9I A;  4GB9 A;  1UZX B;  1V5T A;  2ZPY A;  5LLI A;  1I35 A;  2GBK A;  3QA8 A;  2C5L C;  1NDD A;  2JXX A;  3PRP B;  2BKF A;  2O2V A;  4DK5 A;  3PV1 A;  4IWO A;  3PLV A;  2CR5 A;  2JUO A;  4I6L B;  2M17 A;  4XZ4 A;  5CTR C;  1LFD A;  1XQQ A;  3BY4 B;  4WJQ A;  1WGG A;  2GBM A;  4FHJ A;  2AYO B;  4KSK C;  1Z2M A;  2IBI B;  3KVF B;  5CHW A;  3TIX A;  1J19 A;  3PRM B;  4IM2 A;  3ZRF A;  3PS6 A;  2RD0 A;  2JPH A;  2A4Z A;  3U30 A;  4FN2 A;  4F1S A;  4FAD A;  5IAA C;  1L7Y A;  1NI2 A;  5BO4 B;  4NQK E;  1WZ0 A;  1U4A A;  2KJH B;  4KZ0 A;  3VUY A;  1OGW A;  2BYE A;  3HHM A;  2L7R A;  2Z0E B;  3HIZ A;  4FUL A;  2D3G A;  3JW0 X;  3TMP B;  3VAW A;  2LI5 A;  3W1S C;  3N3K B;  3SD5 A;  1ZKH A;  1GG3 A;  4KDL B;  3VXW A;  1WRD B;  4F7Z A;  3A9J B;  4B95 A;  3W1S A;  2L0F A;  3MJW A;  1X1M A;  2LGX A;  3APF A;  3UGB B;  3ZTD A;  2IO3 B;  3KUZ A;  3A9K A;  3PSE B;  3B08 A;  3QWZ B;  5D7G A;  1ZW7 A;  1WMH B;  2L05 A;  2LUE A;  4BOZ B;  1E8Z A;  3L16 A;  3VHT C;  1IYF A;  5DPT A;  3V60 A;  1CMX B;  3RD2 A;  4NJ7 A;  2JRI B;  3VH3 B;  4DHZ B;  4BVU C;  1UEL A;  3ZNH B;  2LVO A;  2VRR B;  3BIN A;  4KIK B;  4NAW A;  2PEA A;  2B3A A;  3UIN B;  4IUM B;  2DEN B;  4GDL B;  4BKS A;  4MM3 A;  2J0K A;  2KDI A;  4FBJ B;  3DVG Y;  3H7P A;  4HK2 A;  4JLC A;  2L0T A;  1WGH A;  1SGH A;  2DZK A;  2RPQ A;  1MG8 A;  4HLE A;  2MP2 B;  2REX A;  1V81 A;  2N7E A;  2KMC A;  1Q1O A;  3X23 A;  2O6V B;  2IO2 B;  2KTF A;  4N9F 4;  3RYT A;  5EDS A;  2CHW A;  1P0R A;  3SHQ A;  2FNJ B;  2KC2 A;  2UYZ B;  1KOT A;  4TV3 A;  3L10 B;  4DHJ B;  3HM6 X;  4M0W B;  5J17 A;  4LDT D;  3VQI A;  3VUW A;  4JL9 A;  4B6W A;  3IVF A;  4W9H A;  2PJH A;  4ANV A;  4NNJ B;  4KDI C;  2RR9 A;  3ZNG C;  4DBG A;  3WIM A;  2MBE A;  2M4N A;  2D2Q A;  3ZRC A;  3C0R B;  2JT4 B;  3OJ4 B;  3IHP C;  4IM3 A;  4NY0 A;  3U8Z A;  1XD3 B;  1WGD A;  2N1V A;  3NZU A;  2KQS A;  1YX5 B;  4PYU A;  3DVN V;  2CHX A;  3EEC A;  2WYQ A;  4BKS D;  1GNU A;  4ZRI A;  4WQO B;  2GBN A;  3OAW A;  2JVC A;  2KD0 A;  1WY8 A;  3CMM B;  4DHJ D;  3EC8 A;  3KYD D;  1H4R A;  3AUL A;  4TKN A;  2MSE D;  3GOE A;  4XC2 A;  2MBH A;  1T0Y A;  2JY6 A;  3WAN A;  2DYM A;  2WDT B;  2NS5 A;  4LCD E;  4NPN A;  2JF5 A;  2YLM A;  2ZNV B;  3U7D A;  4E3C A;  4DHZ E;  1C1Y B;  2LRU A;  2JZZ A;  2D10 A;  2KJ6 A;  2LAS A;  4TQ1 A;  4A20 A;  2MX2 A;  2OJR A;  1P9D U;  1J0G A;  4EUT A;  3SDL C;  3EFU A;  3VUX A;  5AZG A;  2DZM A;  3MHS D;  3VFK A;  1R4M I;  4TUU A;  3AU5 A;  3IG3 A;  3M95 A;  3OLM D;  2DYB A;  4G0N B;  1WZ3 A;  2RGF A;  1L2N A;  2O2V B;  2ZJD A;  3ZUN A;  2C9W B;  3H6N A;  1WXS A;  1WF9 A;  4RM9 A;  4ANW A;  3D32 A;  3UQB A;  1WIA A;  3VH4 B;  4I6P A;  4KIK A;  4NAW B;  3LJ3 A;  1UH6 A;  2IO1 B;  1RFA A;  3DPD A;  2JWZ A;  4GN1 A;  3K9O B;  4ANX A;  2KVR A;  3ZNI D;  1WJ4 A;  3RUI B;  3QCA A;  2I1J A;  1HE8 A;  4HWI B;  3APC A;  4MGI E;  4NQL B;  1LQB A;  2IZV B;  4W9F A;  2R2O A;  1LM8 B;  3V6E B;  1WM2 A;  1M94 A;  3VTW A;  4II2 B;  2MBQ A;  2K8H A;  4FJY A;  5L83 A;  1JRU A;  1I42 A;  2CU1 A;  1KJT A;  2K6D B;  2WX0 A;  4CHK A;  2BKR B;  5J2R A;  1Q0W B;  2N4F A;  3UIO B;  3KH0 A;  4AJW A;  2MCN B;  3S2A A;  3IFW B;  1ISN A;  2J7Q B;  4MDK E;  4BFR A;  4E71 A;  1WE6 A;  2KFJ A;  2CKH B;  2K8C A;  4IM0 A;  1WGY A;  5E6N A;  1EUV B;  4YL8 A;  1OEY J;  4P7I A;  2L00 B;  1J8C A;  4IWP A;  3N32 A;  3TCA A;  4BKG A;  2MP2 A;  4IG7 B;  1V5O A;  3A9K B;  3CST A;  3ZTC A;  4MJS A;  1AAR A;  4JGH B;  2KWU B;  4DDG D;  4RM8 A;  2NPT B;  1EF1 A;  3PVL A;  2O6V D;  1UD7 A;  2C7H A;  4MSM B;  1IPG A;  5L95 C;  2FCQ A;  4FA6 A;  2IO0 B;  2KJR A;  1E8X A;  2FIF A;  2DZI A;  1V9J A;  4KVG B;  2KXJ A;  4GDK A;  4EZK A;  1WYW B;  2G3Q B;  2V1Y A;  3RZF A;  3AXC A;  3HM3 A;  1Q5W B;  4PS7 A;  4A3P A;  4TQ0 A;  3L0W B;  1XT9 B;  2MBO A;  3NS8 A;  5CHF A;  2MLB A;  3CF6 E;  1C3T A;  2BGF A;  4OVU A;  2C7M B;  3PPA A;  2KZR A;  2KFK B;  4AOF A;  4IWQ A;  1WX7 A;  3QAR A;  1S1Q B;  5G55 A;  2UWQ A;  4ZDV A;  5IA7 A;  2KDE B;  4FJZ A;  2MA9 B;  5C23 A;  3QQ8 B;  3H7P B;  3PTF C;  3VTV A;  3QIJ A;  1NBF C;  2DYO A;  2MRP A;  1E7V A;  3Q3F A;  4MGZ E;  3L08 A;  2XK5 A;  3RT3 B;  2KWV B;  4G11 A;  3QK0 A;  2CS4 A;  2KN5 A;  2W9N A;  2EMS A;  3ML9 A;  4K7W A;  2JZ3 B;  2KLC A;  4GSW A;  4PS3 A;  5D94 A;  4G50 A;  3H1U A;  2GMI C;  4K81 A;  1V80 A;  1SE9 A;  4MJS B;  2ASQ A;  1VCB A;  4XX5 A;  4PS8 A;  4ANU A;  4AP4 C;  2KHW B;  1UBQ A;  2N9E B;  3A9J A;  4EZL A;  1LXD A;  2K1F A;  3ZDM C;  2DAF A;  2BWE S;  1OTR B;  4K7U A;  3RUL A;  1E8W A;  2KFK A;  4HDO A;  2BPS A;  2L8J A;  3JSV B;  3WAM A;  4LJP B;  1RRB A;  4ICU A;  1V2Y A;  2NR2 A;  4G3X B;  4HDQ A;  4E74 A;  2WX1 A;  4EZJ A;  4CO7 A;  2M8S A;  3NZS A;  2ZCC A;  3WAO A;  2RSU A;  2LRW A;  3AU4 A;  3RCZ A;  1GC6 A;  4GDK B;  1VD2 A;  1YQB A;  4W9G A;  1Z5S B;  2KMA A;  2BWF A;  2HE7 A;  3AI5 A;  1K8R B;  2K8B A;  2Z0D B;  4NJ6 A;  4LJO B;  2C60 A;  4EOY A;  3CSF A;  2LXC A;  1KM7 A;  3TBL D;  2NPT A;  3V61 A;  4BBN C;  3A4S C;  3ZLZ A;  2BYV E;  4WWN A;  4WAA A;  3QAQ A;  3O65 B;  1Y8R C;  2AWT A;  4FLH A;  3NOB A;  2G4S A;  2M0X A;  3UQA A;  3NY5 A;  5AZH A;  4AJY B;  3VDZ A;  3KYC D;  2KDF B;  3B1L X;  4EKU A;  2KX0 A;  3R66 C;  2N1W A;  1WGR A;  2PPH A;  5LXI B;  3L13 A;  1GUA B;  3KW5 B;  4GIV A;  4I6N B;  2Z59 B;  2ZZP B;  3QHT A;  4GOC A;  2NBV B;  5D2M B;  3TL5 A;  4DXA B;  2LD9 A;  4WJN A;  5AEK B;  2NBW B;  3DOW A;  3ZDT A;  5C1Z A;  2ZVO A;  4W9D A;  3DBR I;  1YX6 B;  2KDB A;  3ZIM A;  3RZW C;  3B0A A;  1UBI A;  5D6J B;  4MGY E;  3TJP A;  5JHA A;  5J18 A;  2NVU I;  1WX9 A;  3QC8 B;  4HPL B;  4ZRJ A;  2FCS A;  2ZCB A;  2FUH B;  3A33 B;  2FCM A;  2K39 A;  3DDC B;  3V62 A;  5G2N A;  3R7Q A;  5DPW A;  2J0J A;  1WH3 A;  3QX1 A;  2AL3 A;  2MW5 A;  3PZD A;  2KOX A;  1TBE A; 
#chains in the Genus database with same CATH topology
 2FID A;  1E8Y A;  1TZ1 A;  3X0W A;  1S3S G;  2K22 A;  1FCL A;  2NBU A;  4EFO A;  1L0Y B;  3A1Q B;  1YJI A;  4XDC A;  1P98 A;  1MFW A;  3FC4 A;  2MQJ A;  3PZ8 A;  3N1Z C;  3BVM A;  1OEY A;  3ZO5 B;  1KTK A;  1N63 A;  1WR6 E;  2GOW A;  1V6E A;  5CHV C;  4RNA A;  2HD5 B;  2C7N B;  1C79 A;  2FBW B;  1G6J A;  4II3 B;  4F8C B;  1OQR A;  4JQW C;  1YIW A;  1WJN A;  1JW9 D;  2KK8 A;  1PDX A;  2LWP A;  3Q8B A;  4B9K A;  2GBJ A;  1QKZ A;  1KLV A;  1E7U A;  2BVC A;  4ICV A;  5FR6 A;  2N7D A;  2PE9 A;  4W9K A;  1A5R A;  1UNS A;  3AEF B;  2XK5 B;  2PE6 B;  4WWP A;  5JH5 C;  3DBR B;  4HCN B;  4ZYN A;  3MJ5 A;  1N61 A;  3ZXR A;  2LGY A;  3KUD B;  4YTP B;  4GMV A;  3K9P B;  2KNB A;  3PZ7 A;  5EE1 A;  2D11 A;  2DX5 B;  1HQR D;  3NZ3 A;  3I57 A;  2LHD A;  3ML8 A;  3T8M A;  3WAP A;  2K25 A;  4ZHP A;  3I63 C;  3AEG B;  3R7R A;  1F2R C;  1WMH A;  3HK0 A;  1FMA D;  5KHQ A;  2K0P A;  4FHK A;  4MH0 E;  4EEW A;  1YQ4 B;  3C8Y A;  5HKH A;  1E0Z A;  2JWU A;  1ZGU B;  1XCT L;  1FIQ A;  3I9V 1;  2WWZ A;  2L3Z A;  2INC C;  1NEK B;  1D5Z C;  4M0W A;  1PGB A;  1V8C A;  3L17 A;  4KZC A;  3B2F A;  3MC8 A;  2MHJ A;  2KQ7 A;  3PRZ A;  5DPR A;  3T9L A;  1QOG A;  3Q8C A;  3AE1 B;  2JRH A;  3H9D A;  3WAL A;  4W9I A;  1FD6 A;  1UZX B;  1V5T A;  2EKI A;  3QA8 A;  4RGN A;  1IBX A;  2JXX A;  3PRP B;  1V1P A;  2O2V A;  5AUI A;  4IWO A;  1TS5 A;  2BW2 A;  2JUO A;  3BYT B;  1XQQ A;  2YEP B;  4WJQ A;  5CHW A;  3SEB A;  2IBI B;  1SXT A;  3PRM B;  3ZXV A;  2RD0 A;  1SSN A;  1E7P B;  3IAM 1;  2A4Z A;  4LLG M;  2GB1 A;  3U30 A;  3ZGZ A;  4FN2 A;  2PW9 A;  1L7Y A;  1NI2 A;  5BO4 B;  3B9J A;  3HVD A;  1WZ0 A;  3HIZ A;  2D3G A;  2W82 A;  1WXQ A;  3FAH A;  3W1S C;  1I4R A;  3VXW A;  1WRD B;  3MJW A;  1X1M A;  2LGX A;  3AED B;  2IO3 B;  5H8Y E;  2NMQ A;  3B08 A;  1WMH B;  1E8Z A;  3GE8 C;  1TY2 A;  3VHT C;  1CMX B;  3RD2 A;  1UEL A;  3ZNH B;  3BIN A;  2DWQ A;  2WXN A;  2PEA A;  2B3A A;  4GDL B;  4BKS A;  4MM3 A;  2J0K A;  4YT0 B;  3DVG Y;  4HK2 A;  2RPQ A;  1MG8 A;  2WHI A;  4BAX A;  2KMC A;  1Q1O A;  1GB1 A;  3RYT A;  5EDS A;  2FNJ B;  3HM6 X;  4LDT D;  4B6W A;  3OWE B;  2CU3 A;  3IVF A;  3NS1 A;  2K5P A;  1CQV A;  3ZNG C;  4DBG A;  2MBE A;  2JQR B;  3ZRC A;  1C76 A;  1RWS A;  4NY0 A;  4IM3 A;  3U8Z A;  4D2K A;  3NZU A;  1I4H A;  1WGK A;  2H88 B;  3HVZ A;  4PYU A;  1HA5 A;  3DVN V;  2WYQ A;  4BKS D;  1L0X B;  4ZRI A;  4A90 A;  3N9Y C;  3AE8 B;  3KYD D;  1T0S C;  4TKN A;  3AV8 A;  3GOE A;  3N1X C;  3WAN A;  4LCD E;  3NUH B;  4J3O D;  2ZNV B;  2E6X A;  1M4V A;  2LRU A;  4RFB A;  2D10 A;  4A20 A;  1K50 A;  2OJR A;  1P9D U;  1ZDV A;  4JE3 B;  2V9H A;  1R4M I;  2AX5 A;  2NTS A;  3IG3 A;  3M95 A;  4YSY B;  2C9W B;  1L4D B;  3D32 A;  1C4A A;  2WP9 B;  3VH4 B;  4NAW B;  2KDM A;  2IO1 B;  1RFA A;  2JWZ A;  4GN1 A;  5D3I B;  4ANX A;  1TT5 B;  2I1J A;  4HWI B;  1FM0 D;  1WM2 A;  1C78 A;  4FJY A;  5L83 A;  2K6D B;  2WX0 A;  1KRH A;  1D4B A;  3KH0 A;  1ISN A;  2J7Q B;  1SE4 A;  1WE6 A;  2KFJ A;  3P4Q B;  1FFV A;  4IM0 A;  4LK0 M;  4P7I A;  3AN1 A;  4IWP A;  3N32 A;  4BKG A;  2MP2 A;  4IG7 B;  2TSS A;  4L2Y A;  3ZTC A;  4MJS A;  2ON8 A;  1AAR A;  2KWU B;  4RM8 A;  4HRS A;  3N1Y C;  3NRZ A;  1E8X A;  3L4P A;  4GDK A;  3E56 A;  2K9X A;  2V1Y A;  3RZF A;  4A3P A;  1YJJ A;  2MBO A;  2QDF A;  2MLB A;  1C3T A;  1KF6 B;  1BML C;  4WH4 A;  2KZR A;  1JQ4 A;  2KFK B;  4YWG G;  1WX7 A;  3KWV A;  4FJZ A;  1SF0 A;  2MA9 B;  1ZP0 B;  3CWI A;  5C23 A;  3H7P B;  4RF1 A;  3IAS 1;  2RDB C;  4C56 C;  1VDV A;  3Q3F A;  4L1B A;  3RPF C;  2IGH A;  3RMK C;  3RT3 B;  2KN5 A;  3Q69 A;  3ML9 A;  3V05 A;  2DBY A;  1V80 A;  1SE9 A;  1CK1 A;  2ASQ A;  1VCB A;  4XX5 A;  1P7F A;  3Q8F A;  1I4G A;  2KAC A;  3ZDM C;  4OZB A;  1MHX A;  1TS2 A;  2BPS A;  4REZ A;  4ICU A;  4PK1 A;  4DQO C;  1HTO A;  2RSU A;  1J7A A;  3RCZ A;  1VD2 A;  1Z5S B;  2BS4 B;  4H2A A;  2HE7 A;  2WS3 B;  2WXH A;  4LJO B;  1TY0 A;  1XLP A;  3BWU D;  3V61 A;  1VR9 A;  1K52 A;  3A4S C;  3ZLZ A;  4WWN A;  4WAA A;  2AWT A;  3IT6 B;  2INP E;  3VDZ A;  2KAJ A;  3VRB B;  4EKU A;  2BT6 A;  3R66 C;  2N1W A;  1WGR A;  3KW5 B;  4I6N B;  2Z59 B;  2ZZP B;  1QOA A;  2LUM A;  4GOC A;  2NBV B;  2LD9 A;  4WJN A;  3ZDT A;  5C1Z A;  2ZVO A;  2J52 A;  2WU5 B;  3RZW C;  3B0A A;  1UBI A;  1HZ6 A;  4MGY E;  1T3Q A;  1DOY A;  4WAF A;  1WX9 A;  4ZRJ A;  2K39 A;  1WWT A;  1RYJ A;  5G2N A;  2MW5 A;  2L1A A;  4EE2 A;  2W54 A;  4BBN F;  1KLG D;  2MEK A;  2KTR A;  4IKG A;  4OHJ A;  4K3C A;  1WE7 A;  4MAC A;  2CJN A;  1E6E B;  2LJ5 A;  4YSX B;  3AEE B;  3OJ3 A;  5JHB A;  4TMA B;  4W9J A;  2WXF A;  4LNO A;  3ZQ4 A;  5IP4 D;  1QLB B;  1E5W A;  1XCQ L;  2SEB D;  4JPS A;  1TJE A;  4RMA A;  3P4R B;  1YN3 A;  3DBL I;  3HUI A;  2KTR B;  2IGG A;  4L23 A;  2V4L A;  1WXV A;  5CX3 A;  2LGS A;  5G5H A;  4LNI A;  2RDG A;  3ZVV A;  3AE6 B;  5LNK 1;  4GXB A;  4ZRK A;  1I4P A;  3H7S A;  4KV2 A;  1TKY A;  2QJL A;  2WXQ A;  2JXT A;  2J4X A;  4RCO A;  1IBX B;  3VVW B;  1IGC A;  3MHZ A;  1F9J A;  1EU3 A;  4HJK A;  1FRD A;  2L32 A;  3R2T A;  4RGT A;  2N0S B;  3V6C B;  2EMT A;  4J6I A;  2WXL A;  2FAZ A;  1V1O A;  1E90 A;  4ZRP A;  3I3T B;  1E10 A;  4DDI D;  3ECI A;  2LVQ A;  1ACC A;  2ZNV C;  5TSS A;  2HTM E;  4MEM A;  3PRE A;  5BYR A;  3GZN I;  4OW0 A;  4CYE A;  1J7C A;  2RMM A;  4M8M A;  3DCG A;  3JSV A;  3ZNZ B;  2XEW A;  1WJ6 A;  2O6V A;  2WQY B;  2KQ4 X;  2V3P A;  2KC1 A;  3UIP B;  1AWD A;  4OVV A;  2WDV B;  1PYW D;  4ITK A;  1EO6 A;  2BBC A;  4LDT B;  3DBS A;  3WA0 A;  4N6E B;  2DZJ A;  4US9 A;  3NVV A;  3IXS A;  4BZA A;  3P2B A;  1FNW A;  2J53 A;  1RLF A;  2ZVN A;  3PHX B;  3KUC B;  2IY1 B;  3Q6B A;  4M01 A;  3DVG X;  4KGT A;  3R3M A;  3PHW B;  4WJP A;  2R61 A;  4LNF A;  3NHE B;  2Y5B B;  2Y5C A;  3PLU A;  1XO3 A;  4BOS C;  2ZPY A;  5LLI A;  4K3B A;  2QSD A;  4AQ7 A;  1NDD A;  3W5U B;  2BKF A;  5EE0 A;  3PV1 A;  4ZOH C;  2IPK D;  2GLS A;  4XZ4 A;  1LFD A;  1TIF A;  4KSK C;  4FHJ A;  4B0E A;  2LEK A;  1VJK A;  4FAD A;  5IAA C;  1YMH E;  4NQK E;  4XDD A;  1OGW A;  1FEH A;  2BYE A;  3HHM A;  3RNG C;  4FUL A;  1T5X D;  3TMP B;  4NAM A;  2JZP A;  1GG3 A;  3C19 A;  4F7Z A;  2BB5 A;  3A9J B;  1MHH E;  3APF A;  3BVZ A;  3KUZ A;  3PSE B;  2L05 A;  2KWD A;  3URY A;  4IDI A;  1ZE3 D;  4TSS A;  3V60 A;  2WNM A;  1OFF A;  5BMH A;  1NEN B;  1QT9 A;  2D3A A;  2LVO A;  2VRR B;  3NVW A;  3UIN B;  2DEN B;  2AQ2 B;  2E3T A;  1XXG A;  3EA6 A;  2REX A;  1V81 A;  1I7H A;  3X23 A;  2PKO A;  1J7B A;  2KTF A;  4Q2J A;  2CHW A;  1N5X A;  1KOT A;  2PJH A;  3NJT A;  2RR9 A;  1CZP A;  3WIM A;  5IN7 A;  2JT4 B;  3OJ4 B;  2D3C A;  3DWG C;  4S17 A;  1XD3 B;  2KQS A;  3LXF A;  2CHX A;  2VZK D;  4AS1 A;  1E9M A;  1GNU A;  2N9K A;  2MJ3 A;  3AE7 B;  4JWU C;  3OAW A;  2JVC A;  2KD0 A;  1WY8 A;  2MJD A;  2HDE A;  5G5G A;  1ENF A;  2RPV A;  1KLU D;  1MJD A;  3EC8 A;  1ESF A;  1H4R A;  4A6Q A;  4DXF A;  2MBH A;  2WDT B;  4NPN A;  1MI0 A;  2YLM A;  4RF0 A;  3U7D A;  4KX6 B;  4N58 A;  1C1Y B;  1JWA D;  1L0V B;  1TKG A;  3MHS D;  3P63 A;  4TUU A;  2DYB A;  3ETR A;  4G0N B;  5BYS A;  1L2N A;  1V1P B;  2O2V B;  4ANW A;  1WIA A;  3Q8E A;  2N7J A;  4KIK A;  3LJ3 A;  1UH6 A;  5FR3 A;  2KVR A;  2W3S A;  2ZW0 A;  4MGI E;  4NQL B;  4N59 A;  2AQ1 B;  4KGS A;  1V97 A;  3VTW A;  2LMC A;  4A8X C;  2IJ0 A;  2CU1 A;  2QIL A;  4CHK A;  4XWT A;  3AE3 B;  2N4F A;  3UIO B;  1SB3 C;  4P1B C;  2MCN B;  3S2A A;  3IFW B;  4E71 A;  2K8C A;  4RH6 A;  1FRR A;  1T6B X;  1XLQ A;  1OEY J;  5IOI A;  1TS3 A;  1MPE A;  1V5O A;  2LHE A;  1L5P A;  3PVL A;  2PTL A;  1IPG A;  2D3B A;  2IO0 B;  2KJR A;  2XN9 C;  1KH0 A;  2BQQ A;  2KXJ A;  1WYW B;  2G3Q B;  1SJE D;  3N20 C;  1XLN A;  2QC8 A;  3HM3 A;  4HRO A;  4TQ0 A;  3NS8 A;  1XT9 B;  5CHF A;  1VRA B;  1D5M C;  3CF6 E;  3PPA A;  3IT4 B;  2QMT A;  1EM7 A;  2UWQ A;  4ZDV A;  1F77 A;  3VTV A;  1NBF C;  3DHH C;  5MPO A;  2XK5 A;  1SE2 A;  4G11 A;  3QK0 A;  2CS4 A;  2W9N A;  1C4C A;  1T0R C;  2KLC A;  4GSW A;  1Y56 A;  4G50 A;  3H1U A;  1HZ5 A;  4K81 A;  4MJS B;  4PS8 A;  4ANU A;  4AP4 C;  1HEZ E;  2KHW B;  2N9E B;  3ZJV A;  4EZL A;  2ONQ A;  2K1F A;  2DAF A;  1F1H A;  4K7U A;  2V0G A;  1NI3 A;  1TZO A;  2WXI A;  1ET9 A;  2DLB A;  4LJP B;  1V2Y A;  2NR2 A;  4G3X B;  4HDQ A;  2QEJ C;  4CO7 A;  2M8S A;  1UF0 A;  4M00 A;  4YTM B;  3AU4 A;  5C3J B;  1YQB A;  4WUR A;  2K8B A;  2C60 A;  2LXC A;  3TBL D;  2PVO D;  1K51 A;  2BYV E;  3QAQ A;  2M0X A;  2WXK A;  3UI3 A;  3KYC D;  3P4P B;  4ARI A;  2KDF B;  2KX0 A;  5LXI B;  4GIV A;  5JXV A;  4DXA B;  5AEK B;  3DOW A;  3KQ4 A;  3MP9 A;  3ZIM A;  2WGS A;  5J18 A;  2NVU I;  3QC8 B;  4US8 A;  1DOX A;  2FUH B;  3V62 A;  3PZD A;  2BS3 B;  1GC7 A;  4P1C C;  1TKE A;  2V3S A;  2N9P C;  3TEX A;  1R4N I;  4LNK A;  1P1A A;  1IGD A;  1V86 A;  1GJZ A;  1ZXI A;  2I1K A;  1C77 A;  1K53 A;  2IY0 B;  3UF8 A;  2KKC A;  5LXH A;  3KWL A;  2A5U A;  4HJG E;  4AUQ C;  1UGM A;  3A1Q A;  3N30 A;  2WLB A;  1ZUD 2;  4P16 A;  2BTE A;  2LXA A;  2KN4 A;  3M62 B;  1IP9 A;  2IND C;  1YOV B;  2XBB C;  3VR9 B;  1WR1 A;  2B76 B;  3L54 A;  3ZYY X;  3JVZ X;  1PGA A;  1TGZ B;  4AWJ A;  4GGQ A;  4JX1 C;  3AE5 B;  3ENE A;  2DNF A;  1QOF A;  1OQY A;  2HTH A;  1ZOY B;  2GRI A;  3AEA B;  3IBE A;  3PT2 B;  3R2I A;  3MTN B;  3APD A;  4GDL A;  2D5G A;  1P3Q U;  4OZA A;  3DVN U;  2KWC A;  3GZN B;  2HJ8 A;  4C4V B;  5GXG B;  2K6Q A;  3ZW3 A;  2UU7 A;  1ZDX A;  1HTQ A;  2BYF A;  1BUI C;  2KYW A;  3AM9 A;  2G45 B;  2V4I B;  2D07 B;  2ZEQ A;  1L6U A;  3EFC A;  4WJO A;  2IYD B;  5E6O A;  1WM3 A;  4ZRQ A;  3MC0 B;  3TEY A;  2OHF A;  2R2Q A;  3DQV A;  4KGR A;  2IDY A;  4FXC A;  2YVC A;  1H8C A;  1WRI A;  3M3J A;  1SIF A;  4DWF A;  4A55 A;  4MEL A;  4C7Y A;  5C2T B;  2N9X A;  5AZF A;  2V3N A;  1YJ1 A;  2LZ6 A;  2JSV X;  4AJW A;  2ZPN A;  1WX8 A;  3DBH I;  4MSQ B;  3J9C A;  1QF6 A;  4IW0 A;  1D3Z A;  2BB6 A;  1B9R A;  5TR5 A;  4ASW C;  2KLG A;  3A4R A;  4WWO A;  4GB9 A;  1TYG B;  5T8I A;  3FKY A;  1I35 A;  3MC9 A;  3BII D;  2GBK A;  3DHG C;  4DK5 A;  5I4D A;  3PLV A;  2CR5 A;  2M17 A;  5CTR C;  1WGG A;  2GBM A;  1XEE A;  2AYO B;  3KVF B;  5EE3 A;  1T0Q C;  4IM2 A;  3ZRF A;  2JPH A;  4F1S A;  1FFU A;  1U4A A;  2KJH B;  3AE9 B;  2L7R A;  2Z0E B;  3VAW A;  1XF5 L;  2LJI A;  1ZKH A;  4KDL B;  3DWM A;  3W1S A;  2L0F A;  3ZTD A;  3Q3M C;  3A9K A;  5AUK A;  3SR6 A;  4LNN A;  4RGO S;  4BOZ B;  2N9L A;  3L16 A;  3AEB B;  2BS2 B;  2JRI B;  1YN4 A;  4KIK B;  2M19 A;  4IUM B;  1ZXH A;  4NJC A;  1F2R I;  2DZK A;  2MP2 B;  2ACZ B;  3BYY B;  2IO2 B;  4N9F 4;  2PMV A;  4DXG A;  1Q10 A;  1P0R A;  3SHQ A;  2LGI A;  2KC2 A;  2UYZ B;  3L10 B;  4DHJ B;  2VH1 A;  1VZ6 A;  3VUW A;  2RDH A;  4JL9 A;  4P6V F;  4YXD B;  4KDI C;  2M0A A;  1N62 A;  1GOZ A;  1FXA A;  2M4N A;  2D2Q A;  2H89 B;  4WIP A;  2I2Y A;  1YX5 B;  3Q3N C;  4WQO B;  2GBN A;  2ICI A;  4O1N A;  1DYQ A;  3CMM B;  1N5W A;  2MSE D;  4XC2 A;  1T0Y A;  2DYM A;  2JF5 A;  4DHZ E;  2L52 A;  2JZZ A;  2KJ6 A;  3OG5 A;  3R8B A;  2IGD A;  1PFD A;  3SDL C;  2W3R A;  3EFU A;  3VUX A;  3VFK A;  2DZM A;  2Y3A A;  2W55 A;  3OLM D;  1WZ3 A;  2RGF A;  2ZJD A;  3ZUN A;  3H6N A;  3U4E G;  5IO9 A;  4I6P A;  3DPD A;  5IKC M;  3U7Z A;  2QIE B;  3LB8 C;  4PT5 A;  3RUI B;  3QCA A;  4W9F A;  3V6E B;  2I38 A;  1LM8 B;  2R2O A;  1M94 A;  3EGR A;  4A9A A;  1I42 A;  1KJT A;  5BMI A;  1Q0W B;  2AQ3 B;  4MDK E;  3RI7 C;  4B0M A;  3E9S A;  1JWU D;  1WGY A;  4XWW A;  1EUV B;  1N60 A;  4KKI A;  3TCA A;  3GP7 A;  1VZ7 A;  1SIJ A;  3CST A;  4DDG D;  4MM3 B;  2O6V D;  2LFI A;  2C7H A;  5HFY A;  2PVG C;  5L95 C;  2BYT A;  1JML A;  1PGX A;  2FIF A;  2DZI A;  1V9J A;  3P42 A;  3KLS X;  1JWS D;  1Q5W B;  1NYQ A;  4KKJ A;  3AE4 B;  4C80 A;  2WDQ B;  2BGF A;  4OVU A;  4AOF A;  3NG0 A;  2KVZ A;  1S1Q B;  1STE A;  5G55 A;  5IA7 A;  1FXI A;  1QQR A;  3QQ8 B;  3PTF C;  5E6J A;  2FE8 A;  4MGZ E;  3L08 A;  2EMS A;  4K7W A;  5D94 A;  4PS3 A;  2WXO A;  2GMI C;  3A9J A;  1UBQ A;  1P7E A;  1GB4 A;  1OTR B;  4XYC A;  3RNC C;  3RUL A;  2KFK A;  1JCK B;  1WSP A;  1A70 A;  2EEL A;  1L4Z B;  3O13 A;  2L83 A;  1VLB A;  2M56 B;  4EZJ A;  2WX1 A;  3RNE C;  3NZS A;  3WAO A;  5FKA C;  2LRW A;  1GC6 A;  2OJW A;  4GDK B;  2KMA A;  4LTU A;  2BWF A;  3AI5 A;  1K8R B;  2Z0D B;  2INN E;  4EOY A;  4BBN C;  3O65 B;  3UQA A;  4FLH A;  2G4S A;  2KMM A;  4WWM A;  1YQ3 B;  3NY5 A;  3U52 E;  2Q5W D;  3B1L X;  1FNU A;  1UWM A;  3L13 A;  3AMZ A;  3QHT A;  3TL5 A;  1MG4 A;  1AYF A;  4W9D A;  4UDU C;  5JHA A;  3TEW A;  1UUP A;  2FCS A;  2ZCB A;  3A33 B;  2FCM A;  2JYT A;  1C4P A;  3R7Q A;  5DPW A;  1WH3 A;  2AL3 A;  2KOX A;  5EE9 A;  1TBE A;  4IC7 B;  3M63 B;  1V49 A;  3TSS A;  1TTN A;  2ZW1 A;  1PQS A;  2KX3 A;  1DOI A;  1WXM A;  3BVG A;  2KAN A;  4URK A;  4QAY A;  1FNV A;  1YD8 U;  3VRA B;  2OOB B;  2QHO A;  1XLO A;  2DAJ A;  4ACF A;  3ONS A;  3WCQ A;  1OQQ A;  3RNA C;  1LO5 D;  3AH7 A;  3H8H A;  3TEZ A;  4HPM B;  2LVP A;  2KO3 A;  2CHZ A;  3VR8 B;  5E6P A;  3EUB 2;  4K7S A;  2GI9 A;  2CJO A;  1WJU A;  4HKZ E;  5GMV A;  1WFY A;  3I5J C;  4M02 A;  2J0M A;  3Q14 C;  4GLS C;  1B1Z A;  1EF5 A;  1F52 A;  3FIL A;  4W9C A;  4X57 B;  4ARC A;  4GU2 A;  2GBR A;  2L76 A;  1JRP A;  1WI0 A;  4HXD A;  2DHZ A;  3W1Y A;  2MWS B;  2FCN A;  2AEH A;  1QZE A;  4HKQ A;  3PGE A;  1D5X C;  2AL6 A;  3Q8A A;  4NZL B;  3BZD B;  1RAX A;  3ALB A;  1FXT B;  1NYR A;  4C00 A;  2KT7 A;  1BT0 A;  4JIO U;  5KHO A;  2LGD A;  3Q2A C;  1PUT A;  4W9E A;  1AW7 A;  2BF8 B;  2QCZ A;  3ZJT A;  3Q3J A;  5JZE B;  1R4N B;  2EKE C;  1JRO A;  1ZPS A;  4M8N A;  1WXA A;  5DPS A;  1FO4 A;  3VTU A;  4K1R B;  2G4D B;  4A3O A;  3MFG A;  2G1E A;  4W9L A;  4FJV B;  2YEP F;  3PO0 A;  4MGK E;  3LDZ E;  4HCP B;  2M1M A;  2NCN A;  4BKT A;  4HVB A;  3BK1 A;  1AN8 A;  3EHV A;  3V3X A;  2FUG 1;  5DCN A;  3ZKJ C;  1LGR A;  4PYZ A;  2MBB B;  3QJZ A;  3JYU A;  4KSL C;  3SU8 X;  3ABV B;  2MJE A;  4OVZ A;  4ZYS A;  4XGA B;  1BXT A;  2WXP A;  2C5L C;  2X38 A;  3NVY A;  4HEA 1;  3Q3O C;  2Y5P A;  1UGJ A;  4I6L B;  2J42 A;  2JYE A;  3BY4 B;  3RN9 C;  3TIX A;  1WYG A;  1Z2M A;  1J19 A;  3W2D A;  3DBH B;  3PS6 A;  1VZ8 A;  2WXJ A;  4KZ0 A;  3VUY A;  3JW0 X;  2LI5 A;  3N3K B;  3SD5 A;  3W9C B;  3W5V B;  1YN5 A;  1TS4 A;  4B95 A;  3UGB B;  4WQM A;  2JU6 X;  3QWZ B;  5D7G A;  1ZW7 A;  2WXG A;  4OZC A;  2LUE A;  3GS2 A;  1IYF A;  5DPT A;  4C4V A;  4HPP A;  2HJ1 A;  4NJ7 A;  1GPX A;  3VH3 B;  4DHZ B;  3RFZ B;  3SFD B;  4BVU C;  4NAW A;  4CQN A;  2KDI A;  4FBJ B;  3H7P A;  4JLC A;  1N6Z A;  1EWC A;  2L0T A;  1WGH A;  1SGH A;  4HLE A;  2N7E A;  3GB1 A;  2O6V B;  4YTN B;  3HRD D;  2SAK A;  4ZHO A;  4TV3 A;  4M0W B;  5J17 A;  3VQI A;  4RGM A;  4W9H A;  4ANV A;  4NNJ B;  2OED A;  2WXR A;  1D6E C;  3B2G A;  3C0R B;  1CJE A;  3IHP C;  3AB5 A;  1HXY D;  1WGD A;  2N1V A;  4IOI E;  1SJH D;  1QIL A;  3EEC A;  4DHJ D;  3BK2 A;  4R3D A;  1RM6 C;  3AUL A;  3AE2 B;  5H92 C;  2JY6 A;  2X8X X;  2NS5 A;  3NVZ A;  4E3C A;  2LAS A;  4TQ1 A;  2MX2 A;  1GAQ B;  1FCC C;  1J0G A;  1JWM D;  4EUT A;  2XNA C;  5AZG A;  1R7S A;  3AU5 A;  4C7Z A;  1ROE A;  3DHI C;  1WXS A;  1WF9 A;  4RM9 A;  3UQB A;  1RFK A;  2WDR B;  3K9O B;  5HG2 A;  3ZNI D;  2Z8L A;  1WJ4 A;  3FIL B;  1HE8 A;  3APC A;  1LQB A;  2IZV B;  1QOB A;  4II2 B;  2MBQ A;  2K8H A;  3TUO A;  1KFY B;  1JRU A;  2VZK B;  2BKR B;  5J2R A;  5BMG A;  1L6V A;  4BFR A;  1MVK A;  2K3U A;  2CKH B;  5E6N A;  1EU4 A;  4YL8 A;  1J8C A;  2L00 B;  1I4Q A;  5HHD G;  3T3N A;  3A9K B;  1DGJ A;  1SEB D;  4JGH B;  3P4S B;  2NPT B;  1EF1 A;  3P1M A;  1UD7 A;  4MSM B;  1I4X A;  2FCQ A;  4FA6 A;  4KVG B;  4EZK A;  1ET6 A;  3AXC A;  4PS7 A;  3L0W B;  3U2S C;  5FK9 C;  2PLP A;  1SBB B;  4YSZ B;  2C7M B;  5D3D A;  4IWQ A;  3QAR A;  3DBL B;  2KDE B;  4MH8 A;  3QIJ A;  2G9H D;  2DYO A;  2MRP A;  1E7V A;  1IUE A;  1UWX A;  1F0Z A;  5BYQ A;  1SE3 A;  2KWV B;  4MT5 A;  2JZ3 B;  2WU2 B;  3CIR B;  3RNF C;  1LXD A;  2BWE S;  1YNT E;  1E8W A;  4HDO A;  4JWS C;  1EWY C;  2MH7 A;  2L8J A;  3JSV B;  3WAM A;  1RRB A;  4E74 A;  3GE3 C;  3AEC B;  2ZCC A;  1JAL A;  1NVI D;  1R4M B;  3LYY A;  4W9G A;  1FPY A;  2VH2 A;  4NJ6 A;  4S0R A;  2WXM A;  3CSF A;  1KM7 A;  2NPT A;  1Y8R C;  3NOB A;  5AZH A;  4AJY B;  2PPH A;  1GUA B;  1JWB D;  3T3O A;  5D2M B;  2NBW B;  2PIA A;  1C9F A;  4XE0 A;  5HI1 A;  2NTT A;  3RNB C;  4USA A;  3DBR I;  1YX6 B;  2KDB A;  5D6J B;  3TJP A;  2JX5 A;  4HPL B;  3DDC B;  3SFE B;  2J0J A;  3QX1 A;  3ZJU A; 
#chains in the Genus database with same CATH homology
 1GC7 A;  2FID A;  4IC7 B;  4BBN F;  2V3S A;  1E8Y A;  2KTR A;  1TZ1 A;  2N9P C;  1V49 A;  3M63 B;  1R4N I;  3X0W A;  1S3S G;  1TTN A;  1WE7 A;  1P1A A;  1PQS A;  1V86 A;  2KX3 A;  1WXM A;  2NBU A;  2LJ5 A;  1GJZ A;  2I1K A;  3A1Q B;  3OJ3 A;  2KAN A;  4EFO A;  5JHB A;  4URK A;  4W9J A;  2IY0 B;  3UF8 A;  2KKC A;  1P98 A;  1YD8 U;  5LXH A;  2A5U A;  2OOB B;  2QHO A;  1E5W A;  4AUQ C;  1UGM A;  2DAJ A;  3A1Q A;  2MQJ A;  3N30 A;  4RMA A;  3ONS A;  3DBL I;  2LXA A;  1OEY A;  3M62 B;  3ZO5 B;  1IP9 A;  2KTR B;  1WR6 E;  2GOW A;  2LVP A;  4HPM B;  2XBB C;  1V6E A;  2KO3 A;  1WR1 A;  2CHZ A;  5CHV C;  3L54 A;  2HD5 B;  2V4L A;  2C7N B;  3JVZ X;  1WXV A;  5CX3 A;  5E6P A;  1TGZ B;  1G6J A;  4AWJ A;  4K7S A;  4II3 B;  4GGQ A;  1WJU A;  4F8C B;  3ENE A;  4JQW C;  3ZVV A;  1YIW A;  1WJN A;  4GXB A;  5GMV A;  1OQY A;  2KK8 A;  1WFY A;  4ZRK A;  2HTH A;  2LWP A;  3H7S A;  4KV2 A;  2J0M A;  4B9K A;  2GBJ A;  3IBE A;  3PT2 B;  3MTN B;  3APD A;  4GDL A;  1EF5 A;  1KLV A;  1E7U A;  4W9C A;  1P3Q U;  4X57 B;  3DVN U;  4ICV A;  2KWC A;  2N7D A;  5FR6 A;  2HJ8 A;  2PE9 A;  4GU2 A;  4W9K A;  3VVW B;  2GBR A;  1A5R A;  2L76 A;  1WI0 A;  2XK5 B;  2PE6 B;  1F9J A;  4HJK A;  4WWP A;  5JH5 C;  2K6Q A;  4HXD A;  2DHZ A;  3W1Y A;  3ZW3 A;  4HCN B;  4ZYN A;  3V6C B;  2EMT A;  2BYF A;  2LGY A;  4J6I A;  2MWS B;  2FCN A;  2AEH A;  1QZE A;  2FAZ A;  3KUD B;  4GMV A;  1E90 A;  3PGE A;  3K9P B;  2KNB A;  3I3T B;  2AL6 A;  2G45 B;  4DDI D;  3ECI A;  2D07 B;  2D11 A;  2LVQ A;  2ZEQ A;  2DX5 B;  1RAX A;  2ZNV C;  3ALB A;  1FXT B;  4MEM A;  4WJO A;  2IYD B;  3PRE A;  5E6O A;  3GZN I;  3ML8 A;  1BT0 A;  4JIO U;  4CYE A;  5KHO A;  1WM3 A;  2LGD A;  4M8M A;  3T8M A;  2R2Q A;  2K25 A;  3DCG A;  4W9E A;  3JSV A;  3WAP A;  2XEW A;  3ZNZ B;  1WJ6 A;  2O6V A;  3DQV A;  3R7R A;  1WMH A;  2BF8 B;  2KC1 A;  3HK0 A;  3UIP B;  5KHQ A;  4OVV A;  2YVC A;  3Q3J A;  5JZE B;  1H8C A;  3M3J A;  1SIF A;  4DWF A;  2EKE C;  1EO6 A;  4FHK A;  4MH0 E;  4EEW A;  4M8N A;  4LDT B;  1WXA A;  5DPS A;  3DBS A;  5HKH A;  4MEL A;  3WA0 A;  3VTU A;  1ZGU B;  4K1R B;  2G4D B;  2N9X A;  2WWZ A;  5AZF A;  4A3O A;  2L3Z A;  1YJ1 A;  2DZJ A;  2LZ6 A;  4W9L A;  4FJV B;  3P2B A;  3L17 A;  4MGK E;  1RLF A;  4KZC A;  2ZVN A;  2ZPN A;  3LDZ E;  1WX8 A;  2M1M A;  3PHX B;  4HCP B;  3DBH I;  4MSQ B;  3KUC B;  2IY1 B;  2KQ7 A;  3PRZ A;  5DPR A;  3T9L A;  2NCN A;  4BKT A;  3DVG X;  4HVB A;  3R3M A;  4IW0 A;  1D3Z A;  3EHV A;  3PHW B;  5TR5 A;  5DCN A;  4ASW C;  2KLG A;  3A4R A;  3ZKJ C;  2JRH A;  4WJP A;  4PYZ A;  2MBB B;  3H9D A;  3NHE B;  2Y5B B;  3QJZ A;  3WAL A;  3JYU A;  3PLU A;  4KSL C;  3SU8 X;  4BOS C;  4WWO A;  4W9I A;  4GB9 A;  1UZX B;  1V5T A;  2ZPY A;  5LLI A;  1I35 A;  2GBK A;  3QA8 A;  2C5L C;  1NDD A;  2JXX A;  3PRP B;  2BKF A;  2O2V A;  4DK5 A;  3PV1 A;  4IWO A;  3PLV A;  2CR5 A;  2JUO A;  4I6L B;  2M17 A;  4XZ4 A;  5CTR C;  1LFD A;  1XQQ A;  3BY4 B;  4WJQ A;  1WGG A;  2GBM A;  4FHJ A;  2AYO B;  4KSK C;  1Z2M A;  2IBI B;  3KVF B;  5CHW A;  3TIX A;  1J19 A;  3PRM B;  4IM2 A;  3ZRF A;  3PS6 A;  2RD0 A;  2JPH A;  2A4Z A;  3U30 A;  4FN2 A;  4F1S A;  4FAD A;  5IAA C;  1L7Y A;  1NI2 A;  5BO4 B;  4NQK E;  1WZ0 A;  1U4A A;  2KJH B;  4KZ0 A;  3VUY A;  1OGW A;  2BYE A;  3HHM A;  2L7R A;  2Z0E B;  3HIZ A;  4FUL A;  2D3G A;  3JW0 X;  3TMP B;  3VAW A;  2LI5 A;  3W1S C;  3N3K B;  3SD5 A;  1ZKH A;  1GG3 A;  4KDL B;  3VXW A;  1WRD B;  4F7Z A;  3A9J B;  4B95 A;  3W1S A;  2L0F A;  3MJW A;  1X1M A;  2LGX A;  3APF A;  3UGB B;  3ZTD A;  2IO3 B;  3KUZ A;  3A9K A;  3PSE B;  3B08 A;  3QWZ B;  5D7G A;  1ZW7 A;  1WMH B;  2L05 A;  2LUE A;  4BOZ B;  1E8Z A;  3L16 A;  3VHT C;  1IYF A;  5DPT A;  3V60 A;  1CMX B;  3RD2 A;  4NJ7 A;  2JRI B;  3VH3 B;  4DHZ B;  4BVU C;  1UEL A;  3ZNH B;  2LVO A;  2VRR B;  3BIN A;  4KIK B;  4NAW A;  2PEA A;  2B3A A;  3UIN B;  4IUM B;  2DEN B;  4GDL B;  4BKS A;  4MM3 A;  2J0K A;  2KDI A;  4FBJ B;  3DVG Y;  3H7P A;  4HK2 A;  4JLC A;  2L0T A;  1WGH A;  1SGH A;  2DZK A;  2RPQ A;  1MG8 A;  4HLE A;  2MP2 B;  2REX A;  1V81 A;  2N7E A;  2KMC A;  1Q1O A;  3X23 A;  2O6V B;  2IO2 B;  2KTF A;  4N9F 4;  3RYT A;  5EDS A;  2CHW A;  1P0R A;  3SHQ A;  2FNJ B;  2KC2 A;  2UYZ B;  1KOT A;  4TV3 A;  3L10 B;  4DHJ B;  3HM6 X;  4M0W B;  5J17 A;  4LDT D;  3VQI A;  3VUW A;  4JL9 A;  4B6W A;  3IVF A;  4W9H A;  2PJH A;  4ANV A;  4NNJ B;  4KDI C;  2RR9 A;  3ZNG C;  4DBG A;  3WIM A;  2MBE A;  2M4N A;  2D2Q A;  3ZRC A;  3C0R B;  2JT4 B;  3OJ4 B;  3IHP C;  4IM3 A;  4NY0 A;  3U8Z A;  1XD3 B;  1WGD A;  2N1V A;  3NZU A;  2KQS A;  1YX5 B;  4PYU A;  3DVN V;  2CHX A;  3EEC A;  2WYQ A;  4BKS D;  1GNU A;  4ZRI A;  4WQO B;  2GBN A;  3OAW A;  2JVC A;  2KD0 A;  1WY8 A;  3CMM B;  4DHJ D;  3EC8 A;  3KYD D;  1H4R A;  3AUL A;  4TKN A;  2MSE D;  3GOE A;  4XC2 A;  2MBH A;  1T0Y A;  2JY6 A;  3WAN A;  2DYM A;  2WDT B;  2NS5 A;  4LCD E;  4NPN A;  2JF5 A;  2YLM A;  2ZNV B;  3U7D A;  4E3C A;  4DHZ E;  1C1Y B;  2LRU A;  2JZZ A;  2D10 A;  2KJ6 A;  2LAS A;  4TQ1 A;  4A20 A;  2MX2 A;  2OJR A;  1P9D U;  1J0G A;  4EUT A;  3SDL C;  3EFU A;  3VUX A;  5AZG A;  2DZM A;  3MHS D;  3VFK A;  1R4M I;  4TUU A;  3AU5 A;  3IG3 A;  3M95 A;  3OLM D;  2DYB A;  4G0N B;  1WZ3 A;  2RGF A;  1L2N A;  2O2V B;  2ZJD A;  3ZUN A;  2C9W B;  3H6N A;  1WXS A;  1WF9 A;  4RM9 A;  4ANW A;  3D32 A;  3UQB A;  1WIA A;  3VH4 B;  4I6P A;  4KIK A;  4NAW B;  3LJ3 A;  1UH6 A;  2IO1 B;  1RFA A;  3DPD A;  2JWZ A;  4GN1 A;  3K9O B;  4ANX A;  2KVR A;  3ZNI D;  1WJ4 A;  3RUI B;  3QCA A;  2I1J A;  1HE8 A;  4HWI B;  3APC A;  4MGI E;  4NQL B;  1LQB A;  2IZV B;  4W9F A;  2R2O A;  1LM8 B;  3V6E B;  1WM2 A;  1M94 A;  3VTW A;  4II2 B;  2MBQ A;  2K8H A;  4FJY A;  5L83 A;  1JRU A;  1I42 A;  2CU1 A;  1KJT A;  2K6D B;  2WX0 A;  4CHK A;  2BKR B;  5J2R A;  1Q0W B;  2N4F A;  3UIO B;  3KH0 A;  4AJW A;  2MCN B;  3S2A A;  3IFW B;  1ISN A;  2J7Q B;  4MDK E;  4BFR A;  4E71 A;  1WE6 A;  2KFJ A;  2CKH B;  2K8C A;  4IM0 A;  1WGY A;  5E6N A;  1EUV B;  4YL8 A;  1OEY J;  4P7I A;  2L00 B;  1J8C A;  4IWP A;  3N32 A;  3TCA A;  4BKG A;  2MP2 A;  4IG7 B;  1V5O A;  3A9K B;  3CST A;  3ZTC A;  4MJS A;  1AAR A;  4JGH B;  2KWU B;  4DDG D;  4RM8 A;  2NPT B;  1EF1 A;  3PVL A;  2O6V D;  1UD7 A;  2C7H A;  4MSM B;  1IPG A;  5L95 C;  2FCQ A;  4FA6 A;  2IO0 B;  2KJR A;  1E8X A;  2FIF A;  2DZI A;  1V9J A;  4KVG B;  2KXJ A;  4GDK A;  4EZK A;  1WYW B;  2G3Q B;  2V1Y A;  3RZF A;  3AXC A;  3HM3 A;  1Q5W B;  4PS7 A;  4A3P A;  4TQ0 A;  3L0W B;  1XT9 B;  2MBO A;  3NS8 A;  5CHF A;  2MLB A;  3CF6 E;  1C3T A;  2BGF A;  4OVU A;  2C7M B;  3PPA A;  2KZR A;  2KFK B;  4AOF A;  4IWQ A;  1WX7 A;  3QAR A;  1S1Q B;  5G55 A;  2UWQ A;  4ZDV A;  5IA7 A;  2KDE B;  4FJZ A;  2MA9 B;  5C23 A;  3QQ8 B;  3H7P B;  3PTF C;  3VTV A;  3QIJ A;  1NBF C;  2DYO A;  2MRP A;  1E7V A;  3Q3F A;  4MGZ E;  3L08 A;  2XK5 A;  3RT3 B;  2KWV B;  4G11 A;  3QK0 A;  2CS4 A;  2KN5 A;  2W9N A;  2EMS A;  3ML9 A;  4K7W A;  2JZ3 B;  2KLC A;  4GSW A;  4PS3 A;  5D94 A;  4G50 A;  3H1U A;  2GMI C;  4K81 A;  1V80 A;  1SE9 A;  4MJS B;  2ASQ A;  1VCB A;  4XX5 A;  4PS8 A;  4ANU A;  4AP4 C;  2KHW B;  1UBQ A;  2N9E B;  3A9J A;  4EZL A;  1LXD A;  2K1F A;  3ZDM C;  2DAF A;  2BWE S;  1OTR B;  4K7U A;  3RUL A;  1E8W A;  2KFK A;  4HDO A;  2BPS A;  2L8J A;  3JSV B;  3WAM A;  4LJP B;  1RRB A;  4ICU A;  1V2Y A;  2NR2 A;  4G3X B;  4HDQ A;  4E74 A;  2WX1 A;  4EZJ A;  4CO7 A;  2M8S A;  3NZS A;  2ZCC A;  3WAO A;  2RSU A;  2LRW A;  3AU4 A;  3RCZ A;  1GC6 A;  4GDK B;  1VD2 A;  1YQB A;  4W9G A;  1Z5S B;  2KMA A;  2BWF A;  2HE7 A;  3AI5 A;  1K8R B;  2K8B A;  2Z0D B;  4NJ6 A;  4LJO B;  2C60 A;  4EOY A;  3CSF A;  2LXC A;  1KM7 A;  3TBL D;  2NPT A;  3V61 A;  4BBN C;  3A4S C;  3ZLZ A;  2BYV E;  4WWN A;  4WAA A;  3QAQ A;  3O65 B;  1Y8R C;  2AWT A;  4FLH A;  3NOB A;  2G4S A;  2M0X A;  3UQA A;  3NY5 A;  5AZH A;  4AJY B;  3VDZ A;  3KYC D;  2KDF B;  3B1L X;  4EKU A;  2KX0 A;  3R66 C;  2N1W A;  1WGR A;  2PPH A;  5LXI B;  3L13 A;  1GUA B;  3KW5 B;  4GIV A;  4I6N B;  2Z59 B;  2ZZP B;  3QHT A;  4GOC A;  2NBV B;  5D2M B;  3TL5 A;  4DXA B;  2LD9 A;  4WJN A;  5AEK B;  2NBW B;  3DOW A;  3ZDT A;  5C1Z A;  2ZVO A;  4W9D A;  3DBR I;  1YX6 B;  2KDB A;  3ZIM A;  3RZW C;  3B0A A;  1UBI A;  5D6J B;  4MGY E;  3TJP A;  5JHA A;  5J18 A;  2NVU I;  1WX9 A;  3QC8 B;  4HPL B;  4ZRJ A;  2FCS A;  2ZCB A;  2FUH B;  3A33 B;  2FCM A;  2K39 A;  3DDC B;  3V62 A;  5G2N A;  3R7Q A;  5DPW A;  2J0J A;  1WH3 A;  3QX1 A;  2AL3 A;  2MW5 A;  3PZD A;  2KOX A;  1TBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...