2KJWA

Solution structure and backbone dynamics of the permutant p54-55
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
96
structure length
96
Chain Sequence
b'MDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S6
publication title Solution structures and backbone dynamics of the ribosomal protein S6 and its permutant P(54-55)
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 16
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kjwA00
3ZZPA 1B64A 4X62F 4DV4F 1FKAF 4DV7F 4JI2F 4JI1F 1RISA 4AQYF 4B3TF 4JI7F 1HNZF 4DR6F 4JI8F 4X64F 4DUZF 4JV5F 2BXJA 3T1YF 3R3TA 5AJ3F 2UUBF 1J5EF 4DUYF 4JYAF 1G7CB 4JI5F 2UXCF 1VMBA 1N32F 2J5AA 1IBKF 1HNXF 4YY3F 4DV5F 1N34F 2ZM6F 2UUCF 4LFAF 2BVZA 3T1HF 4B3MF 2UU9F 1LOUA 5LMUF 4DR5F 1G1XA 4DR7F 4OX9F 2KJVA 4JI0F 4YHHF 4JI6F 4DV0F 2F4VF 1CQMA 4JI4F 4LF4F 4DR3F 2B7CB 4LF9F 3OTOF 2UXBF 5BR8F 4GKJF 1IBLF 4LF8F 1IJFB 2YY3A 2UXDF 1QJHA 4DV2F 4LFCF 1N33F 1I94F 2HHHF 4JI3F 1IJEB 1XNRF 1XNQF 1GH8A 4DV1F 4B3RF 2B7BB 4NXNF 1FJGF 1XMQF 1HR0F 4LFBF 2E5LF 2VQFF 4DR4F 4LF5F 4K0KF 4B3SF 5IWAF 5LMNF 4DV3F 4GKKF 1F60B 1HNWF 2VQEF 4LF7F 1N36F 4DR2F 4NXMF 4LF6F 4DV6F 2UUAF 4DR1F 2KJWA 1XMOF 4KHPF 4X66F 1CQNA 1IBMF 2RJZA 4X65F
chains in the Genus database with same CATH superfamily
1YZ6A 3PW0A 1F2HA 2A3JA 4XPEA 1VQLS 4NXNJ 1RT6A 4DCJB 1QUPA 1HNZF 3MF5A 1S10A 1QY7A 4KGVB 3MCOA 1P9QC 1XTZA 2E1RA 4C3LA 3BSOA 1M5HA 2AEJA 2B6AB 5F41A 5K8PA 4RWXA 1DURA 2KXFA 3T41A 3DLEA 4C97A 1QE1B 3N9UC 1SJ1A 1UA0A 3VALA 3PFEA 4OZ0A 1S1WA 4GO7X 3K89A 1WOSA 1CQMA 1OPZA 3N5BA 5DO2A 3CCVS 2W2PP 2FVRA 4ER8A 3EGWB 1JNZB 6FD1A 2CZ4A 2R4FA 3ZTOA 4U96A 1NJXA 1RT5B 3BEGB 3KDNA 3T1HJ 4P9SA 2V69A 3V6DB 4G65A 2BQUA 3M1VB 3UI3A 3TR5A 4QR2A 4RUHA 4HI1A 4LR8A 3KJVB 4DHVA 1Q8BA 1IBLJ 1C0UB 3FMWA 2EKNA 1T9YA 5HROA 4A8FA 3HHLA 3AFGA 3AXMA 2O1PA 1UL3A 3PV8A 1X5OA 2A0FB 2R3VA 3HSZA 1QAXA 3RB6A 4ED2A 3RAMA 5SUHA 3AJ2A 2MQQA 1VC6A 1T05B 4XDCA 3L9ZA 1RWUA 3QJJA 2H5IB 3GJSB 4ZJOA 5I3QA 4LVNP 3HSJA 2IBOA 3FMBA 1QVFR 1VRUB 4MYUA 3MM6A 2MQMA 5ETNA 4ZJLA 1KP6A 3GCXP 1O51A 1O5JA 2AT1B 2XS7A 4ANEA 2QZ8A 4FYDA 3RJMB 4DN9A 4DS4A 1RCXB 1Y3JA 1SQGA 4UQGA 5EN1A 1HQ2A 3ELHA 2NLWA 2GNKA 1RAEB 3A4TA 3Q8PB 4RUCA 4J9RA 4M63A 5IWAF 3OTCA 1D8YA 1LW2A 4TU9A 1SV5A 4NYPA 1ZS6A 2AX0A 1UAWA 4J9PA 2WBRA 1FD2A 4RBTA 2EK6A 2AJFE 4KGXB 4ILMA 1JLBB 1YLXA 3UCUP 3T6JA 3GJTB 1WORA 4X4PA 2HKEA 4JV1A 1FA0A 2ATLA 1U1KA 2E5LJ 7FD1A 4ES1A 4NA2A 4I6YA 2IIHA 1WKJA 2IMOA 4EGLA 5MLCV 2VG7B 2CUYA 3PKMA 2FVQA 1RYRA 1FFGB 4DFMA 2D9PA 2HS4A 1RAIB 2EKYA 5HMYA 5KG7A 2CVEA 2CJQA 3HI9A 5I42A 4ED0A 2ZOGA 5LMNJ 4MIAA 1F6TA 3V6HA 1AZSA 4UUWA 2CJYB 3M9NB 4DV2F 1VGYA 2P9CA 1FX2A 4F0MA 4AL5A 1NB2A 2MZTA 2ZUAA 3K5PA 3AA8A 1GX5A 4LSZB 4KAIA 1KC8T 1DZ5A 1WG4A 5AJ3J 4CNZA 2HNZA 5CA5A 2GHPA 2R8KA 3CF5Q 1UCNA 2RQ4A 1ZH5A 1QAIA 1XIQA 2RH3A 3DLHA 1RLDA 4FF4A 5E3AA 1MMLA 2EXUA 3ZZUA 2PIIA 3OTBA 4LF8J 4OYZA 3EZUA 3AAWB 4NA3A 3RZAA 3K5LA 4RX6A 3M2UB 3OR2A 3PNIA 4PABA 3NWRA 4PQUB 2HHSA 2UUCF 3TZWA 1MSWD 4IRDA 4K5RA 2QA4S 3C2PA 4GO5X 1VQ7S 2DHAA 2HBYB 3DRPA 3D6HB 3NS7B 4JI6F 3OV7A 1QSYA 3M2RA 4QPXA 1O0PA 1ZTTA 2DH7A 2VPZB 4NOHA 2OMOA 3WC0A 1WEYA 2PD1A 1X9WA 1FHTA 3OXFA 1XMOJ 1PC5A 2R2RA 3GG1A 4USKA 1T9WA 1RT6B 1GH8A 1N5YB 4DV1F 1WF2A 2W7AA 3M2VA 5I4MA 2JC1A 2R8JA 4H4MA 4YEAA 4DJBA 2QIFA 3EPGA 3MM8A 3D9BA 5CCMA 2JZ5A 4YB6A 3B54A 1N48A 2I8EA 4HHHA 2WVDA 5F9LA 2CG8A 1I1GA 4OZJA 2GZOA 1G3OA 1D8ZA 2W1BA 1JLCB 1RUSA 3DOMA 4Z7CA 3W3SA 2JOQA 2AHOB 4ZP7A 2UUBF 2MKHA 4OJ3A 2GIQA 4LR9A 2V2ZA 4DX5A 2CPFA 1D9FA 4URGA 1H72C 1MWZA 1YKWA 2DEIA 2HFUA 3R2DJ 5HO4A 1RT1B 1TAQA 2POKA 1KVKA 1LW0B 3I0RA 1FXDA 1U8WA 4QIGA 2VFSA 3OFEA 3D0IE 3O8WA 2JL9A 1X4CA 1T03B 3J80U 2DRBA 3VWSA 3CJSA 5F8LA 2MZ1A 1MROA 1RB0A 3ITHA 4TY8A 3D1OA 2GQ2A 1FEEA 3WZ0A 1VISA 4RW6B 2GA7A 4DUZJ 3HHNB 1FJ7A 2NXNA 3I87A 2K3KA 3NAIA 5DZ6A 4ECWA 2FZCB 4ECZA 3OSPA 3BQ0A 5KFKA 2QRRA 3OR1A 4J9SA 4PG4A 3J7AN 5EWFA 2MDAA 1M1HA 3ZNJ1 3NS6A 2MZRA 2AGQA 1O6XA 1KBRA 1AA1B 1ZM2A 1UWBB 3L95X 4KJIA 4QWEA 1KHWA 2YH0A 3RAQA 5HAOA 2HRTA 4FKXA 1IXKA 1TMMA 2Y1LB 1WOOA 3W64A 3F44A 4OYMA 4EMDA 3DHXA 3MPWA 4OX9F 3AA9A 4A8MP 1IKVB 1DRZA 1L3KA 1SV5B 1FXLA 3NGUA 4IO1A 1HNZJ 1LK7A 3PRBA 4NLPA 3G86A 1ZZFA 5DDOC 3DLJA 1X4BA 3I55S 4USTA 1ZPWX 1YHQS 3GSIA 4C0OC 4NYZA 4IH5A 5E41A 1HIYA 3DLKB 4O0NA 2BJ3A 3CDAA 3QAEA 3CO9A 1HW9A 2KFZA 1S9GA 3NEKA 4P7VA 2FHKA 2I9SA 2ZNZA 4BWMA 3QFWA 1LV5A 1VCTA 1Y7PA 1NK7A 1NKCA 3WDOA 3OL6A 2M8DB 3UVJA 2NUHA 1KS2A 3A13A 5IC4B 2F8MA 3FCHA 1IKXB 3R97A 4CH0S 2QLXA 2WVCA 4I6AA 1BLUA 4DU8A 4K50A 3GJQB 3IBCB 4ZP6A 1DHMA 2W7PA 1XN9A 5G4DA 1KD1T 4HDGA 3DGVA 1NSPA 3A8EA 4J9LA 3JS9A 3V4IA 5RUBA 3PHTA 1X4HA 4EZ9A 4CP5A 2OH2A 4KY3A 4O3PA 1HYSB 4RBUA 4QU7A 3CEDA 3KLGA 2OLWA 2XGPA 3OT9A 2WONA 2F5GA 4DR6J 5LT5A 4A4JA 3OR2B 1VQ8S 1RT4A 3QPIA 2D41A 5A76A 5H9FJ 1FRIA 4CO1A 2JVRA 2XY5A 2L9WA 3PO5A 1C1BB 1BY9A 4DV4F 4B08A 3SI8A 3LTOA 3EDQB 1G2EA 1VFJA 2CZ9A 4Z7YA 1FVQA 2WAQD 4Y3CA 3GZ7A 5IWAJ 1VMBA 2BDPA 3I31A 2ALZA 1T9TA 3BGUA 1YJNS 1U02A 3OVAA 3HHKA 1NK9A 1MNEA 4ERDA 5FDLB 2DGUA 3M32B 3ZZTA 4DR5F 5F8MA 2R42A 4O4RA 1PGZA 2I0XA 4C0HA 4P72A 2AZ3A 1LFPA 1UKUA 5EX3A 4KC5A 2EFGA 1RAAB 2DCUB 3K0JA 3Q86A 4RU9A 3NCPA 3D0HE 4F2SA 1Y5LB 3KFWX 2DNRA 4U7UD 3H2LA 2IC3B 4H4OA 3QRPA 4NXMJ 4DOZA 4EBDA 1SC6A 2J6SA 5A8KA 4X62J 2X3GA 4P2MA 4P2SA 5KFTA 2YKQA 2K1RB 5A8WB 3A12A 2YH1A 2LA4A 3IAS9 4N76A 3QJPA 4PAAA 1YRTA 1KWMA 3Q0AA 4I7FB 1N34J 3I0SA 2VC1A 1O8BA 2IHR1 2XSJA 4Y65A 4QWAA 1TKXA 1MWYA 1HL6A 1FKAF 1I51B 1WC3A 2QLBB 4MKAA 4JI4J 3WHIA 3BSNA 1X60A 1U48A 1LK5A 3TYTA 4ZVTB 1EKRA 3M8ZA 1GXUA 3DOLA 3G2XA 2QYCA 1BGXT 1Y3KA 2FTRA 1WHYA 2VJUA 4CLLA 1F3VA 2OIHA 4R0EA 1R0AA 3KUGA 1CJVB 3B4DA 2VG6A 3ZTSA 3DLGA 2KHCA 1NPPA 3QGGA 2B4PA 1OQ3A 2J0SD 4O3RA 2E44A 2NQPA 2EW9A 3OSNA 4RW7B 3W60A 2UUCJ 1FKPA 2DHXA 2KZMA 4YR2A 4Y2AA 4OZ5A 5L9NA 4RUAA 4EYHB 3MCMA 4JI6J 4KO0A 2BQRA 1JJHA 5J2PA 5HP1B 2FY1A 2B8QA 3FCWA 2GAGC 1TR0A 3AHPA 5C2GA 2N4CA 1PJ6A 3N01A 4CO5A 2L3MA 4FKYA 2YKMB 4FVMA 3UPFA 4FPIA 1H73A 2D3OR 2D3O1 4AQYF 1P1TA 3TVZA 3MM7B 1DLOA 1YRUA 3SDEB 1GTEA 1G7CB 2N4DA 2H5EA 3MURP 2QX0A 5KFXA 2W2MP 5ETPA 1NB7A 5A6WA 4DG1A 4OYPA 1FNMA 1R27B 2FHOB 4NCGA 1R7IA 3M30B 5KFJA 4K4TA 1RTIA 5GMDA 2YPZA 1HBUB 3OHBA 2FJEB 3EVOA 3AXKA 1XR6A 4F0KA 3UWTA 5J1NA 3D2WA 2UXDF 2GGPB 3M8RA 1IBMJ 1HR0F 1C1CB 3JSRA 4M5KA 3R9LA 1QSSA 3ZNUA 3BREA 1NH7A 4IO9Q 1NJZA 3MEDA 1S77D 4ANCA 4HEA9 4CLTA 2MQLA 2YX1A 2KB2A 2BKOA 2JLEA 2ILYA 4NLYA 3H42A 2CPHA 2K7KA 2IMWP 3DN9A 1UTAA 3FZ2A 1JJ2R 4QCLA 2FLPA 1JLAA 3U02A 2DGVA 1XR7A 1H2UX 2Y0BB 1FFWB 4ZLPA 3DRRB 3MWBA 3GIMA 5IV3A 4QIFA 2DNYA 2HNDB 2V8VA 3TARA 3CCQS 1VLYA 4PG7A 4QR1A 4TVAB 4DV0F 4IYQA 1S1TA 2FGCA 4WJBA 4LF9F 3LWLA 3EPIA 4I67A 3O5TB 4J9NA 1Q78A 3R7NB 2ZBIA 3IRXA 4DFKA 1TK5A 2CFXA 1X5PA 1OS5A 5DDRC 3A8IA 1GXTA 3THPA 2YTCA 2BACA 5D15A 4MFBB 1FNXH 3H7HB 3BV8A 1MWQA 1HQEA 2HK2A 5ETKA 1UEVA 2BJEA 2IVMA 4W90B 1XEZA 1HBMB 2W8LA 2HBZB 3NG8A 4CM2A 2A18A 2IJNA 5B0EA 2XHCA 4LSNA 1SI9A 4PPZA 5GAHU 2J8SA 3IR7B 2CZVC 4F67A 1UFWA 5D8HB 2MXYA 4DZ6A 2WOMB 4FBUA 1TFYA 4IG0A 2AJ4A 2BE9B 2WRMA 3CDBA 4KRWA 1GK8A 2EC0A 4Y2MA 3LP2B 5F8HA 3OFHA 2IM0A 4UOHA 2HHPA 1W2IA 2ACYA 2KKHA 3CJ2A 3N0VA 2EC2A 1RU1A 4LF7J 1S7HA 5JVGQ 2ZZTA 1K9MT 3UD5A 2DTJA 4X66J 2PE8A 4J5OA 2XZDB 2DT9A 4ZVGA 1FJGF 1VJWA 3EE3A 2CWXA 2RIJA 3CJRA 2DNMA 2DH9A 2UVUA 1V3SA 5F0UA 4WKRA 4OV1A 2DNZA 4ZVUB 1HI1A 2X51A 2G2ZA 1VQKS 1U0HB 2ILZA 1KLMA 5KG1A 3C3LA 2CJ9A 1HNVB 1GFWB 4WWSA 2OI2A 4K2XA 4P2XA 2I6WA 4ZVFA 3BPDA 4ECVA 4YQWA 5CABA 1NPKA 2FC9A 5HQLA 1UZDA 4KH0B 1P6TA 2KI2A 3K57A 4BWJA 3OL7A 5I3UA 3AJDA 1SJ3P 3ZFVA 5L8RC 2HMIB 2PA8D 3H5SA 4FZVA 1RWMB 4NMXA 4DV4J 3V2UC 2UVRA 2RRAA 2IRXA 2VODA 1RT3B 2HGLA 2ZBQA 1HBNA 4J9VA 1FK9B 2C2EA 4NLGA 3ZC4A 4CH1A 4M5NA 2DD8S 2ATCB 4QQBA 3QNWB 2R7TA 3LALA 1WHXA 5THWA 4DR5J 2MSTA 3BO3A 3O3LA 1K0VA 4GKKF 3R1LA 5E0OA 2IYIA 1TK8A 4YY3J 2V2KA 1RTIB 4ECSA 1WG5A 1ZM3A 5KFMA 2CJKA 2VBXA 1B64A 3IA0A 4F36A 3L7PA 4QW9A 4JV2A 5KFSA 4MT1A 4ELTA 2ZJRQ 4ZCMA 2CNNB 3MUTP 4TLQA 4IRCA 4I2PB 2PEBA 2R8HA 3HP6A 3VVTA 2OP5A 2A10A 2CQ0A 1TV6B 2VBYA 2HG4A 2MKYA 1TL3B 4JOUA 4O4GB 3G6YA 5E3PA 4F4KA 2R8GA 3TX0A 3EXCX 3W2VA 5B0BA 1ZAXA 1C0TA 3HXMA 5C24A 3KWMA 4DWIA 2HVIA 5GAGU 3C16B 1S6PA 2YBVA 5GMEA 2WW4A 3T6BA 3JSBA 3CT9A 5EGYA 3W7BA 3IGVA 2JFDA 5K8OA 2ZHOA 1LWXA 4OJGA 4P75A 4CYUA 5KFLA 2J9CA 4ZIWA 2PMWA 4CLWA 3CIZA 3NCQA 5BYQA 3P8BB 2Y8YA 4KB7A 2WSFC 2B4VA 1XWLA 2HGMA 3DNCA 2V9WA 3MMCA 2CRLA 3JSMA 3BN4A 3VQSA 3PW5A 1TUWA 1NDLA 2MKJA 1N32F 3JAMY 3MECB 2YKAA 3RBDA 3NGRA 4D3GA 4I64A 1F9HA 2MGZB 5D6GA 4DR3F 3RBZA 3HHLD 2W9CA 1HHSA 4WFAQ 3THTA 4PKDB 5AXMA 3BF4A 5DM6Q 3FFIB 4ED5A 5IT9Y 3OL8A 4LSNB 3GR1A 3GU0A 4HTIA 3WIVA 3FK4A 1B70B 2ACMA 1AUSL 1FWLA 1ULRA 4DUYJ 3HT3A 3MM9A 4IH7A 3OFFA 2KVIA 5HSPA 1RGVA 2UXDJ 5KFGA 1IBCB 4K2JA 2HIQA 1HD0A 3P6YC 1BUXA 3KUHA 4XIUA 1YVFA 1HR0J 2UUTA 2XSFA 3TUIC 3FSXA 4X64F 1X0FA 3IBFB 2RKIA 4I2QB 2P2CB 3QSIA 4RZRA 1DQAA 2RQKA 4ID5A 1M0SA 1T02A 3C6TB 3EXYA 3GFYA 3GP9A 3PW2A 4F3OA 1BD6A 3DMJA 4ATNA 2HHVA 3IBWA 3EICA 3KG4A 1CC8A 3W5YA 1FJEB 3LA0A 2LXUA 3P3DA 3MMJA 3H8YA 3JXOA 2PFDA 1YSJA 3PZPA 1V6HA 3KLVA 2CDQA 1CPZA 1R6VA 2HVZA 5LXYA 1AROP 3GIIA 4FS2A 2HLTA 4XK8C 3KOAA 1D9DA 1RAGB 3HVWA 3MAHA 1PBUA 3FBEA 1DQ8A 4USHA 4E98A 1KR4A 4OYIA 2F4FA 2B9XA 2P8IA 4K7QA 1CS4A 1VQNS 4W92B 1IVZA 1ZOTA 4JV5F 2KN4A 3K8VA 3HM9A 3B78A 3GE9A 1QM9A 2VA3A 2OPSA 4CO3A 3TUJC 5K9FA 1RA7A 4F2RA 3TI0A 2V2QA 2HYIB 2IM2A 3K5OA 3M8QA 5LOQA 3S01A 2UP1A 3W9IA 3CJ5A 3GR0A 3QLHA 2XM3A 2DNHA 2BJ1A 3BYRA 3CDEA 1CJKA 2M5YA 4KE5A 2E7XA 2IFXA 3BBBA 1UVKA 3TA1A 4ICLB 1YGYA 1PO6A 1FE4A 1N36F 1OY8A 3R5DA 3G82A 2RILA 4Y28C 1NK5A 3BR9A 4EI2A 2D1CA 1FJGJ 2EPIA 4OHZA 4WP9A 3MR6A 3TOQA 1SL0A 3G8SA 1P9YA 1Q53A 3W2VB 2AQ4A 2JEFA 3W9JA 3AD8C 4PXCA 1X31C 1HWLA 1T0TV 5J2NA 4WIIA 5M2PA 2HZAA 2MYFA 2V4JA 5KFNA 4CCHA 1D9AA 2D3UA 3FBFA 3C15A 4DX7A 3HVTB 2Q66A 1TVRB 2KFNA 1UEUA 5HMZA 3TAQA 2NSCA 3T5HA 1LWEA 4K5SA 4U8YA 3QWUA 1S0OA 4OX6A 4DR4F 4IFVB 1IQTA 2YQ0A 3EGNA 4IFYA 2BOAA 2XO7A 1PKUA 2M8HA 2ZKUA 3NBPA 4UTGA 4DQQA 2YKPA 4WKYA 1VK3A 3JB9k 5F8IA 4I6WA 1QD1A 2UVWA 1FKOB 4B9LA 2HAIA 2DNPA 1ZAWA 3EM1A 3J81U 4DZDA 5SZTA 1REVA 3MTKA 4GKKJ 2ZC4A 2ZE2B 1EIYB 2QFJA 4O44A 2QMXA 4QIEA 4BCAA 4I1TA 1ZA2B 2YNHA 4KV8A 2VOOA 4DR7F 1VJQA 1YDLA 1S1XB 3PO4A 4BC9A 4PWWA 4HT5A 2VOPA 3MPYA 5KFPA 2YNIB 2LEAA 3D4JA 1IKWB 2XYHB 3TAMB 3OHAA 1SXLA 2MHEA 4CO4A 5KFWA 2F9DA 1LQ9A 1H6KX 1Q79A 1VDHA 3FEZA 2B7BB 3IRWP 4PWDA 1EX8A 1B3TA 4F4WA 4ZVRB 4WTYA 4K0KF 1FRLA 1DARA 5KFEA 4S0MA 2C2MB 3KMQA 3C6UB 3HCXA 4FXVA 1FESA 2R7VA 2WZ1A 3AB2B 1JJ4A 3HX9A 1IM4A 3BSAA 1KQFB 3PKYA 2YKOA 4XDDA 1TKZB 1HWKA 2CPJA 4ZP9A 4DV7F 2YWHA 1CEZA 3MMBA 2GVDA 3I9ZA 1ZA1B 2KHDA 2IDEA 5HJXA 5A2QU 3R5JB 1SJFA 4RW4B 3AOAA 3EVMA 3UDLA 5L1LA 1CJTB 1NRKA 3CJKB 2E5GA 2XMJA 3SCKE 5KG2A 4IG3A 5HMXA 3SQGA 5E2QA 1JLEA 3DGPB 1NK6A 1S48A 2C2NA 3ADAC 4TKTA 2OAUA 2OELA 4IQXA 5CAAA 4DF4A 3OFGA 2VBWA 1VBZA 3MAQA 4DSKA 4LJMA 4A8QA 1NKBA 3CMAS 1Z1ZA 1Q7LB 1V9OA 1WC1A 3MCNA 1VK8A 2LQBA 2OPSB 4PRFA 3CDWA 4DR3J 1ACMB 2F9JA 3UN5A 2CPEA 4LBHA 2MLZA 3E01A 1RBOB 3OL9A 4DFJA 1MG7A 2IBKA 2HQFA 5I3PA 5HANA 2DRDA 3VQTA 3GWCA 4KT0C 2YNGB 4NEYA 2EI5A 2V5HG 1B7YB 1QDUB 1RK8A 3QWPA 2ZBPA 2QL7B 3KK2B 2ZM6F 1EKSA 1N5QA 1S1VB 3FNNA 1LWFB 2Z8QA 3DRSA 2WCXA 4OYBA 2HSEB 1CJUA 3E3XA 1WWHA 4IOBA 5AE2A 3M8YA 4XAKA 1UPPA 1FE0A 4E8UA 3JAMU 3DXBA 4X64J 2DK2A 3AY0A 2HHHF 4KHPJ 1H7XA 5J1EA 1RHJB 3G71S 3DDIA 4JUZA 3VGTA 1E6YA 3RB3A 4Q7AA 1NXIA 5FLXY 3KJQB 3CC2S 1XK8A 4U67Q 1VHIA 3DI6B 3T1YJ 1L3TA 1J5EJ 1LWCA 3D3BJ 2GO9A 2RDJA 1U4BA 2VIHA 1FI4A 2IRYA 3TA2A 1NM2A 4WE1A 1L3UA 4XPCA 4A8KA 2DIVA 2V8DA 3A8KA 2BE2A 4M5IA 2KRBA 1M5KC 4H4KA 1QAJA 2RDDA 2ZH6A 3UDEA 1OYDA 2O66A 1S72S 2ASYA 4OI1A 1Q5VA 4DEZA 5B08A 4DPYA 2J9EA 5LJ5Y 2MLYA 4O3SA 2LDIA 2EFNA 3VGVA 2RS2A 2G0CA 9ATCB 5BYRA 2B56A 4ALZA 3KLHA 4JV5J 1U2FA 1UA1A 5IZHA 2BJ7A 1C4AA 4Z37A 3NAHA 1YBUA 3IR5B 2RS8A 4IKAA 3IM8A 2VQFF 3TEHB 2LLZA 3MPUB 4JI8J 4U9RA 2Q6CA 5C5JA 2CQ4A 5H9EJ 2A2DA 5F3TA 1UVNA 3QMQA 4O44B 2CA9A 2QJ3A 4IDKA 2MQNA 4J9UE 3KG0A 1K73T 2KG0A 4HTJA 2GMLA 4CZCA 2W9BA 2MKCA 2C2KB 5C42A 2JH3A 1Q95G 5LL6d 4C8LA 4QOTA 4DUTA 3X1LB 1RTHB 3NCRA 3KK3A 3Q8YA 4B9SA 1N36J 2IJFA 2HNYA 2OEJA 3HFKA 3VV2B 4NLXA 1KQKA 1N5VA 4FF2A 3BGOP 3SMZA 5HLFA 5HK4A 2F65A 2KFYA 4F02A 3ENVA 2B0GA 4Y0FA 2CVIA 4NWBA 4M95A 4NI2A 1FRXA 5F8NA 5CYQB 1TUVA 2PT0A 2GVDB 3SSSA 1GMVA 5T14A 2LQJA 2DR7A 2XMMA 2GMJA 2K8GA 3JYTB 1E6VB 2R7OA 3FDSA 2LQ8A 2FJXA 3PM9A 1S0VA 2RE1A 1PG5B 2QC3A 2G1HA 3B82A 1IKYA 3ENAA 3TQEA 1KTQA 4C6AA 3LUYA 3G6XA 1S79A 2P6TA 4LR7A 2HFZA 2GAHC 4RNOA 5KG6A 4DR4J 2J9DE 4X2BA 5DGBA 4Y2CA 5G0RB 3D6FB 2D74B 2F8EX 3R2CJ 4EWTA 1SQEA 1OJ4A 3BBFA 2BRKA 3POTB 1HI0P 2HBQB 3QSYB 2PEHA 1AW0A 4HL9A 2AMCB 2B6AA 2CXEA 4Q0BB 3TJ8A 1IQZA 1C4CA 1LEOA 4LQ3A 2LECA 1ZTWA 1QE1A 3TWZA 2I1RA 1JMTA 5E3QA 3TA0A 3FVYA 3PRDA 3I5CA 3P5TL 3G9CA 3HKWA 2Z56B 5HBMB 3CWJA 2UV8G 4J9QA 3RB0A 4DR7J 1TL7B 4NEZA 5EX0A 3LO3A 1RT5A 5LMNF 5BXIA 4N41A 3GV5B 1EETB 1KSPA 1BWVA 4DSEA 2BUNA 3M1VA 4ZOSA 1DBDA 3GQCA 3ILIA 4QR0A 3RTVA 1U8SA 2HFVA 1C0UA 1U0SA 3HPOA 4AT1B 2B3TB 1S0NA 2ZKTA 2O3DA 4X4VA 4DQSA 3FQKA 5AJ3F 2GFFA 4M5LA 4NZ7A 3PDNA 1PAUB 1UVMA 2WB4A 1RAHB 1Y11A 1T05A 5AXKA 1CBKA 3UDCA 5GAHI 1GX6A 1OPIA 3PEJA 1Y00A 3PR5B 4RLEA 4K4VA 4DV7J 1TTHB 3IWNC 3W8GA 4LF8F 1WEZA 1VRUA 2U1AA 3EZOA 1JNRB 4WXOA 3TANA 1U6FA 3SQOP 4KPYA 4OI2A 3L7UA 4OZNA 3PACA 4X65J 3FBCA 3DKDA 5DDPC 1RJJA 2G0JA 2C3MA 4ED7A 4ZVSB 5HATA 3V81B 2BV3A 1T9VA 1XMOF 4QYRA 3QGPA 3IMQJ 3K59A 1EJ7L 4OJ1A 1CQNA 2UU9J 1NH8A 3GFHA 3ZZRA 4BLGA 3LP0B 3GPAA 2F4VJ 4LUBA 2G13A 1JLBA 1YK9A 1RLCL 1S6QB 4FNIA 5CD4A 2VFVA 3CD5A 3VAHA 4M5DA 2FY8A 2RRNA 4LSLB 3HO1A 2C3UA 5A8RB 2VG7A 3CTRA 2HPUA 2CQPA 4Z2XA 1RT7B 3ET6B 2B43A 4I69A 3UNYA 3PX0A 5T7LB 1IJFB 3H5XA 1RWNB 3H2UB 1I6JA 2BQ3A 3K7RA 4RW8B 3R5CA 3W8PA 4ZA1A 2UV8A 4F3MA 4DPTA 2V4RA 4RNHA 5KFAA 2ZM6J 4WFBQ 3U27A 3ISNC 1OYEA 2CQ3A 2E9TA 1S1UB 6FDRA 5K8NA 1Y9OA 1FTCA 1LXNA 4B9VA 3MM5B 2BANB 4JB8B 1Y0HA 2WSCC 1RCOB 4WU3A 2AD9A 1F60B 2L9NA 1DTQA 2KU7A 2ZJQQ 1YBTA 2BJ9A 3TX8A 1VQSA 2UUAF 2Q1LA 4B3MJ 3E8OA 1RTJB 4KGMA 2R7SA 2N3LA 2XS2A 4DL7A 1WC5A 1U45A 1SH3A 1UJ5A 2GJFA 4LF4J 4DUZF 4ILRA 1MMNA 3DFEA 2YQ1A 4UZBA 2KH9A 5KFBA 2Z2LA 4JYAF 3LPYA 2MQ8A 4WZQA 5KT7A 4JI5F 2W2NP 2HGNA 4G1QB 1I5OB 2OPQB 4DV5F 3KTQA 2RHSB 2RAQA 3MR7A 2VFUA 4ED1A 1G1XA 3N4WA 4OHXA 2QA4G 3M2UA 4TYBA 3GB0A 4USMA 1FTRA 3JQJA 5AT1B 3VVUA 2AGOA 2NREA 3K5NA 2JRSA 4O23A 1S12A 1GMUA 3SSQA 3CIMA 2WHOA 4NMLA 5H9FK 5L46A 2J7WA 1N5YA 2C2DA 2JEJA 2FVPA 1K44A 5EWEA 2LCWA 5GAGI 2OKQA 2ZVIA 4ZN3A 3MAAA 2G1DA 4OI4A 2XMKA 3KXDA 4JBCA 4JI1F 1ZBTA 5CCLA 1PBAA 2VQFJ 2W9AA 1EQMA 1UEKA 4CT8A 1XR5A 2PGCA 1JLCA 2JVOA 3C46A 4RWWA 5KFYA 1YWXA 2DNOA 2BVZA 5F9NA 3CCZA 3UNGC 4BBYA 4KPCA 2FC8A 3D68A 3FZBA 3THVA 2ROEA 4CQ1A 1K1SA 2KXNB 2IAJB 4FF1A 3OVSA 4MK9A 2ROGA 1RT1A 3D3CJ 4LF6J 1LW0A 1YX2A 2M2BA 1B7FA 3NGSA 4LVOP 1M1KT 1PSDA 1T03A 1Q7YT 3LW5C 1M5OC 3DLBA 2DPIA 4F4ZA 2XI3A 4RW6A 4K4SA 2V94A 2OFGX 4M1KA 3RBXA 4ZCKA 4I4BA 4DSJA 4FN5A 2HRYA 3CCUS 1JLGB 1SKWA 4DR6F 1WSRA 5KFUA 2E7WA 3GLJA 3EUNA 3CCWA 1WJ9A 2COLA 2DR6A 1S97A 2DYAA 2CQCA 3MGJA 3PW4A 4C7QA 1XQIA 1UWBA 1Y5NB 4XTTA 2UVVA 1PYOB 7FDRA 2MTLA 2OPPB 4OJHA 1DAXA 4ELVA 3GYNA 3C14B 3AQPA 3UE2A 2M0GB 1NO8A 3MEGB 3GFXA 3G6ES 1X7VA 1IKVA 3CJTA 4K4UA 1H2VZ 4NLWA 2GVZB 4WPAA 3SV4A 1OQ6A 1AXQA 1TKTB 2BEFA 4YMEA 3UFCX 3BS9A 2XMUA 1YJ7A 1G6BA 4B3TJ 3UD3P 1EARA 3PX4A 4DL2A 3DLKA 2E1CA 5GMKa 4FDFA 1R31A 1H0HB 2AF6A 4M5DB 3TQ1A 4NXMF 1X8DA 2ZDPA 1A7GE 2LKZA 4DL5A 2AP6A 1F0XA 3HULA 4IOAQ 3R5AA 1N6QB 4QYZK 1RTDA 4X62F 5GAEU 2B9YA 4U8VA 2NXUA 2XWXA 2UXCF 4LFCJ 1X4AA 3A1YG 5F0WA 4KFBB 5DJBA 4R8UB 2BABA 3EDRB 4CTAB 1N34F 4Y34A 3ENWA 4LRDA 1IKXA 1Q8LA 2KJVA 3MOZA 4JI4F 2AJQA 1DTQB 4LF2A 1DTTA 2HLUA 2YY3A 4ZPCA 4N5SA 3LAKA 1HWJA 3KLFB 2MKKA 2CNLB 1N4LA 3HT0A 5KFFA 3JQKA 3SIPB 1SIZA 3LGHA 3VAMA 3H40A 3HVAA 1Q4RA 1S4FA 4YOEA 2P6SA 3CO0P 2D3ZA 2XS5A 1HYSA 1M5PC 4C8ZA 3HMJG 2VA2A 1OIAA 2BJ8A 1H7WA 1HA1A 5E5NA 5DQIA 5IOLA 1X0PA 2BW2A 5KOWA 4QZVB 4MIWA 2FDNA 2FJDB 2BXJA 4UT4A 3MFHA 1C1BA 3PRVA 2DNKA 4E0DA 2BE7D 4RNFA 1OSDA 3BYPA 1RWPB 1FCAA 2XB2D 1FEHA 1S7IA 4YB1P 1WI6A 4FP9A 1AUDA 2A2CA 1ZZNA 4C8MA 5JUMA 3SV3A 2DBBA 2FJBB 5FDLA 3M32A 3OXLA 1FD8A 2AX1A 2QLWA 2J9DA 4DLEA 3W5XA 5IT0A 3MAAB 2V2VA 4NPOA 3PIOQ 4B3RF 1DY3A 3CJ0A 3UN3A 2IC3A 2XQCA 1F5BA 3MUMP 3OD2A 2V63A 3K5MA 2CJAA 1UP1A 2K1RA 2ERRA 5A8WA 2M7SA 5E3RA 3TP2A 1IBMF 4TY9A 1R8BA 1SKUB 2CPXA 1U1OA 3G8TA 5EDWA 4I7FA 3E51A 4MIBA 2W01A 2BW7A 4A8XA 3HVRA 4HDHA 5LSRA 5L1KA 4FXDA 4J90A 3J7YU 5B0CA 4X4RA 2UUAJ 4EBCA 5HVHA 1WKKA 6AT1B 4TLRA 4ECYA 4TQRA 3TUPA 2ZH1A 3BR8A 3CGIA 1FX4A 3KHRA 1YJTA 2WTFA 2NYHA 4CNYA 1RSCA 4JYAJ 4JI5J 1CJVA 2HAFA 1HFEL 3IG1B 4TXSA 3J7Z5 4DV5J 4AXJA 4UOGA 2NZCA 2DHSA 3NP5A 4USUA 1NAQA 4OFZA 2QV6A 2KT5A 4V19X 4RW7A 1NBEB 1HNWF 3BSCA 4EK2A 4ZVEA 2KJWA 5K20B 2XEXA 4AE5A 2DISA 4USWA 5HP1A 3MR3A 3BJYA 2FB0A 1MW7A 2OHDA 1BC6A 4U95A 2YKMA 5DRKA 2V8GA 1S49A 1KVIA 1SUQB 2J8AA 2V8PA 3NOGA 4U7UK 4CT9A 3GIJA 3DYAB 1JQGA 3MM7A 3N6LA 4K4XA 3TVYA 5CD4H 3SDEA 4KHRA 2LP4A 4HHUA 3H90A 1QUVA 4LF5J 5AXNA 4B3SJ 1WC4A 4ZPVR 4KQZA 4C48A 4JI1J 2JDJA 1JXLA 2Y3YA 5CH7B 3HDSA 2C28A 3M30A 4KBIA 3QQCD 1HBUA 1RTDB 2LXIA 4DR1J 2DO0A 3QT8A 1JWWA 4LIWA 3FGVA 1JIHA 4KKOB 4ZPTR 1FRJA 5C2CA 5GADU 2GGPA 2G0IA 5FJ4A 3PHEA 4KYZA 4B9MA 1FNOA 5C25B 3MI7X 1FDAA 2DY1A 1C1CA 2ZUGA 3OQ2A 4LF7F 2QYGA 2NZ4A 1MLAA 1GMWA 3I5AA 2ABYA 2HVHA 2ZZMA 3MTJA 4X66F 3UQSA 5HMWA 1P1LA 3V6KA 1DTTB 3CXCR 2EFOA 8RUCA 2RU3A 4Q44A 4Q45A 4B9TA 3P49B 2WSEC 1W26A 3KLIA 5KG0A 4O3OA 3F73A 3QT6A 2QA2A 4YDXA 3IM9A 5CYJA 5D4NA 2GIRA 1T9XA 5T41A 4TN2A 1WDTA 2ZOFA 1NKEA 3PG9A 3LP1B 4YHHF 3L4BC 2RB7A 3QO9A 3CVKA 4DXLA 3DRRA 2QLFB 1PC4A 2HNDA 4RUBA 2B4OA 2BOPA 4OMFG 2QEXS 1Q82T 3D1QA 1EP4B 2PMHA 3BGLA 5KAKA 5IQQA 4FBTA 2EWHA 4KH1B 1SJQA 1RTZA 4MFBA 4BS2A 8ATCB 3SXLA 2JWNA 1WC0A 4CDIA 1F5AA 3IS9B 4YP3A 2X7IA 1X9SA 2EFVA 1HBMA 2VC0A 2H5JB 4DQRA 5ETOA 5KFDA 4CO0A 3FEYB 4AL7A 1FO1A 4ETZA 4YY3F 1R89A 1NK0A 1K1QA 2MZJA 4DCOB 4DSFA 2R2TA 3V5RA 4IR9A 4NL5A 4NLOA 3T3FA 2WOMA 1D0EA 2Z57B 4HACB 2E7VA 3LGNA 3N79A 5J1PA 3LP2A 4ZVHA 2UXCJ 5KT4A 4JI3F 4NASA 3Q8SB 4ZKAA 1BQNB 2NXJA 1MU2B 1R8HA 3W2WA 2RQCA 2F8HA 2H9ZA 3PJXA 1CSJA 3OXGA 4PPDA 3MMAB 2GO8A 2Z30B 2DGXA 2OSQA 3ISZA 1RP5A 1YIJS 4AUKA 2MZQA 2FIUA 3KK1B 2Q79A 5CYMB 1VR6A 3GONA 1JK9B 1HQUB 1UVJA 1IWAA 3PYGA 4PR6A 1NZAA 2RMLA 1U1NA 4DSLA 2BR0A 5LJ3Y 4WFXA 2N7YA 2GX8A 1U0HA 1M90T 2KM8B 2E29A 4LRCA 1HNVA 4H4KC 2QA1A 3OUYA 2YVSA 4I0WA 3CCLS 3QAUA 2C42A 4OIXA 5LMUF 1SBRA 5D78A 5D3GB 2J0QD 3VTIA 3WX8A 3HZEA 5A0YB 5IM0A 2HMIA 4OZ3A 2XMVA 1W2BR 1SL2A 3D28A 3Q24A 1RT3A 1FK9A 2V9KA 4R5PB 3J80Y 1IM6A 1H74A 3ZZZA 3ZZYA 2KL8A 4A48A 2X3DA 3DDNA 4K4YA 2Y1JA 2VQEF 2E1PA 2FHMA 1WG1A 2RF2B 5AE1A 1T9UA 4DDFA 4OI0A 2CIMA 2IA0A 1NHVA 4B3RJ 2LEBA 2XMTA 5KG4A 2FJAB 2CQBA 4DUYF 4F8RA 2QGFB 1BQXA 3BH6B 4CLZA 2I38A 1NHKL 3OJUA 1VC5A 3BO2A 3J7A1 4PG8A 1CULB 4EYIB 1HMVB 2J0WA 2ZH2A 3RU0A 1F5CA 2D9OA 2MY7A 4LT6A 2LDYA 4GC6A 1VQ6S 4I2PA 4HKQA 3QYYA 4C8YA 3ENQA 3W61A 3QRRA 4F4XA 1TV6A 1TL3A 4EO8A 2OUGA 4O4GA 3M9MB 4WBFA 4AFFA 3KLEB 2M9KA 4C0BA 3N28A 2HVEA 3F0NA 2NPIA 3KLIB 3TJAA 5CQGA 2Q6BA 5MAOA 4RBVA 1PILA 1YBAA 2AZ1A 2CWKA 2R2SA 1A6LA 3WIUA 2CQDA 3W65A 3C16A 2XLJA 3NY0A 3AJ1A 3DU5A 1U7LA 4D3HA 4LFAJ 3KHGA 4C98A 2V34A 3QO9B 1WOPA 4MKBA 2C2OB 2N3OA 2NYIA 3L7OA 2VUGA 3PIPQ 3LQVA 3FC9A 4QPTA 3B8HA 1F2GA 1HNWJ 1Z4UA 4ZVPB 2PN6A 4YUDA 5KFRA 1ZETA 4LFBJ 2XULA 4ES2A 2MKSA 2ADCA 1Z2ZA 3I82A 1H2TZ 1PJ5A 3MECA 5L1JA 4K8RA 2W2QP 2LVWA 2KTQA 1NPRA 4PG5A 4P52A 3CCRS 1R43A 2MGZA 2XWYA 4OI6A 4DPOA 1N88A 5DQGA 3EGZA 2I5JB 1NJYA 4ZJQA 3LH2S 3BKUA 2O5DA 3OTDA 3IP0A 4PYDA 3FFIA 2APOA 2NR0A 4CO2A 2YQ3A 3R27A 3AB4B 3X3UA 5D0RA 2VFTA 4PXDA 1FJCA 1SKSA 4A8YA 2XMWA 4UW2A 3SBMA 2GIFA 3DCAA 3MUVP 3T5JA 2Z2YB 3Q8UA 4TQSA 2AEMA 4BC7A 4J9OA 4MJKA 4U6PA 2HZVA 3ZZPA 3HKZD 3M8PB 2XNQA 3JQMA 4ZHRA 1J5OB 3R3TA 4ZK7M 2R7XA 3TRGA 1Q16B 1VQPS 3I6PA 3LPEA 2AU0A 2HW3A 4I56A 4OX8A 1XNRJ 2M4MA 4X4SA 3W2WB 4ECQA 1JLFB 3M6UA 1K47A 4I2QA 4OZ1A 3K58A 2OPRB 3ETMA 2B7CB 3KUEA 3D5MA 2GHWA 5J2MB 4PUOB 2CNKB 3Q2TC 4Y6IA 2AV5A 3C6TA 3TZZA 1N52B 1IN0A 5C7PA 1KKHA 2FJWA 5ADZA 1U1MA 3NL0A 1TL4A 2MZSA 2NCKL 4YHHJ 1JKHB 1VBKA 2DKOB 4DV3F 1U24A 4YFUA 3OUYB 1TL1B 4H54A 1FRMA 5L1IA 5D77A 3CC4S 1Y10A 5KG3A 3CCES 1H3DA 4DPUA 5EWGA 4OV6A 5IM0B 2WB1D 3EVWA 3OTOJ 2AJ0A 4PEOA 3QZ8A 2EVZA 1HNIB 2U2FA 2PO4A 3AQOA 3B4MA 1IUJA 1XNQJ 2XC9A 2HFOA 5F8GA 4ECRA 2AIRB 3SZ2A 1JLQB 4C11B 1GTHA 2VD3A 4YN3B 2ADBA 2CNOB 2OFHX 2Q43A 3HZGA 4G1PA 3RYLA 1S99A 2DR9A 1RU2A 3I32A 4EO6A 2B9EA 4M5HA 2FHJD 3T5KA 1AB8A 5J2QB 5DLFA 4RNNA 2W8KA 5IS2A 2DITA 5KFIA 1HPZB 1QAYA 1ZPVA 3K17A 3P4UB 3CCTA 2GV1A 1RT2B 4ZITA 3DHWC 2PI4A 2DNGA 3GV8B 2P9EA 5K14B 2XY7A 1S57A 5IQ6A 4CLPA 3BDEA 1Q86T 2J6UA 1LXJA 5ETSA 1J27A 4JI3J 4ICLA 5ETQA 3TEGA 1VBXA 1VBYA 2VG5B 2GQQA 3WC2A 1RBAA 3VCDA 1BHNA 1HBOB 2CDRB 3WBZA 2YKNB 3D66A 2K2PA 4OX7A 3OLAA 1S9EB 3PJWA 5HVFA 4R25A 4B3OB 3W1YC 1P8GA 3GJRB 2HQ3A 1X4GA 3MPVA 1XMQJ 2HHQA 2WVEA 1U1RA 3CUNA 3G87A 3NXZA 3RB4A 4FPRA 2PI5A 4FYWB 5D0HA 4RW9B 5KTQA 1U6ZA 3EMTA 2YNFB 2OEMA 3QIDA 1APSA 1RXOB 4X84A 4GVBB 3ULHA 2BJDA 2RNEA 1B0TA 4FYXB 2DH8A 3A3OB 4ANDA 2CQ2A 2K06A 4N8OA 2CQIA 2X1GA 2ZD1B 3HVTA 1TVRA 5LMUJ 1NDKA 2E9ZA 1CG2A 3ETOA 1WF0A 3MFIA 4IFVA 2JHEA 4K4ZA 3EYZA 2MB0B 4KHMA 4RPFA 1TUGB 5KFQA 3SSRA 2JX2A 4L76A 3VHQA 2X1FA 1VRQC 2ZNYA 4WU2A 2MEWA 3LANA 2RHQB 4DF8A 3HSDA 4GC7A 1XMBA 3JTPA 1TZ0A 5DG9A 3DLEB 2W24A 2RUSA 2ZOMA 5M2RA 3QGIA 1FKOA 4LQ9A 2DNQA 1S1WB 3NGDA 2VQEJ 1OY6A 1R0BG 2B9WA 2QT7A 1XERA 3NNCA 1R0CB 3I4HX 2FGOA 3OLBA 4DQIA 2HK3A 4N8NA 2ZE2A 5U47A 3JTOA 1ROFA 1S1XA 4DR2J 4DSIA 2CPZA 4XO0A 3Q89A 5H9EK 3LAMA 4ZHRB 4OL8A 2YNIA 2E5HA 1IKWA 1WC6A 5LM7E 3TAMA 2H51B 5HROB 4WP3A 3HHLB 3OW2R 3AT1B 1V5VA 3S8SA 2QSFA 2YPYA 1XBWA 5LSLA 2HURA 3ZZOA 5IT4A 2N7CA 3T9ZA 4KHPF 1T8EA 3BH7B 3ZXWA 3W63A 1S6UA 1F9EB 4F4YA 3C6UA 3BGFA 3FKBA 4J37A 2K7JA 4CM0A 2HBRB 2B51A 4USIA 3T1YF 2BX6A 2DGSA 1J5EF 3CJ3A 2QL5B 4DX6A 1RWKB 1TKZA 2FVSA 2D7SA 3MM6B 3LWMA 1CLFA 2YWGA 2L41A 3TUZC 3K2YA 1YZ7A 5GAEI 2DY9A 3UW1A 1YTYA 3MD1A 5ETLA 4ETXA 3LF0A 2AYBA 3O1LA 4RW4A 5KFCA 3RR7A 1MN9A 1SC3B 1CJTA 4ZVQB 3CJKA 3UCZP 1SPBP 4B9UA 4NZ0A 2V68A 3SEOA 1NK8A 3DGPA 2DGWA 1KEKA 1HHQA 2I2YA 2OD6A 3NKYA 1URRA 1LW2B 3RR8A 4LMZA 1RWOB 1FT8A 1HLWA 2WVBA 3AD9C 4KTQA 4V19J 4HT7A 1UW4A 1NDCA 4C8OA 1VIOA 2VDHA 2EFPA 3V4MA 4QWBA 1RAJA 3O2IA 4TNOA 4L74A 3W5ZA 2E5JA 1U6BA 2W25A 4JI8F 2IVYA 2L48A 3HD2A 2GC8A 4EFAC 2FPHX 5I42B 1N5TA 2JEGA 1NCLA 1BXNA 4NLVA 2C3YA 3C8YA 2YNGA 1AZSB 1RHKB 3FEXB 2J0XA 2AJ2A 3CD0A 2ZWOA 1URNA 1J2VA 1RABB 3KK2A 1S1VA 1OY9A 1ELOA 1Y4ZB 1LWFA 2LXFA 3U1NA 1RHRB 5D4LA 4ZDNA 4HHJA 4ZLJA 2CQGA 3SFUA 2HNZB 3QZ7A 3K8WA 3M6WA 1X5TA 1GEHA 1TP7A 5H1SV 3PW7A 2EEYA 4Q8EA 1Q0NA 3DRXA 2PSZA 2BBEA 3FCVA 1SH0A 2JJ4D 1SVDA 2CYYA 3DI6A 2CAJA 2O67A 2EFQA 1TFWA 4OLPA 2E66A 4B02A 1JXVA 4P73A 2VBZA 1R8AA 1YJVA 4UY8T 1Q8KA 1SH2A 3DRPB 3OPKA 4EBEA 4DV3J 5HQMA 3M2RB 4DS5A 2ZWPA 2DGTA 2V6AA 5KFVA 2W4CA 1UWAA 4L73A 1T3OA 2DJWA 4G3IA 2MLXA 1N0UA 3ZTRA 1FWKA 3CNQP 3SFGA 1DFDA 2PMZD 4TU8A 3M2VB 3IR6B 2MQOA 3J7YI 3L3CA 3FBBA 4F25A 5A6PA 4H4MB 4MH8A 3TNVA 4A8WA 1NJIT 4P71A 3R1HA 2AKWB 3PX6A 4IR1A 4KR0B 3MM8B 3CC7S 2XHWA 1RYSA 5DG8A 1VQMS 1AFJA 3DOMB 4MMOA 2KO1A 1FVSA 2HRUA 3H5YA 3EJMA 1I3OB 2YXLA 1WD6A 1RDRA 3HF5A 2M70A 3I9V9 2N82B 4FF3A 1VHFA 1WHWA 2BKNA 4DV2J 2OTLS 4LRAA 3BPSP 4TYAA 4EUVA 2GMHA 4MAKA 3C66A 4Y2IA 1HNXF 4UY85 1QTMA 3I0RB 1SJ4P 1RTHA 3WX4A 1LOUA 4O3NA 2ZFHA 4Q5VA 3EWGA 1KLNA 2UUWA 2DVIA 1UVLA 3OJSA 2F1FA 3AH6A 1MROB 3ITHB 4TY8B 4M5GA 2FYXA 1VQ5S 1FWPA 1U1PA 2FJVA 2MHNA 1WNEA 3H98A 4EU0A 3ONQA 1Q8IA 4NLTA 3HFVA 2DHHA 4DFPA 3QBCA 3NLCA 2KM8C 3OR1B 5CYQA 4ECUA 2C3PA 1SJRA 1G4CA 5JMNA 4MK8A 3CD7A 2HVDA 1OSCA 3JYTA 1E6VA 1ZM9A 2WVFA 5GADI 4C4WA 2ZDOA 4X65F 3US5A 3Q23A 3CCSS 2XO6A 4F0HA 2VPXB 4DMZA 2QFIA 2H4WB 4X4NA 3PVXA 3TO8A 2XY6A 4FVCA 3P45B 4PZVA 1MMDA 3UO0A 1YRXA 4JP8A 3H25A 4U7CA 4CIOA 2F63A 2H1YA 4DV1J 1T94A 1RADB 5G0RA 2UU9F 1U47A 1P27B 2QLJB 4ENOA 3POTA 1BQMA 2F4VF 2B4UA 2VPYB 3D6MB 2VHGA 4QYZJ 2XYPB 2E5IA 1GMWD 1YITS 4CLUA 1WUUA 2DCLA 1HARA 4Q0BA 4YB7A 2HHXA 1S9GB 2MJUA 3PFOA 1TK0A 4C8KA 2DGQA 1Q81T 2XTJP 5D0EA 5F3ZA 3QGHA 3QT5A 1S9FA 3D54A 5HBMA 2UUBJ 2FLOA 1D09B 3UVJB 2VKRA 3RRGA 2X1AA 2EBEA 3UD4P 1TL7A 2VDIA 4TU7A 4ZPAA 2KRRA 4FS1A 3CJQA 2J7KA 3U7JA 4J91A 2EG1A 4ZPDA 1EETA 2QO3A 4RL1A 1WTBA 2DXDA 2M88A 7AT1B 2VU5A 4HLBA 4RO0A 2V50A 2HHUA 3R7SB 3V4IB 4CH7A 4B3MF 3MDFA 1SB6A 3H0PA 5EHHA 4LF4F 3MEEA 2HHTA 4Q2LA 4DPWA 4MYTA 5IT9U 3KLGB 2WONB 3GV7B 1RAOA 9RUBA 2Z2ZA 1UFKA 1RT4B 2G9OA 1FDNA 3NMRA 4OZ2A 4Q8FA 1DJ0A 4CI0B 4X4TA 3WQPA 3R5BA 4G6VB 1WELA 4OX9J 4PG6A 1X4DA 2KZZA 3V81A 4WZMA 5DLGA 3FSIA 1T7PA 1FDDA 2C1EB 4L3NA 2RSQA 3LP0A 4P74A 4JV0A 3QRQA 4WFYA 4A8SA 3JSYA 3Q83A 4QU6A 3R6GB 2BMBA 3J81j 2Q3PA 1S6QA 4GMKA 2HS0A 3NRBA 3PYFA 4H4OB 3CDUA 1OWXA 2R7RA 1TMJA 4W98A 2DR8A 4A46A 5A8KB 5AXLA 4LSLA 4DCPB 5A8RA 1R8PA 2SXLA 5B0GA 4IQMA 1RT7A 3ET6A 3BB5A 3RBEA 2H4YB 4CRJA 5T7LA 2HEKA 2QG9B 3UR3C 2RDIA 2VASA 2BZ2A 4RW8A 3CCMS 5HVGA 1WSVA 2OJ3A 3I0SB 4J7CA 2XBPA 3ZTPA 2XSJB 3P96A 4F26A 2IY5B 1TKXB 2MPUA 1S1UA 3MZIA 2J6TA 2J76E 2RU9A 1F9FA 2BM0A 4KGZB 4LF6F 1RHMB 3A8JA 3MM5A 2BANA 3CJ4A 2XI2A 2E1AA 3TZYA 3D7SB 5KT2A 1N0VC 1PCAA 2VJVA 4JI2F 4OYAA 3DOLB 1F1BB 3KHHA 2O01C 1U26A 4MTPA 1RTJA 3J81Y 4OYXA 5CXTA 2GJIA 3MR2A 3D67A 1R0AB 3FQLA 3TJ9A 2MJNA 2A6OA 2VG6B 1TELA 3DLGB 2CQ1A 3S6EA 1BE4A 4QIWD 4JI0F 4KSEB 4G1QA 2OPQA 5IC6B 5KFZA 2VH7A 2UXBF 3W9HA 4DN0A 2IDLA 3HSGA 5HQ8A 1OMSA 1FKPB 3UR0A 4ILLA 2DPJA 3H59A 1HWIA 2Z0GA 3TAPA 1NMEB 4KO0B 2QL9B 4ZVOB 4A8OA 5J2PB 5ETMA 4CLFA 2ZBCA 3VAFA 1AFIA 1DQ9A 2NXEA 3VGSA 2MY8A 2FQQB 2W4PA 3D0GE 3HHDA 5L38A 4DX8H 1WEXA 3TW0A 1DLOB 3UN2A 1BQMB 2Z4PA 3HJFA 2YX4A 2FUG9 4UOFA 3OVBA 4USJC 3DRYA 4P6QA 3R6LB 4B3TF 4DG1B 4ZS6A 4NCGB 3F41A 4ZN1A 3PXGa 5A2QY 1YJWS 3GCWP 1A0OB 2HWIA 2MQPA 1VYAA 4GRSA 2ZEJA 4NLDA 3SCJE 1HHTP 1EB0A 5E3CA 1H38A 3BZQA 1W25A 4NZ6A 3BQ2A 3VF0B 5EUHA 2H3EB 4LFCF 1CC7A 1ITPA 4C3MA 3A3PB 3ILJA 3MEDB 1HNXJ 4X4QA 4ZCIA 2IAJA 3MEKA 1KVJA 3EGVA 1NSAA 4K4WA 2GW8A 1CVJA 1HWUA 4P10A 2WW8A 2LQ5A 4OYWA 5DQHA 1SC1B 1RWWB 3VR1A 1JLAB 2AJ1A 3SCLE 3MEEB 3FRZA 2JC0A 1ZAVA 3MXHP 4EEYA 2CJXB 1YJRA 2GS8A 1QVGR 1JLGA 2XZTB 1S1TB 1GQEA 4NRTA 5HJYA 1KOHA 2HHWA 1FFSB 3NWGA 4M5JA 2WBMA 2CPIA 1F3FA 3KG1A 3IRXB 2HWTA 3IWLA 3IWXA 2ASDA 2M3DA 2OPPA 2X1BA 1PAEX 1I94F 4DQPA 4IH6A 5JJBA 3C14A 4WXWA 1KRPA 3MEGA 2YWWA 1HQEB 5B0DA 4AQYJ 2FVCA 1TL5A 2L9DA 3GYXB 1YI2S 1RHUB 2GVZA 2A1BA 1TKTA 1S59A 5ETTA 3MHYA 3ISND 1LFWA 4RR5A 3M05A 1V3RA 1NEEA 2VFRA 1S4EA 4FYVB 4DL3A 2DEJA 1LKZA 2GQCA 4IG0B 1R8CA 2CPYA 5DZ7A 1N6QA 4P2FA 1VQ9S 1KNZA 2J5AA 1K0TA 3HHLC 4C8NA 1HKAA 3KDOA 3R8YA 4G1IA 4X4UA 3BGRA 2C2ZB 3NGKA 5B0FA 3MPDA 2R9LA 4O0IA 4RNMA 4KFBA 4R8UA 3SYZA 5IFMA 4CTAA 2IVFB 4B17A 1QSLA 1T11A 1VIXA 5CZXA 2XNRA 2ALYB 3H5UA 2G2YA 4NLSA 2BKPA 3CSKA 2XZWA 2KDOA 5BYSA 3Q22A 3ZZ0A 4WIQA 3M6VA 4HVZA 4YDDB 4F7VA 5E7OB 3KLFA 2DXFA 3T5LA 3U1LA 4L6V3 2QN6B 1KLMB 2IRUA 1X5SA 2Z2MA 2AWZA 3OTEA 1NK4A 3M7VA 4MKYA 2DIUA 1JXEA 4LBIA 4DV0J 5KFOA 1N54B 2EG2A 3VZIA 4IRKA 4LF9J 1S76D 1U2RA 5IV4A 5I3UB 3UDVA 4YR0A 1R6YA 1RZMA 3HFZB 4O3QA 1QTNB 1WKLA 1HBNB 3H4DA 3Q8QB 2V8HA 1KFDA 1VQ4S 3TVKA 1V5IB 1SCJB 4ED6A 4B9NA 2H48B 4BDPA 2OO4A 2KYZA 3M6XA 5KG5A 2JSXA 3JTNA 4ZP8A 1TU0B 4DI6A 3B6BA 4NA1A 1UJ4A 3AOBA 2JFKA 3Q8VA 2HS3A 5FLXU 4M94A 5KT6A 2Y8WA 4F3QA 3PTWA 4UQTA 4AL6A 1GXLA 1K8AT 4LF5F 2FZGB 4B3SF 4QJVA 2OSRA 2YWFA 5ITHA 2LU1A 4C2MA 3IGNA 3BO4A 1YQHA 4OQJA 1AYEA 2VICA 4Q43A 3A3NB 4DR1F 4X4OA 4MKVA 2DB1A 2R7QA 3RRKA 4NLUA 1FRKA 2VPWB 5D0GA 3MD3A 3ILLA 1ZM4A 1ICEB 1NSKL 3H20A 5CHCB 5BJRA 1M1GA 1VC0A 2CQHA 5DS7A 4WF9Q 3NMAA 4LF1A 1B4SA 1RE1B 1Y5IB 4JI2J 3RAXA 1C0TB 2DNNA 5C24B 4QW8A 1S6PB 3NS5A 4ZMMA 1IR2A 5ETRA 1YJUA 1SL1A 1NDPA 1KTVA 3RRHA 2LFVA 4CYUB 5K8MA 3D1HA 4P7TA 4JI0J 3IG1A 4EZ6A 3NNHA 2UXBJ 1KHVA 3Q8RB 1TAUA 2W2OP 3OBIA 2FD2A 1PJ7A 4QBUA 2IM3A 3MMCB 3PEHA 2J7UA 3JSMB 2L08A 2W7OA 4FXWA 2MKIA 3I96A 1KDNA 3O6QA 4WTOB 5JXSA 3IXQA 5E33A 1C2PA 2KVQE 3N5FA 1U09A 4JI7F 1GT8A 4NCBA 1R3NA 1X4EA 4F04B 3Q2SC 1UPMB 2W9CB 2ZHBA 1X4FA 1SUQA 5F8JA 1NLKL 4LBPA 3DYAA 4ZLNA 1HD1A 2DRAA 2GJ2A 1S6OA 2ZH4A 4DBQA 4UZCA 3EZ5A 1VS3A 4KGKA 2YWEA 2GHVC 3HD1A 2MSSA 3GTYX 3MM9B 1M5VC 4J9MA 1VRTA 1NUEA 1NNDA 2CADA 1PIEA 2OEKA 4KKOA 5DDQC 3BGRB 2QE5A 4RU2A 4RJVA 1D1UA 1PYTA 1U1LA 5KFHA 5C25A 4ED3A 4AYBD 2RKIB 2DNLA 5DM7Q 2Y1IA 5D4OA 1WACA 4ID5B 3DDKA 1EAYC 4NCAA 1IBKF 3BM7A 4I68A 2ZVSA 3KJNB 4PYAA 3CD6S 2YWKA 3DMJB 2C22A 4ED4A 3CULA 4A47A 2FLNA 3RG6A 1UJ6A 4Y00A 1KN6A 2KT2A 2ZH8A 3QFHA 1B0PA 4GKJF 4NLQA 3LP1A 1WHVA 1SC4B 3G8QA 4ECXA 1U25A 3NGTA 1V3ZA 4YB5A 1B99A 3ZTQA 3IN5A 2VB6A 3M8SA 2ZH3A 5KOXA 1RBLA 1WF1A 1FXRA 2R7WA 2YX7A 4QWDA 2RQMA 3ZO7A 1KQSR 3KMSA 1TKDA 2NS1B 3CE8A 1VQYA 1N32J 1RWXB 1XC9A 1CS4B 3L09A 1EP4A 1AT1B 4ITSA 2XLKA 3I56S 2A6MA 1I94J 2XCPA 3DOKA 2P9GA 4OHVA 4WYWA 3RW7A 2RVJA 4WP8A 2XGQA 1BWEA 5K5MA 3HJVA 5DG7A 1NU4A 2HQGA 1JX4A 2DHGA 2XLIA 3IS9A 2DXEA 3J7ZT 4L75A 2LA6A 3KYLA 4N77A 2K3IA 3M8QB 2F40A 4YR3A 4F4AA 4WCEQ 3QLHB 1RQ0A 5DETA 1T3NA 4N56A 5BR8F 4WYLA 3GMGA 4LRBA 1N8RT 1CJKB 4N7TA 4MK7A 2W4DA 2HFNA 1QJHA 4J9KA 3H4BA 1VOMA 2EK1A 5JVHQ 2HQIA 2RT3A 4URSA 1WDDA 1WTFA 2KXHA 3HLUA 4HACA 4PXBA 4N47A 2ZBRA 2B5JA 1UETA 2VV5A 3G82B 3I4PA 3AODA 1BQNA 1MU2A 1UZHA 4NLRA 3VAJA 2ZH5A 2RD5C 3S7RA 4HR2A 4DV6F 2E1MC 2UZAA 3MMAA 2F7VA 4PQAA 1L3VA 3KK1A 5CYMA 2HQCA 5J2NB 2EBGA 2BYCA 2AW0A 1YJ9S 4DLGA 1IWGA 1KONA 4CLSA 3EX7B 1HQUA 2V4JB 4LFAF 4W4MA 3C15B 3VZHA 2JLGA 2LYVA 5IXUA 5KT5A 4IUFA 3QJLA 3V6JA 4DL6A 2ASJA 5CZVA 1LWEB 3DC2A 4OHYA 5D3GA 1N33F 3O44A 4E2FB 4IFYB 1BMQB 4OYOA 3PJ9A 4NXNF 1FERA 1JJCB 3NBPB 5A0YA 4LFBF 2ZH9A 2AGPA 2V0NA 1RA6A 3HHEA 3G4SS 2FZKB 3BDPA 3RGIA 2JLFA 4R5PA 3VAIA 2ZITA 1SKRA 1UVIA 1RI7A 5GVQA 3FJ2A 5LSOA 2KT3A 1PYSB 3LOUA 1REVB 4K59A 2RF2A 3PYDA 4C9DA 3FRYA 1JB0C 2YNHB 3PR4A 4KV8B 4NE9C 1EZZB 3DM2A 2PFFB 1WI8A 2LMIA 2VL1A 3VAGA 2OTJS 4C3KA 2QTWA 4NYOA 4ZLLA 3T1HF 1B0VA 2VZ9A 1VRTB 2CPDA 3CJ8A 1U49A 1S0MA 3T19A 2JNJA 3GG0A 3PYEA 1CULA 4LREA 1HMVA 3IC1A 1IBLF 3W66A 2Z58B 4PWDB 1IR1A 1M5SA 4PCQA 1LNQA 3GIRA 2NUUG 2C3OA 1T95A 2M52A 2FLLA 1NZ8A 1XNRF 3ICLA 4KIAA 5HN0A 4LIRA 2LQ9A 3QIPA 2AYGA 3C19A 4FYYB 1KFSA 2IJRA 3KLEA 1HW8A 3VAKA 3P5BP 2OGUA 2D69A 5AE3A 1L3SA 1RACB 2HFSA 3MMBB 2QSWA 1Z2LA 4USVA 2H54B 1KQGB 3SCIE 4ED8A 2VKZG 3IO1A 2OD4A 5B7WA 2PC6A 2XCAA 2AYMA 4IG3B 3SQGB 1NHUA 1JLEB 1U1QA 1FRHA 1N5SA 4F50A 1SQFA 2BRLA 2CJBA 1IR0A 3FSYA 2DO4A 2IA6A 3N6NA 4ZCLA 1RWVB 4YS2A 2E9RX 3OTOF 4JI7J 4ECTA 4ELUA 1RAFB 4ID8A 2WK4A 1W7WA 3DOKB 3FUYA 4AXIA 2GCFA 5B0AA 1XNQF 2V4QA 2BM1A 3M9OB 2E5LF 4CLKA 4OLOA 3W62A 2VONA 4WFZA 3DLLQ 2I5JA 1A9NB 3KHLA 3E01B 2CG4A 3G96A 2JEIA 2NSBA 2C2RA 1EQ0A 5LXRA 3BBCA 3TZXA 5FIIA 3BQ1A 2QMWA 2RJZA 5DGAA 4M8LA 2Y9HA 4L3KA 2AEFA 1TQLA 3AOCA 2G4BA 3CB4A 8AT1B 1MN7A 4L72B 2DGOA 3V6DA 2G2OA 3M8PA 3BN7A 2Y1RI 3DRSB 2IM1A 3M8WA 1CJUB 5M2UA 4V1Ak 3CCJS 3KJVA 2B5JB 1J5OA 3VGUA 2P5VA 5L39A 4LRFA 4K0KJ 3D6TB 3ILOA 5HI7A 2CKWA 5J1EB 4QIVA 2NPFA 3PY8A 4QWCA 1JLFA 3KNGA 3T9NA 1E6YB 2BA9A 4HH1A 1D3WA 4CLYA 2OPRA 5D4PA 1IBKJ 1UFLA 2ZHAA 2PA3A 2R2UA 3RW6A 1LWCB 1U2CA 3MCSA 2MMYA 1XMQF 1X9MA 1L5UA 5J2MA 4PUOA 4HYKA 3BKTA 2HIYA 1VQOS 2KYXA 4WE1B 4WK3A 1UW9A 4DU7A 4GKJJ 2ZZNA 4ZIVA 2BE2B 1JKHA 1QLNA 3HK2A 2QMUB 1TL1A 2LEPA 2ROPA 1FDBA 1UMJA 1RISA 1VLOA 1VI7A 1OO0B 3GSDA 4NX9A 2R7UA 4URQU 2LU2A 4IOCQ 3IAM9 2HQDA 3CMES 2IYGA 1YG0A 3KLHB 3PCOB 4PWUA 1Q5YA 4UUXA 3DXSX 2V67A 1HNIA 1NSQA 4OHWA 2ZJPQ 1SIWB 1EHWA 2AYEA 4HI2A 3GYGA 4UOCA 2B8PA 4BHQA 4FNHA 1KOOA 1JLQA 4C11A 3S1TA 3UCGA 4Y2KA 4GVLA 1IJEB 3F56A 3CW2C 5J2QA 3M4XA 2H65B 3CPWR 2IPOB 2VF3A 2KG1A 2HWHA 4IDKB 1HPZA 3G6VA 3KNAA 5B09A 3NOCA 3DM2B 2R8IA 2ZC3A 1RT2A 3KKFA 3R5GA 2W9BB 5BR8J 2RRBA 4ES3A 5C42B 4AD6A 4DR2F 3MR5A 5HL7Q 3I5BA 4R0JA 3GIKA 3BKFA 4UF4A 1N56A 5K14A 3RUBL 1H98A 2DR5A 4ZPBA 3CMQA 2PDAA 2XYGB 5FD1A 5ETVA 2ZH7A 3MOJB 4ZPWR 4Q2MA 3KK3B 3DU6A 2HNYB 3NNAA 1RKJA 1HI8A 1NJWA 2FHJA 3N6MA 1S5ZA 3KJFB 3QT7A 2HHHJ 4NRUA 2VG5A 3QATA 4CWBA 2XG8A 3QIPB 4RKUC 2NXCA 1GAOA 5HLFB 2RUGA 4DV6J 1HBOA 1Q1KA 2XMAA 2YKNA 3T1AA 2F3JA 4NI2B 1S9EA 1REGX 4DL0C 3GFZA 1ZYQA 1RKIA 4B3OA 5L9XA 2ASLA 4HH0A 4OZLA 3E2EA 4DPXA 1XJWB 3AD7C 1FF2A 1GNKA 4WK1A 4RW9A 3GILA 1RHQB 2YNFA 3H2VE 3IFEA 4GVBA 4PQUA 1IKYB 4WFNQ 3U1MA 2HZCA 2OMLA 2ZD1A 4OI3A 4PXEA 2Y0SD 4M5MA 4DL4A 3LGMA 1N33J 3R7BB 5KT3A
chains in the Genus database with same CATH topology
5HP1A 4E98A 3PW0A 1KR4A 2A3JA 4PG6A 4XPEA 1X4DA 1VQLS 2KZZA 3MR3A 3V81A 2B9XA 3BJYA 1RT6A 4WZMA 1VQNS 1QUPA 4W92B 5DLGA 1HNZF 3FSIA 1ZOTA 2FB0A 1MW7A 3MF5A 4JV5F 2KN4A 1S10A 3K8VA 1QY7A 3HM9A 1BC6A 1P9QC 1T7PA 1FDDA 4L3NA 2YKMA 5DRKA 1XTZA 2E1RA 2V8GA 1S49A 4C3LA 3B78A 1KVIA 3BSOA 1SUQB 2J8AA 1M5HA 2RSQA 3GE9A 3LP0A 2B6AB 1QM9A 4JV0A 2VA3A 5F41A 2OPSA 4RWXA 4U7UK 4CO3A 4WFYA 4CT9A 5K8PA 1DURA 3DYAB 3TUJC 3GIJA 4A8SA 3MM7A 3N6LA 3JSYA 5K9FA 2KXFA 4K4XA 4QU6A 3DLEA 1RA7A 3TVYA 5CD4H 4C97A 3SDEA 4KHRA 2Q3PA 1QE1B 4F2RA 3N9UC 1SJ1A 1UA0A 1S6QA 4GMKA 2HS0A 3NRBA 3VALA 1QUVA 3PFEA 3TI0A 4OZ0A 1S1WA 2HYIB 5AXNA 4GO7X 4H4OB 3CDUA 1CQMA 1OPZA 3N5BA 1OWXA 4ZPVR 4KQZA 2R7RA 5DO2A 2DR8A 3CCVS 4A46A 2JDJA 1JXLA 2IM2A 5CH7B 3HDSA 5A8KB 2FVRA 5AXLA 3K5OA 2C28A 3M30A 4LSLA 4KBIA 3EGWB 3M8QA 3S01A 2UP1A 5A8RA 1JNZB 6FD1A 1HBUA 1R8PA 2SXLA 3CJ5A 5B0GA 3GR0A 1RTDB 3QLHA 2CZ4A 2LXIA 4IQMA 2DO0A 2R4FA 2DNHA 1JWWA 1RT7A 4LIWA 3BB5A 3FGVA 3RBEA 1JIHA 1NJXA 1RT5B 3BEGB 4KKOB 5T7LA 3CDEA 4KE5A 2M5YA 3UR3C 2E7XA 2RDIA 4ZPTR 1FRJA 2VASA 2BZ2A 4RW8A 3CCMS 2IFXA 3V6DB 5GADU 2OJ3A 2GGPA 3I0SB 2BQUA 5FJ4A 3PHEA 3M1VB 3UI3A 2XBPA 4B9MA 1FNOA 1UVKA 4QR2A 2XSJB 3TA1A 3TR5A 5C25B 4RUHA 3MI7X 3P96A 1FDAA 4HI1A 4ICLB 4F26A 1TKXB 3KJVB 4DHVA 1YGYA 2MPUA 1Q8BA 1C1CA 1PO6A 2ZUGA 1C0UB 1FE4A 3FMWA 3OQ2A 4LF7F 1S1UA 2NZ4A 3MZIA 2J6TA 5HROA 1N36F 2J76E 4A8FA 2RU9A 3I5AA 2ABYA 3HHLA 1F9FA 2BM0A 3R5DA 4LF6F 2ZZMA 2HVHA 3MTJA 2O1PA 2RILA 2BANA 1UL3A 3MM5A 4Y28C 3UQSA 3CJ4A 1P1LA 5HMWA 4X66F 1NK5A 2XI2A 3PV8A 1X5OA 3BR9A 2E1AA 3V6KA 1QAXA 3RB6A 5KT2A 4ED2A 1DTTB 1N0VC 2D1CA 3CXCR 2EPIA 4OHZA 4JI2F 3DOLB 2EFOA 3RAMA 5SUHA 3TOQA 3MR6A 1SL0A 3AJ2A 3G8SA 1Q53A 3W2VB 2MQQA 2RU3A 3KHHA 4Q44A 4Q45A 1VC6A 4B9TA 2AQ4A 2O01C 3P49B 2JEFA 1T05B 1U26A 2WSEC 4MTPA 1RTJA 4XDCA 1RWUA 3QJJA 3KLIA 3J81Y 5KG0A 4O3OA 3F73A 4PXCA 5CXTA 2GJIA 3MR2A 2QA2A 5I3QA 3FQLA 1R0AB 4YDXA 5CYJA 5D4NA 2GIRA 2MJNA 1HWLA 4LVNP 5J2NA 2VG6B 5T41A 3DLGB 4WIIA 4TN2A 2IBOA 2CQ1A 3FMBA 1QVFR 5M2PA 3S6EA 2ZOFA 1VRUB 1NKEA 4MYUA 3LP1B 4QIWD 4JI0F 4YHHF 4KSEB 4G1QA 3MM6A 2MQMA 2MYFA 2OPQA 2RB7A 5KFZA 2V4JA 2VH7A 5KFNA 3QO9A 3CVKA 4CCHA 3DRRA 1D9AA 2UXBF 2D3UA 4DN0A 1O51A 1O5JA 1PC4A 5HQ8A 1FKPB 2XS7A 2HNDA 3UR0A 3HVTB 2Q66A 4ILLA 1TVRB 2DPJA 2QZ8A 3H59A 4FYDA 1HWIA 2Z0GA 3TAPA 2KFNA 4DN9A 4DS4A 1UEUA 5HMZA 3TAQA 2NSCA 4KO0B 1Y3JA 3T5HA 4A8OA 1LWEA 4UQGA 4K5SA 5J2PB 5EN1A 2B4OA 2BOPA 4OMFG 2NLWA 2QEXS 2GNKA 3Q8PB 3QWUA 4RUCA 1S0OA 1Q82T 4OX6A 2ZBCA 4J9RA 4M63A 3VAFA 4DR4F 1AFIA 3D1QA 1EP4B 4IFVB 1IQTA 2PMHA 3BGLA 3EGNA 4IFYA 1DQ9A 5KAKA 5IWAF 2XO7A 5IQQA 4FBTA 2EWHA 2MY8A 3OTCA 2M8HA 2ZKUA 3NBPA 4DQQA 1D8YA 2YKPA 1LW2A 1SJQA 1SV5A 4NYPA 4WKYA 4TU9A 1VK3A 2W4PA 2AX0A 3D0GE 3HHDA 3JB9k 1UAWA 5L38A 4DX8H 4J9PA 2WBRA 1WEXA 5F8IA 1FD2A 4I6WA 4MFBA 3TW0A 4RBTA 2EK6A 1DLOB 2AJFE 4BS2A 1BQMB 4ILMA 1JLBB 2Z4PA 3SXLA 3UCUP 2JWNA 3HJFA 3T6JA 2YX4A 2UVWA 2FUG9 4X4PA 1FKOB 3OVBA 4USJC 1F5AA 3IS9B 4YP3A 4B9LA 4JV1A 3DRYA 4P6QA 1FA0A 2ATLA 1U1KA 2HAIA 2DNPA 1X9SA 4B3TF 1ZAWA 4DG1B 7FD1A 4ES1A 2EFVA 1HBMA 2VC0A 4NA2A 4ZS6A 4NCGB 4DQRA 5KFDA 4I6YA 5SZTA 4CO0A 1REVA 3F41A 2IMOA 4EGLA 3MTKA 5MLCV 3FEYB 3PXGa 5A2QY 1YJWS 4AL7A 1FO1A 2HWIA 2ZC4A 2ZE2B 2MQPA 2VG7B 3PKMA 4ETZA 4YY3F 2FVQA 1R89A 1NK0A 1RYRA 2QFJA 4O44A 1K1QA 2MZJA 2QMXA 4QIEA 4BCAA 4DSFA 4I1TA 2YNHA 2R2TA 3V5RA 4KV8A 4IR9A 4DFMA 2VOOA 4NLDA 2D9PA 2HS4A 4NL5A 4DR7F 3SCJE 2EKYA 1HHTP 4NLOA 5HMYA 1S1XB 3PO4A 4BC9A 5KG7A 3T3FA 2CVEA 2WOMA 2CJQA 3HI9A 5I42A 4ED0A 4HT5A 2VOPA 3MPYA 2ZOGA 5E3CA 1D0EA 5KFPA 1H38A 3BZQA 1W25A 4NZ6A 2YNIB 3BQ2A 3LGNA 4MIAA 2LEAA 3N79A 1IKWB 5EUHA 3VF0B 5J1PA 3V6HA 4UUWA 3TAMB 3M9NB 4DV2F 1VGYA 4LFCF 2P9CA 1CC7A 3LP2A 4ZVHA 4C3MA 3OHAA 5KT4A 1SXLA 2MHEA 4CO4A 5KFWA 3MEDB 4JI3F 2F9DA 1LQ9A 1H6KX 4ZKAA 3Q8SB 1Q79A 1BQNB 4X4QA 4ZCIA 3FEZA 2B7BB 3IRWP 4PWDA 2IAJA 4AL5A 3MEKA 1MU2B 1KVJA 4F4WA 4WTYA 1R8HA 2MZTA 4K4WA 3K5PA 3AA8A 3W2WA 1GX5A 2RQCA 4K0KF 2F8HA 4KAIA 1KC8T 1FRLA 2GW8A 2H9ZA 1DZ5A 1CVJA 1WG4A 3PJXA 1HWUA 1CSJA 3OXGA 4CNZA 2HNZA 4PPDA 3MMAB 2GO8A 1DARA 2WW8A 5CA5A 5KFEA 3KMQA 2GHPA 2LQ5A 3C6UB 2R8KA 2DGXA 4FXVA 2OSQA 1FESA 3ISZA 3CF5Q 1RP5A 2R7VA 2RQ4A 1YIJS 4AUKA 2MZQA 2FIUA 3KK1B 5DQHA 2Q79A 5CYMB 3AB2B 1JJ4A 3HX9A 1ZH5A 1QAIA 1IM4A 1JK9B 3BSAA 3VR1A 1JLAB 1KQFB 3PKYA 2RH3A 2YKOA 3DLHA 2AJ1A 4XDDA 1TKZB 3SCLE 1HWKA 4FF4A 3MEEB 2CPJA 4ZP9A 1HQUB 4DV7F 5E3AA 2YWHA 3FRZA 1MMLA 2JC0A 1CEZA 3ZZUA 1UVJA 3MMBA 2PIIA 3I9ZA 2KHDA 1ZAVA 3OTBA 4PR6A 3MXHP 1NZAA 3EZUA 4EEYA 2RMLA 1YJRA 3AAWB 1U1NA 4DSLA 2BR0A 4NA3A 5LJ3Y 4WFXA 2N7YA 2GX8A 3RZAA 1M90T 2KM8B 3K5LA 4RW4B 4RX6A 3M2UB 3OR2A 1SJFA 2E29A 1HNVA 3UDLA 3PNIA 1JLGA 1QVGR 4H4KC 5L1LA 4PQUB 1NRKA 2QA1A 3OUYA 1S1TB 2HHSA 2UUCF 3CJKB 2E5GA 1GQEA 1MSWD 2YVSA 4I0WA 4IRDA 4K5RA 2QA4S 2XMJA 3SCKE 3CCLS 3QAUA 2C42A 1KOHA 4NRTA 4GO5X 4OIXA 5KG2A 5LMUF 3C2PA 4IG3A 5HMXA 1VQ7S 2DHAA 3DRPA 1SBRA 5D78A 3SQGA 5D3GB 3NWGA 5E2QA 1JLEA 2WBMA 4JI6F 3OV7A 1QSYA 2CPIA 1NK6A 1S48A 2J0QD 3M2RA 4QPXA 4TKTA 1O0PA 1ZTTA 3VTIA 2DH7A 2OAUA 3KG1A 2VPZB 3HZEA 3IRXB 2HWTA 4NOHA 4IQXA 5A0YB 3IWLA 3IWXA 2OMOA 2ASDA 4DF4A 5IM0A 3OFGA 2HMIA 2VBWA 3WC0A 1VBZA 2M3DA 2XMVA 3MAQA 1WEYA 2OPPA 2PD1A 2X1BA 1X9WA 1W2BR 1FHTA 3OXFA 1SL2A 4DSKA 1I94F 3D28A 1PC5A 4LJMA 4DQPA 4IH6A 5JJBA 2R2RA 3GG1A 3Q24A 4A8QA 1RT6B 4WXWA 1GH8A 1RT3A 1N5YB 4DV1F 1NKBA 1WF2A 2W7AA 1FK9A 3CMAS 2V9KA 4R5PB 1KRPA 3M2VA 3J80Y 1Z1ZA 1Q7LB 3MEGA 1HQEB 1V9OA 3ZZZA 5B0DA 2FVCA 5I4MA 1TL5A 2JC1A 2R8JA 2L9DA 3ZZYA 3GYXB 1YI2S 4H4MA 4A48A 4YEAA 1VK8A 2LQBA 2OPSB 4DJBA 2A1BA 2QIFA 4PRFA 3CDWA 3EPGA 3DDNA 1TKTA 2F9JA 3MM8A 4K4YA 2CPEA 5CCMA 2VQEF 2Y1JA 2JZ5A 2FHMA 4YB6A 3MHYA 1N48A 2I8EA 1WG1A 2RF2B 3ISND 1LFWA 5AE1A 3M05A 1V3RA 3E01A 5F9LA 4DDFA 1I1GA 3OL9A 1NEEA 4OZJA 4OI0A 2VFRA 2IA0A 2CIMA 1G3OA 4DFJA 1D8ZA 1NHVA 1JLCB 3DOMA 2LEBA 2XMTA 4DL3A 5KG4A 2FJAB 1LKZA 2GQCA 2CQBA 3W3SA 2IBKA 2JOQA 5I3PA 4IG0B 1R8CA 2CPYA 4ZP7A 2UUBF 3VQTA 2MKHA 4DUYF 4OJ3A 2GIQA 3GWCA 1N6QA 4KT0C 2YNGB 4F8RA 1VQ9S 1BQXA 2EI5A 1KNZA 2V5HG 2I38A 2J5AA 3OJUA 1K0TA 1VC5A 3BO2A 3J7A1 1RK8A 4PG8A 2CPFA 3HHLC 3QWPA 2ZM6F 4EYIB 3KK2B 1D9FA 1HMVB 1S1VB 1N5QA 2J0WA 4C8NA 4URGA 2ZH2A 3RU0A 1F5CA 1MWZA 2D9OA 2MY7A 3FNNA 4G1IA 3BGRA 4X4UA 1LWFB 2Z8QA 3NGKA 4LT6A 5B0FA 2R9LA 4O0IA 2LDYA 4GC6A 3DRSA 2WCXA 5HO4A 1RT1B 1VQ6S 1TAQA 4RNMA 2POKA 4KFBA 4R8UA 3SYZA 4I2PA 4HKQA 1LW0B 3E3XA 3QYYA 1WWHA 5IFMA 4C8YA 4IOBA 4CTAA 2IVFB 3ENQA 5AE2A 4XAKA 4F4XA 4B17A 1QSLA 3I0RA 1FXDA 1FE0A 4E8UA 1VIXA 5CZXA 3DXBA 4QIGA 2XNRA 2DK2A 3H5UA 1TV6A 3AY0A 2VFSA 1TL3A 4NLSA 3CSKA 4EO8A 3OFEA 3D0IE 3O8WA 2JL9A 2XZWA 2KDOA 4O4GA 5BYSA 1H7XA 2HHHF 3Q22A 1X4CA 1T03B 3M9MB 5J1EA 2DRBA 3VWSA 4AFFA 3ZZ0A 3G71S 3KLEB 4JUZA 2M9KA 4C0BA 1E6YA 5F8LA 2MZ1A 3N28A 3RB3A 4Q7AA 3M6VA 1MROA 3ITHA 5FLXY 3CC2S 1XK8A 4TY8A 4HVZA 4U67Q 4YDDB 3D1OA 2GQ2A 1FEEA 5E7OB 2NPIA 3WZ0A 4RW6B 2GA7A 3KLIB 5CQGA 3KLFA 3DI6B 2Q6BA 5MAOA 4RBVA 1PILA 1L3TA 3HHNB 1FJ7A 1YBAA 1LWCA 3I87A 2K3KA 3NAIA 2R2SA 4ECWA 1A6LA 2GO9A 2RDJA 3T5LA 2CQDA 2XLJA 1U4BA 3AJ1A 3U1LA 3DU5A 4L6V3 4ECZA 3OSPA 1KLMB 3BQ0A 1U7LA 5KFKA 2IRYA 2QRRA 3TA2A 3OR1A 4D3HA 2IRUA 1X5SA 4WE1A 4J9SA 2Z2MA 2AWZA 3KHGA 4PG4A 3OTEA 1L3UA 1NK4A 4C98A 5EWFA 2MDAA 4XPCA 4MKYA 2DIUA 3NS6A 1JXEA 2MZRA 3QO9B 2AGQA 4A8KA 4MKBA 2DIVA 5KFOA 1ZM2A 2V8DA 2N3OA 2NYIA 1UWBB 1N54B 2EG2A 3VZIA 2BE2A 4IRKA 2KRBA 1M5KC 1S76D 3L7OA 1U2RA 2VUGA 5I3UB 3L95X 3PIPQ 3LQVA 4KJIA 4QPTA 4H4KA 4YR0A 1KHWA 4QWEA 1QAJA 2ZH6A 2YH0A 3RAQA 2O66A 1S72S 1R6YA 3B8HA 4O3QA 2ASYA 1F2GA 4OI1A 1Z4UA 4DEZA 5B08A 2PN6A 1IXKA 4YUDA 2J9EA 5KFRA 5LJ5Y 3F44A 2LDIA 4O3SA 1HBNB 3DHXA 2EFNA 3MPWA 3H4DA 1ZETA 3Q8QB 2V8HA 2XULA 1KFDA 4OX9F 3AA9A 4ES2A 4A8MP 1VQ4S 2MKSA 3TVKA 2ADCA 1IKVB 4ED6A 2RS2A 1Z2ZA 3I82A 1H2TZ 4B9NA 2OO4A 2G0CA 1DRZA 4BDPA 1L3KA 1SV5B 3MECA 2KYZA 5L1JA 3M6XA 5KG5A 1FXLA 5BYRA 2JSXA 2B56A 2LVWA 2KTQA 4IO1A 4ALZA 4PG5A 3KLHA 3JTNA 4ZP8A <