2KJWA

Solution structure and backbone dynamics of the permutant p54-55
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
96
structure length
96
Chain Sequence
MDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S6
publication title Solution structures and backbone dynamics of the ribosomal protein S6 and its permutant P(54-55)
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 16
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kjwA00
4LF9F 1XNRF 4DR6F 4OX9F 1I94F 2UXBF 2UUCF 4DV0F 1HNWF 4JI0F 1G1XA 4GKJF 1VMBA 4DV5F 2E5LF 4DR1F 4B3RF 4DUYF 4GKKF 1B64A 1RISA 4LFBF 4DV3F 4DV7F 2VQFF 4YY3F 4YHHF 4DR3F 2BXJA 4DR7F 5AJ3F 4JI7F 1F60B 1J5EF 1G7CB 4AQYF 4JI3F 4DV4F 1N32F 2YY3A 4JI4F 1IBKF 4X62F 4JI2F 1XMQF 4LF5F 4DV2F 1FKAF 1N33F 1CQNA 2UUAF 2B7CB 5IWAF 4B3SF 4DR4F 4X66F 1IBMF 1GH8A 5BR8F 4LF6F 2ZM6F 1IJFB 1CQMA 4X64F 4B3MF 1XMOF 4LFCF 4LF4F 4X65F 4NXNF 3ZZPA 1HNXF 4DV6F 4B3TF 2UXDF 5LMUF 3T1YF 4JV5F 1QJHA 3OTOF 2UXCF 1HNZF 4LF8F 5LMNF 1IBLF 2B7BB 4LF7F 2HHHF 2KJWA 2UU9F 4DR5F 2VQEF 1HR0F 1XNQF 2RJZA 4KHPF 4JI5F 2BVZA 4LFAF 2F4VF 1N36F 4JI1F 4DUZF 1IJEB 4JI8F 1FJGF 3R3TA 4DV1F 4JI6F 4K0KF 2J5AA 2KJVA 3T1HF 1N34F 4DR2F 1LOUA 4NXMF 2UUBF 4JYAF
chains in the Genus database with same CATH superfamily
4P7VA 4M1KA 3IAS9 1D9DA 2ZH4A 3CGIA 2RD5C 2C42A 1HA1A 1W2IA 3H5UA 1SPBP 1R7IA 3TZZA 1UJ6A 4JI5J 2J6TA 1GK8A 5HATA 4IQXA 2D74B 1FDBA 1N4LA 2V8VA 3OD2A 3THTA 5E3RA 3PDNA 3M2UB 1TKXA 2QFIA 2E9ZA 4ZA1A 3BBBA 1RBOB 3ZTSA 3BGRA 1S77D 1IR2A 3PIPQ 3MEDA 4LSZB 1Q4RA 1RU1A 2WBMA 2C3UA 2KXHA 3SI8A 2OPRB 5KOXA 5FLXU 4ILRA 4PPZA 4B3RJ 5L9NA 2DYAA 4ICLA 1Y0HA 4FS1A 2NUHA 2HWIA 1FJ7A 2RQMA 1VBYA 3PIOQ 3FCWA 1AROP 1FERA 4C7QA 1K0VA 4JI2J 3I6PA 2CVIA 3MM8B 2UP1A 1IJEB 5HSPA 1QSYA 1XR5A 3CWJA 1FKOB 1ZAXA 3SQGB 1S9GA 2HNDB 2PIIA 4ILLA 3D0GE 5HL7Q 2W4DA 4EU0A 2XO6A 3GIKA 5KFTA 4QU7A 1UAWA 1S0NA 4QQBA 1U48A 3OHAA 4JI0F 1XNQJ 2AW0A 2B9WA 5K8MA 1NK7A 2V69A 2ZJPQ 1HKAA 4WIIA 4AUKA 3J7A1 4IFVA 3NCRA 4YHHJ 2YNFB 4Q8EA 4WFAQ 3PYFA 1XMQF 1U7LA 3WX8A 1KLMA 4H54A 1IQZA 1CULB 1JKHA 4R5PB 3NL0A 4MIBA 2OSQA 3EVWA 3IR7B 4OYWA 5H9EJ 3Q24A 2R42A 4USVA 4EGLA 2WVEA 1E6VB 4U7UK 3Q2SC 4Y6IA 1F5AA 4M8LA 1TL5A 1DQ9A 3H5XA 4J9PA 3D68A 4X4SA 1RWUA 1CPZA 2DNQA 2LDYA 1I3OB 2RILA 3JYTB 3A8IA 1ULRA 1K73T 2CZVC 4UTGA 1WF2A 3NGSA 2NUUG 4B3OA 2LMIA 1O51A 1C1BB 1S48A 4P2MA 4O3NA 2DHXA 2ZNZA 2E7WA 2HVZA 1VDHA 4C6AA 3TI0A 2PT0A 5K8NA 4F0KA 3CJ0A 2C2DA 3V6KA 4WP8A 3M8YA 1FKAF 5IWAF 2EWHA 3WC0A 2OGUA 3W63A 3TWZA 1NPPA 2ZOGA 1H38A 2ZC3A 4E2FB 3MMAB 2GQ2A 4FYXB 1JJHA 2M7SA 2DIVA 3JSMA 2QG9B 3KTQA 2CWKA 3H42A 2DY1A 4IOBA 3Q0AA 3WC2A 4YUDA 3NCQA 1WF0A 2IDEA 1F9EB 2VG7A 2XWYA 1T3OA 3K5OA 1CS4B 2YNGB 1YHQS 2C3MA 4ZHRB 3RBZA 2XG8A 3ENVA 1AXQA 1FEHA 2B8QA 4LF8J 5IC4B 1NK8A 3MWBA 1DTTB 3ITHB 2XCPA 4KRWA 2E1PA 2FGCA 1J27A 2AV5A 4ZN1A 4O44B 5IM0A 4RW8B 1VLYA 3HVWA 4Q2LA 3BREA 5K20B 1TTHB 4MK9A 3ZZUA 4MKYA 1M5PC 1L3VA 2JVRA 1FE4A 3GG0A 4IH7A 2RKIA 4IO9Q 4ECYA 1J5OA 3FUYA 5DDRC 2OPQA 1IBMF 1IKWB 3D66A 4P73A 5ETPA 3T5KA 3UQSA 4F4WA 7AT1B 2VBZA 2F7VA 3O3LA 3L7PA 2C3YA 2FDNA 3OFEA 2X1FA 2RJZA 3GZ7A 2F4VF 3OXFA 2CWXA 5HVFA 2A0FB 2ZFHA 1BHNA 3MM9B 3MPDA 4YB6A 1BXNA 3G82A 3KLHB 2HMIA 2JZ5A 4DOZA 4G1QB 5F8NA 2Q1LA 1H98A 4DSKA 2ABYA 1S72S 2HK3A 5LMNJ 1SI9A 3ADAC 3SSQA 2VL1A 4BC7A 4IH6A 3NNAA 3BQ0A 2C2ZB 1A7GE 4M5IA 2FZKB 3AXMA 4MKVA 4K4WA 3IM9A 3TAMA 2CPXA 4FF4A 3BSNA 5J2QB 3LUYA 3OPKA 2BMBA 3ILLA 2BM1A 3PRVA 1I94J 1IWAA 4NL5A 1N33F 3PYGA 4DV5J 2ZE2A 4B3MF 3NMRA 2YH1A 1NPKA 2FJWA 2QSWA 5IZHA 2MSSA 1S6UA 4DV6F 3FEZA 1U2RA 1U6FA 1RHMB 2PFFB 3WDOA 3CF5Q 8RUCA 1IKYB 1OO0B 2ASJA 4DPTA 5HMZA 4J9QA 1IBLJ 1MWZA 3HVRA 4X66J 3M1VA 1VBXA 3V4IA 1M5KC 5D4OA 3VQSA 4NX9A 2ADBA 5D4PA 2GMJA 3PJWA 1SVDA 3N6LA 3LO3A 3EZUA 3NXZA 4PG6A 5CYJA 4A8OA 1RDRA 2V0NA 3R5GA 4CTAB 3N6MA 1PAUB 3I5CA 1RT7A 1S7HA 2YQ3A 2HHUA 4MK7A 1FXDA 3CMES 4ZVPB 1X9MA 2LEPA 3T5HA 2F3JA 5KT4A 2Y1IA 2ZUAA 4DQPA 4QYZK 3CT9A 2GIFA 2MPUA 5B0DA 1X4GA 2C1EB 4QWDA 4KR0B 3AH6A 2VODA 1LFWA 4X4TA 1SKSA 2HQIA 2EG1A 3MMBB 2UVUA 1BMQB 2OMLA 1G2EA 3LP1A 4N77A 1WJ9A 2IYGA 2EFVA 2XM3A 1REVB 1SJRA 4UT4A 2CPJA 2YPZA 2HGLA 5LMUF 3CSKA 3KOAA 1RHUB 4I1TA 1W2BR 2IRUA 1RGVA 2H65B 4IOAQ 2CJBA 1PBUA 4IOCQ 1TQLA 2DR9A 1QD1A 3EJMA 4WYLA 1X5PA 3DMJA 1WC0A 2V5HG 2XMVA 3Q22A 2DO4A 1CJVA 2PMZD 4E0DA 4LRFA 4O4RA 1YTYA 4HLBA 2VZ9A 6AT1B 4H4MB 2KZMA 1RISA 3K5NA 3WBZA 1JMTA 1RCOB 2X1BA 3GV8B 3KLIA 1NJYA 3MPWA 1DY3A 1TL3B 2Y3YA 4RNHA 2VFRA 2W2PP 4DV7J 5L8RC 5AXKA 4ECRA 1L3KA 4YR2A 3RG6A 1O6XA 2VG6B 3F73A 1VCTA 5E7OB 4GKKJ 1FKPB 1RAOA 3KUEA 3VAFA 4FN5A 4XK8C 3NGDA 3GQCA 1KFSA 1RBAA 3PJXA 3DXSX 1D9AA 1FX4A 4ZP9A 4NCAA 5KFZA 3FEXB 3GCXP 4PWDA 3EVOA 4RW6A 1IKXB 3T41A 3VGTA 3MCOA 4DQSA 4RW9B 1GMUA 3M8RA 5HI7A 3I31A 2UUBF 2OELA 3FBEA 3ISNC 2QX0A 2HEKA 1VQYA 1NH7A 2DNKA 2YKAA 3HLUA 2AU0A 2MZSA 5HJYA 3DRYA 2OPSB 3OBIA 4B9LA 2KTQA 5G0RB 4J5OA 3AOBA 5D4NA 2D9PA 4PQUA 4P72A 4O3PA 3QSIA 3IFEA 4DV2F 1SV5B 3JSYA 1KS2A 3UR0A 5AT1B 3D6TB 3FSIA 1JNZB 1VBKA 5HVHA 2V67A 4TXSA 3KNAA 3GCWP 5C7PA 3D7SB 1BLUA 3DDKA 4Q5VA 2M88A 1SJ4P 3VZIA 3C19A 3OVAA 2K3KA 3US5A 1HWJA 1TL4A 1WC1A 3CJTA 2ASYA 4RNNA 3AD8C 4QPXA 4OHXA 4L6V3 2VC0A 4IG0A 4ZMMA 3SQOP 2B51A 3OJUA 1CVJA 2YKNB 5CH7B 1BE4A 2D7SA 3AXKA 2QA1A 1CEZA 4UZBA 2E9TA 3D1QA 1JLFB 1C0TA 1RLCL 3R7NB 3Q8UA 4O3QA 5CABA 2GJIA 1PC4A 3QWPA 2UVVA 1HPZA 4KPYA 4OX9F 5I4MA 3G8SA 4HI2A 2HBRB 5IT9U 1NEEA 2O66A 3D67A 1E6YA 2J0WA 3B6BA 2LA4A 4PXBA 1JQGA 5DJBA 5B0EA 1RTIA 2VB6A 2ZD1B 3HVTA 3O44A 3CDUA 5ETLA 4ED3A 2DGUA 2KT2A 2CG4A 1T02A 4KC5A 4NLYA 2C2RA 3NY0A 3PKYA 2R2UA 1RHJB 1NAQA 2FZGB 1KOOA 1K1SA 3BDPA 1TK0A 2GVDA 2VDIA 5RUBA 4A8WA 3KLFA 3M6XA 3PG9A 3CJ3A 2CQ3A 1NU4A 1SCJB 2K1RA 1OSDA 3C8YA 4QWEA 2CXEA 2VFVA 1FTRA 1SJ3P 3K58A 1SJQA 4B9SA 2OFGX 4DR4J 4DUTA 2V4QA 4ZVGA 4YR0A 1PGZA 2GAGC 1XR6A 4C98A 3NP5A 1F5CA 1OYEA 5HANA 4CYUB 5A8RA 4I2QB 4OZ0A 1OY9A 4DFPA 1G1XA 2CJKA 1KVJA 3UPFA 2G0IA 1ZOTA 3UR3C 4KKOA 1S6PA 1HHSA 2ZH1A 2KL8A 2J9CA 4DR6J 5CYMB 4PWUA 2ROEA 3CULA 4EBCA 4KGMA 1Y3KA 2PSZA 3Q8YA 3FSXA 3B54A 2W4CA 2GW8A 4Z7CA 5DETA 4DX6A 2DISA 3CJKB 2HNYB 2B7BB 2C3PA 4IR1A 4Y00A 1DHMA 1WEXA 2LFVA 1H3DA 4CLPA 4W90B 2VV5A 2IC3B 3U1MA 3J80Y 2VONA 4DL2A 2VKZG 3CNQP 3PW2A 2ZITA 4IKAA 3TO8A 4RPFA 4MMOA 2GVZA 1BWEA 2VD3A 1S9EA 5K8PA 5ETVA 1TKZB 3ISZA 4ECUA 4YN3B 3UD5A 2PEHA 4TNOA 3MDFA 3R97A 2HPUA 4KGVB 2J9DA 5E3AA 1DRZA 1WOSA 3B4DA 2E5GA 4QPTA 1WG5A 2VG5B 4RU2A 3MAHA 4N76A 4CT9A 3IC1A 1NPRA 3BN4A 4C3MA 2QZ8A 2DGVA 4G65A 4ZVOB 1U6BA 4ECWA 1H7WA 2YKOA 1LWCB 5GAEU 3VQTA 3CJ8A 2YWFA 3D54A 2YH0A 3HX9A 3QWUA 1YQHA 3D0HE 4KHRA 2B43A 1YRXA 3NOGA 1HBNA 5HP1B 9ATCB 2UU9F 4ZK7M 2MY8A 4D3GA 8AT1B 1LW0A 1AUSL 4HHUA 4N47A 3CCQS 1EQMA 2R7XA 2N7CA 1NSKL 2JDJA 3MEDB 2LVWA 5T7LB 3D6HB 3M9NB 3KWMA 2UVWA 3DLGB 3AQPA 4XIUA 2W8LA 4CNZA 3K5MA 3T3FA 1HNZJ 3UWTA 4J9MA 4KYZA 4GKJF 1VI7A 2UUWA 1YKWA 2D69A 3VAKA 1TL7A 2DNGA 2E44A 3G8QA 2DB1A 1TK5A 2BXJA 5C25A 3QIPA 1A9NB 3K5LA 4DDFA 2OTLS 1RLDA 1NK5A 1MMNA 4ZVRB 1N56A 4AQYF 5LSRA 4F4XA 3VAJA 1LWEB 3ENWA 3M2VA 4BDPA 2V2KA 3WZ0A 3DN9A 2DK2A 4M5KA 3OUYB 2HHTA 4J9LA 1V3RA 5J2NB 3WIVA 4DSIA 3BGOP 1IKVB 4ZCKA 4YP3A 4NXNF 5KFFA 2YKMB 2W9CA 1WKLA 2M0GB 2QLXA 3M7VA 4OX8A 4PXDA 4C8OA 5AJ3J 4DG1B 3DRSB 3P5BP 1RT5B 1MW7A 1HWKA 4RNOA 4P71A 5A2QU 3PX4A 4LF7F 1VQ5S 1NDCA 4K7QA 3C14B 4RBVA 4I7FA 3VZHA 5A0YA 3KK3A 4M95A 2F8EX 1WD6A 2KXNB 1EP4B 2E66A 2A2CA 1HQEA 3MEGA 5J1EB 2DT9A 4LJMA 2LQ5A 2HHHJ 4NLUA 1QVFR 3QLHB 2R7SA 5DM6Q 2AGQA 2BANB 1UPMB 4TY8A 2AYEA 1C1CA 4RW4A 1Y5IB 4WWSA 3ETOA 1ZTWA 3QIDA 4ED8A 2ZDPA 3PHTA 1SKWA 4YQWA 2R9LA 1REGX 1YRUA 4LRDA 2IJRA 2C3OA 5CD4H 2J6UA 2FD2A 2DPJA 4X62J 1U0HB 3BGLA 2HFOA 3AHPA 4B3TF 3P8BB 4WFNQ 4ZVUB 2P5VA 1UVKA 1X4CA 1NUEA 4MTPA 1J5EJ 3PM9A 4ZITA 1S1WA 3MF5A 3EGWB 4N7TA 1VHIA 1N5YA 1URRA 2IBOA 2M9KA 3G71S 3THVA 3TA0A 4U7UD 1CJTA 4DPYA 4PABA 2SXLA 2D3OR 2CQ4A 1IN0A 3TUZC 3KJVB 3HI9A 2R7UA 2HS3A 5IQQA 1JLGB 3FK4A 3T6JA 4ZS6A 3MM6B 2LA6A 2CDRB 3UD3P 2AQ4A 2Y8WA 2EFOA 2YX4A 2GHVC 4HYKA 3SV3A 2ACMA 3I5AA 1ZM4A 5D4LA 1SL0A 4A8SA 2HVHA 5GAGI 5HLFB 1YWXA 3G87A 1FJCA 2E5LJ 3W2WB 2BW7A 2V8DA 3RRGA 4MFBA 3UNYA 1B70B 1M1GA 5BXIA 4RX6A 1XC9A 2U2FA 1WF1A 1QAJA 4DV4J 2V2VA 4YOEA 5DZ7A 2NZ4A 2QLWA 5F8GA 4HI1A 4E8UA 1RT2B 1FE0A 3H59A 1F1BB 5KFOA 2QE5A 4OZNA 4RUAA 4ZLPA 2YXLA 2E9RX 1T8EA 2R7TA 3FQKA 3NG8A 1FNOA 4I0WA 3RUBL 1YJNS 1GEHA 1R3NA 4RWXA 3I0RB 1SUQB 4ED1A 3T5LA 1LW2B 2XZTB 5CXTA 3M8PB 2RF2A 3MTKA 5FDLA 3EX7B 4GVBA 4GVLA 4OHZA 3T1HJ 1X0PA 3GJRB 2H3EB 2XYHB 5J1PA 2XCAA 4LMZA 5L46A 3FCVA 4LF5F 3NGUA 4CWBA 4USTA 1MWYA 2CUYA 1S4EA 2B6AA 3D6FB 2RRBA 1Y5NB 1WHYA 3FJ2A 3H0PA 1BUXA 3A3OB 4RO0A 3L95X 4L76A 2GO8A 3RAQA 2BR0A 3HD1A 2KYXA 1LXNA 4YB1P 2BBEA 5F3TA 4PG5A 2RU3A 1Q1KA 5F8JA 3ILIA 3KLGA 5A6PA 3V6DA 3W9IA 2HKEA 1TKTB 4CP5A 4LIRA 3QGGA 2W9BA 3BKFA 1U6ZA 2RQCA 1QLNA 5HBMA 2RDIA 2DNMA 3C16A 3MOJB 4UQTA 4DR5J 1RAFB 1QAXA 1U1RA 1YJUA 2CJYB 3D0IE 1ZZFA 3WX4A 2OKQA 1L3TA 4UUWA 1PSDA 2V8HA 2GC8A 2IBKA 4K0KJ 5KFQA 2N7YA 3BPDA 3HKZD 4DCPB 4CH1A 1VQ7S 1OJ4A 3P6YC 4QYZJ 2F9JA 2UXBJ 2RNEA 2KVQE 3TVZA 2WBRA 4PCQA 1MN9A 4J9VA 2DBBA 1IJFB 2VA3A 2DNLA 1RHQB 2RT3A 3EZ5A 3L7OA 3EDRB 3S6EA 1T3NA 4DLEA 4E98A 3KK2B 4RR5A 2OD6A 3VVTA 2H5EA 3G86A 3TZXA 3GIJA 4DQRA 3M32B 4L74A 1WOPA 2QSFA 5F0UA 2W01A 4AL6A 6FD1A 1OPIA 4JI1J 2KXFA 4DV1F 1FJEB 3LTOA 4UUXA 3RW7A 4DR2F 4AXJA 3DOKA 2WOMA 2XLIA 1NDPA 1LWFA 3NNHA 3FBFA 1B7YB 4DV0F 7FDRA 3CCES 3LAMA 2JEJA 3HPOA 3JAMY 5A8WB 2DVIA 2W2NP 5HO4A 1W25A 2JLEA 5AXLA 3AOCA 2HQCA 5KFRA 3IA0A 4OV1A 3R5DA 4U95A 5D0GA 4N41A 5F8IA 5JVGQ 4R8UA 3P4UB 3HO1A 3HHEA 4DR1J 2F40A 1HQ2A 2X3DA 4OHYA 4ZPTR 3PR5B 3LP2A 1VQKS 4J91A 2LXIA 1RAJA 1DJ0A 2JOQA 5DG8A 4PG4A 2FLOA 4BBYA 5HROA 5LSLA 3E01A 3I9ZA 2GHWA 4DFJA 2CKWA 4DUZJ 3OTEA 1MROB 5LSOA 5IV3A 3NBPA 3QJLA 2XZWA 3OFGA 3C2PA 2D3O1 4KT0C 2WW4A 4IR9A 2JC0A 4FXDA 4NA3A 4IRDA 2HS4A 3UN2A 4M5MA 3DI6B 2JX2A 3BBCA 2I6WA 3PY8A 4DR3F 4KTQA 2IM1A 3HXMA 1YG0A 1SQEA 5F8HA 3MD3A 3MR7A 1U26A 3ICLA 1KFDA 2EFQA 2V8GA 9RUBA 4DSJA 4IUFA 4DSLA 4DN9A 2HAFA 3MMCA 4X4QA 2OEKA 1V3ZA 5A6WA 5KT5A 3D9BA 4NLGA 2AKWB 4V1Ak 1JNRB 4N5SA 4FKXA 4UQGA 1ZPVA 1NZAA 2K06A 2LKZA 3VAMA 3S8SA 2CZ9A 3SDEB 2FLPA 2Z0GA 1NSPA 3E3XA 3NOCA 3LP0B 1T03B 2FC8A 2I2YA 4PQUB 1M5VC 4UOGA 2XZDB 3DU6A 3W8PA 5KFBA 3A4TA 1WC3A 1RTJB 2WB1D 1FD2A 4JYAF 1YJVA 3POTA 3DRRB 3MM7A 4DBQA 2R7OA 1PILA 4Q2MA 2BJ3A 2HBZB 3QZ8A 5JMNA 2G0CA 3TEHB 2HVEA 3HM9A 2FYXA 1JLBB 4Q43A 3O8WA 1TAQA 2MY7A 4ZOSA 3D1OA 4YHHF 1M90T 1HWIA 3EGNA 4ES3A 6FDRA 1VRQC 2R8KA 4LR7A 3KDNA 4DL5A 4M5DB 2A2DA 5K5MA 2HW3A 1DLOB 2YQ0A 1NDLA 1S6QB 3TJAA 2G9OA 3BYRA 4B3SJ 3KHLA 4LF4F 4Y2CA 4AL5A 1RT6A 3BN7A 4QBUA 2XO7A 4IG3B 4JI7J 2VPZB 4NOHA 5K14A 3GFXA 1R8CA 1N36F 2BQUA 3DLKA 1VQMS 3M2RB 2COLA 1FRLA 5E41A 2KG1A 1WORA 2ZVSA 2H1YA 3JAMU 1RHKB 1TUGB 2DGQA 1U8WA 1WDTA 3GG1A 2JLFA 1Y9OA 4Y2AA 3CW2C 1SC6A 4ED2A 1VQOS 4RNMA 1KTVA 3GYGA 3C6UA 1S97A 2PA8D 4J9NA 3LALA 1J2VA 5JVHQ 4ZJOA 2X1GA 1CBKA 3QT8A 1U1OA 1FFSB 2FHJD 4FP9A 2B5JA 4WJBA 1ZM9A 3P45B 2RAQA 1L3SA 3H20A 2DGOA 2YNIA 2BZ2A 2ROGA 2HG4A 2JVOA 4RKUC 4N56A 1T7PA 3NRBA 4FZVA 5ETRA 2L48A 3DOMB 2VOPA 2CQDA 4LSLB 2W2MP 2H4YB 2OFHX 4G1PA 2IAJB 2BKOA 2ACYA 2MKJA 3DM2A 5BYRA 4I6AA 2JWNA 5IV4A 5ETNA 4O3OA 3E2EA 4J9RA 2OTJS 5EWFA 3IG1B 2WVBA 1IBCB 4AXIA 2QC3A 3FCHA 4EYHB 4ZCMA 1N34J 2U1AA 1VRUB 1NKBA 2BOAA 1VRTB 2CNNB 4X4RA 3HHDA 1AZSB 1C4AA 1C4CA 2FPHX 1CSJA 1K44A 3JTOA 4DV3F 1EETB 3HD2A 3NLCA 1SC1B 3W2VA 5C42B 3OVBA 4X4VA 2DO0A 1VIXA 1ZETA 3TOQA 1L3UA 4X2BA 2BKPA 2DKOB 2FJAB 2UUAF 2GGPA 2B7CB 4F04B 4LF6F 3HULA 1MU2B 2HURA 1JLQA 1S1UA 3NMAA 2VOOA 2DTJA 3DOLB 3W9HA 3QATA 3FZ2A 3HF5A 2I5JB 4CO1A 4MT1A 2Z58B 3TVYA 5GVQA 4KFBB 4DWIA 1OY8A 4H4KC 2ZJRQ 4CZCA 2YWKA 3L3CA 1VHFA 4BLGA 4I64A 1BQMB 1S1VA 3T9ZA 3HZGA 4ER8A 4X4PA 5HQMA 1H74A 1MSWD 4CLKA 3HFZB 1CG2A 4OI3A 4ANEA 2Y1LB 3CCVS 1DTQB 2LLZA 4OJHA 1VC5A 1HLWA 1BQNA 2MQOA 2VBWA 4NLRA 3M6WA 3IBWA 3U27A 1F2HA 4USHA 1YZ6A 4OZLA 3MD1A 3L7UA 2CDQA 3R5JB 3HZEA 2NYIA 2NS1B 3MCMA 2AD9A 3M8SA 1SH2A 3D28A 4RW7A 1NZ8A 2B4VA 2KI2A 2W9AA 2CPDA 5CYQA 2XY5A 5KG5A 3KUGA 3DLEB 4LIWA 3QZ7A 4HVZA 3OLBA 5HVGA 1IBLF 3SSSA 4I56A 3IP0A 4ECVA 1XMQJ 3I32A 4UY8T 3KHGA 2XNQA 3IS9B 1CJUA 2BJ1A 2HQFA 4RZRA 2O3DA 3C3LA 2DHGA 3CJQA 1RSCA 4PAAA 5D3GB 3TQEA 1UJ4A 2GNKA 4K8RA 1HIYA 3PW4A 5EWEA 3KK1A 3W62A 5CZXA 2C28A 1UMJA 4OI6A 2O1PA 1RTHB 4Q8FA 3AFGA 3Q8PB 3KLEA 1EARA 3MMJA 5J2PA 5ETSA 1D3WA 5C2GA 3J81Y 3BR9A 4FDFA 5AE2A 1D0EA 4X4NA 1RAEB 3CMAS 4O4GB 1VQ9S 5KFCA 4I6WA 1X5SA 3GWCA 3OSNA 1RBLA 3PX6A 1HHTP 4USKA 1T95A 1ZTTA 3BYPA 4KGZB 1C1CB 3LOUA 3CO0P 5I3PA 4M5LA 4ID5A 3HKWA 3GONA 3GE9A 2BACA 2P9GA 4NLVA 1OPZA 2BEFA 1UFWA 2HGMA 4USJC 1I1GA 4ELVA 2E7VA 3BBFA 2BRKA 1KC8T 1LNQA 4AT1B 4ITSA 1S9FA 1X7VA 3K2YA 4O3RA 2J7KA 2VASA 2NQPA 1R89A 2P8IA 5H9FK 2BE2A 4DU7A 4URGA 2HFUA 2W7AA 2RU9A 5DDQC 3CCSS 1ITPA 4FS2A 3UE2A 4WE1A 4C11A 4LFBF 4DV7F 3PYDA 2KRBA 5EX0A 3MOZA 2CZ4A 2DNYA 1UWBB 4YMEA 2DRBA 1NHKL 1NKEA 4USUA 5I3QA 1FNXH 3GR0A 2FY8A 3OL6A 5KFXA 4WYWA 2HLTA 2R8JA 1RE1B 4B17A 1YK9A 2KZZA 4MAKA 2K8GA 4OZ5A 2ZKTA 2PA3A 1NRKA 1MNEA 3BB5A 3T5JA 4ZVSB 2YNHA 3KUHA 4JV5F 2G2OA 3QJPA 1JXEA 3Q23A 2MB0B 2NXCA 1JX4A 1S1TB 4I69A 3D3BJ 5AE1A 2IRXA 1HI0P 2AJ1A 1IBMJ 4G1IA 4WFZA 1HARA 2CQGA 4KO0A 4PR6A 5GMEA 4U8YA 3OSPA 1QAIA 3CD0A 2H54B 2XC9A 3QO9B 2AF6A 1Z2LA 3R6GB 2WHOA 1U24A 4DMZA 4WU2A 1H2TZ 4MKAA 2X7IA 2F4VJ 4CO2A 2MGZB 4YB7A 3HFKA 1OS5A 4ZDNA 3MEEA 4OJ3A 4IDKA 4ZJLA 2VQFF 4PKDB 3R2CJ 1EIYB 4JV0A 1SC4B 3X3UA 4H4OB 1L5UA 5DO2A 1Q8KA 1PIEA 5F9LA 1ZAWA 1S0VA 3H4BA 2PI5A 1HL6A 4KY3A 1XWLA 3VCDA 3FFIA 5CCLA 1KNZA 1C0UA 2P9EA 3I0SA 3PW0A 3KJFB 4QWBA 1N33J 4ZCIA 1WEZA 1BD6A 3RRKA 3KXDA 1RP5A 1UA1A 3KG4A 2GIQA 4IRCA 4QR2A 1KVKA 4DV6J 2VFSA 3SZ2A 1LFPA 3FBCA 2CNOB 3CPWR 3HFVA 2DNNA 2WSCC 4UZCA 2UUCF 2B3TB 1GMWA 3J81U 2HAIA 4TU8A 3IGVA 2DNOA 4FXVA 2JC1A 1KSPA 2AZ1A 4XO0A 1M1HA 1NK4A 4BC9A 4OI1A 4PUOB 1T9YA 1G7CB 1VISA 3EVMA 4I2PB 1KQKA 4DPWA 1LKZA 2MLZA 4OV6A 3PHEA 1Y3JA 4R0EA 3UN5A 3A13A 4LFCF 1UJ5A 2NSBA 1UW4A 3PZPA 4CLYA 3BSOA 1HMVB 1XERA 1FVSA 3RBXA 2OPPB 2Z2LA 1U49A 3DYAB 1DFDA 2OO4A 2NXUA 1FFGB 2HBQB 2A3JA 3MPVA 4DPUA 2BOPA 2IVFB 4RUHA 2ZDOA 3M9OB 5L9XA 4EBDA 5LMUJ 5DQHA 3NKYA 2LXFA 3FGVA 3VGSA 3CD6S 2N82B 3AA8A 3HHLB 4CLTA 1X5OA 4CM2A 2J0XA 1B64A 1U1PA 3OR1A 3OW2R 1X4EA 1QSLA 3R2DJ 3HHLD 1T05A 1MMDA 4W98A 1HBMB 3W1YC 4K4XA 3VTIA 4PXCA 3DRPA 3A3PB 3MUVP 1PC5A 3HSZA 4Y3CA 3TUIC 1HBOA 1VQSA 1R8BA 4U7CA 1HYSA 3DRXA 3H5SA 4MIAA 3UCUP 8ATCB 2ASLA 4HKQA 4HDGA 4G3IA 1ZPWX 4MJKA 2I38A 4DCOB 5F9NA 1MLAA 3UVJB 2RS8A 2V8PA 4I6YA 5GADI 1PYSB 1NHUA 1YLXA 2RQ4A 3WQPA 4TY9A 5KFAA 1WNEA 3TANA 2MJUA 4WKRA 1TUWA 1Y10A 2IHR1 1TFYA 2WONB 2GO9A 2OH2A 4ECQA 4GC7A 1YJRA 4R8UB 4W4MA 3M2UA 3AJDA 2EVZA 2Q6CA 4AFFA 1GQEA 3LP2B 3TVKA 1KP6A 3MXHP 1Q8LA 3TNVA 4WXOA 4ZP6A 2Q3PA 3AJ2A 1NB7A 2E1AA 2OPRA 4M5JA 4TVAB 3PFEA 4EYIB 2Y1JA 2JSXA 4DL6A 1F60B 1VLOA 1U1NA 4FVCA 5LOQA 3W5ZA 2R8IA 5B09A 2AX1A 2DRAA 2LP4A 3MECB 2BDPA 3MM8A 1FKOA 3SQGA 5DLGA 2HNDA 2HQDA 2VQEF 2ZWOA 4DV2J 3MR3A 2DHSA 1XIQA 4YS2A 3UNGC 2QRRA 5IQ6A 3LQVA 1TL1A 1T9XA 5ETQA 1RAAB 2QL9B 2QLBB 2I9SA 2Z57B 3DHXA 4DEZA 2X51A 1TKDA 1F3FA 5IFMA 5DDPC 1EQ0A 1RT4B 1AA1B 1LK7A 4ATNA 1CULA 5DQIA 2I8EA 3KMQA 4R5PA 3W5XA 3UW1A 1N32F 1FA0A 1PJ7A 4F4YA 3J7ZT 5DQGA 2XYGB 2NREA 2IFXA 1E6VA 3DU5A 3CJRA 3UCGA 4O3SA 2W7OA 4I67A 3AB2B 2R7WA 5CHCB 5KAKA 4C8NA 5B0FA 3JYTA 4XPEA 3MGJA 3V81B 3S01A 1WSRA 1V5VA 1FK9B 4QR0A 2N3OA 1D9FA 1S59A 2B56A 3ZC4A 1VS3A 2G0JA 2V2QA 2P9CA 4F25A 3K17A 3TR5A 3GYXB 1RWMB 4CLZA 4LQ3A 1S99A 4PEOA 1NSAA 3J7YI 3IBFB 4BHQA 5JXSA 1N6QB 1FXLA 2IRYA 4ALZA 2YWHA 2DNRA 1HI8A 4KV8B 5A76A 5CQGA 1NK0A 4OLPA 2ZBIA 4Q0BB 2WZ1A 1Y00A 2OI2A 3IR6B 4NZ0A 4LSNB 4X62F 3MMAA 2VDHA 1AUDA 5HQ8A 2XMUA 4B08A 1X0FA 3OJSA 2B9XA 4Y2IA 4EK2A 3LGHA 2J0QD 4KQZA 3B4MA 4URQU 4CH7A 1CS4A 3J81j 4NI2B 2YNGA 3C6UB 4X4OA 2G4BA 4ZHRA 4DQQA 2KDOA 2BUNA 2CQHA 4Q7AA 3KJNB 1DTTA 3ITHA 5I42B 3OTBA 4U9RA 2GA7A 4FF1A 1BWVA 3UN3A 4O44A 4RW8A 5M2UA 4JI6F 1RI7A 2QEXS 1KQGB 2LQBA 1WC4A 1I51B 4ZPDA 1YGYA 3OR2B 4NA1A 4BWMA 2EC0A 3M4XA 2YVSA 5T41A 1VK8A 2MXYA 2ZC4A 3TUPA 2IM3A 2XYPB 4C0BA 1X5TA 1VQ4S 2YWWA 4TN2A 1VQPS 4EBEA 2FHMA 1S49A 1IKWA 3MEKA 2C2MB 2QA2A 5GAHI 3IRXA 1SKRA 5J1NA 3DM2B 4FYYB 3PYEA 3V6HA 3TA1A 4U67Q 2QFJA 1S10A 3C15B 5HMWA 3KKFA 3VR1A 1KONA 4WU3A 1S79A 2NCKL 1KD1T 3GSDA 2ALYB 3MUTP 4L75A 3MAAA 3T19A 4B9NA 1NJXA 2JEFA 3MM9A 4F2RA 3KLHA 2QJ3A 3DGPB 4QYRA 2AIRB 4G1QA 3GV5B 3TAPA 3PRBA 4WZQA 3F0NA 1RB0A 4LT6A 2FVRA 3C6TB 2C22A 4EZ6A 5IXUA 4V19X 3R1LA 1KEKA 1PJ6A 5EUHA 3IWXA 3MM5B 2F9DA 2CQCA 2MLYA 1XEZA 2DH9A 2XB2D 5CAAA 1VR6A 4C8YA 3N4WA 3CVKA 3BDEA 2ZH6A 1ICEB 2UU9J 1WTBA 1WKKA 4NLDA 3PEHA 4ZP7A 3HT3A 4DL7A 5KG0A 4CLFA 2IVYA 3RR8A 1NHVA 4A8YA 1MMLA 2HWHA 4XDCA 2JFKA 4OZJA 1ZAVA 4X84A 1SH0A 3RB0A 4DR7F 1K8AT 3OT9A 3BEGB 1RXOB 3A8JA 3AB4B 2P6SA 3PTWA 1WG4A 4F0MA 4GKJJ 1RT1B 1IKYA 1TELA 1XMOF 1GTHA 3M8WA 3AY0A 1P9YA 2HNZB 4LR9A 3N9UC 3SCJE 2UXCF 4AQYJ 2CPYA 2XTJP 3HJVA 2Q66A 1Q0NA 5IS2A 2G2YA 4CTAA 2GQQA 2CNLB 2WVFA 4WZMA 1ZA2B 2GZOA 4ZIVA 3M30B 4NXNJ 4LBPA 3LPEA 2YX1A 1NK6A 2FHOB 5CYQB 4LF7J 4K2XA 2HHSA 1Q82T 5IT9Y 1FDDA 2VJUA 4P2XA 4LRBA 2W2QP 1LV5A 3M05A 3MMBA 3MPYA 5HN0A 2EG2A 2HFSA 3DKDA 2FY1A 1F0XA 1UVNA 2DJWA 2PFDA 1Q16B 1REVA 2UV8A 3D2WA 4BS2A 2KVIA 4A46A 5EX3A 4FF2A 4L3NA 1RTDB 3HVAA 3PXGa 1UFKA 3EICA 1N54B 2CYYA 3CCWA 1N88A 1Q8BA 1TV6B 2VKRA 1QE1B 3CJ4A 4DZ6A 3T1YF 2HYIB 4IYQA 1HFEL 2HVDA 5E5NA 3ZXWA 2R2SA 4LFAF 4JI1F 2KFNA 3KNGA 3Q83A 3R3TA 3MZIA 1Y5LB 4F2SA 2KKHA 3U7JA 2ERRA 2HVIA 4H4MA 2Z30B 1JLEB 2EKYA 3RB6A 4B3TJ 3AAWB 1S1XB 4LRCA 4C3KA 1R27B 4PG7A 4A48A 3FMBA 2R7VA 1TL3A 3T1AA 1RT3B 4K2JA 1N48A 1GT8A 3B82A 1VK3A 3DC2A 3EPGA 4ZVFA 3HCXA 2PGCA 3CUNA 2MKCA 2MJNA 4OX7A 1XBWA 2JRSA 3TUJC 4H4KA 5H9FJ 1EB0A 3QMQA 2POKA 2AEJA 1FKPA 1NH8A 4DPOA 3ENQA 3ET6B 1HBUA 1FWKA 5C24B 4J9KA 3GV7B 4WFBQ 1YJTA 2OMOA 4CQ1A 5CCMA 1R6YA 2F63A 4QOTA 1NMEB 4NYOA 2ZNYA 3PW7A 4P9SA 1IKXA 1SBRA 2MQ8A 2QL7B 4RW9A 2K2PA 3G8TA 1VQNS 5MLCV 1VBZA 4LBIA 1UL3A 3M9MB 2H48B 2HRUA 4KIAA 1P6TA 1SH3A 4HACB 4DUZF 1KN6A 2XI3A 4MIWA 1Q8IA 3G4SS 2OPSA 4LUBA 4KSEB 1NO8A 4LF9F 3A1YG 3LGNA 2KRRA 3KFWX 2BQ3A 5G0RA 2XHCA 4DF8A 3GIIA 4MH8A 1YBTA 2XGPA 2XSJB 4XDDA 1SV5A 2LQ8A 4PRFA 3TAQA 2IJNA 3GTYX 2ATLA 4URSA 2YPYA 3CTRA 4IH5A 2RRAA 4JI4F 3QGPA 3SFUA 3TARA 4RLEA 4DX7A 1SKUB 2MHEA 3EGZA 5L38A 2EPIA 4JBCA 1FHTA 2BJ9A 4CRJA 2YKNA 3GJSB 3FRZA 4B9VA 1JB0C 1TAUA 1H7XA 5KG4A 1JLFA 4K4ZA 2XMKA 3NS5A 4LF5J 4C4WA 4LR8A 2IA6A 1W7WA 2C2KB 1ZBTA 4JP8A 1IXKA 1ELOA 1K47A 2QYGA 2CPIA 4FPRA 2K7JA 4OYZA 4ECTA 4P10A 5GMDA 1XNRF 4NLTA 1IUJA 3OXLA 2ZD1A 2P2CB 3TP2A 1Q78A 4ES2A 3RTVA 2KH9A 2HZCA 3TYTA 2V4JB 4IFYB 4USWA 2PEBA 2LECA 2DGTA 3CXCR 1JXVA 3BF4A 4ZPWR 3CCTA 3UO0A 2W7PA 1H2UX 3CEDA 2PC6A 4B3SF 2YWGA 1N5VA 3JSRA 3K8WA 1MN7A 4U96A 1B3TA 2LQ9A 2DY9A 4O0IA 2VHGA 1YSJA 4ZKAA 3VVUA 1SXLA 2BE7D 5A2QY 4P7TA 5THWA 2XY6A 2DD8S 3MFHA 4CYUA 4UOCA 2ZBQA 4I2QA 4DPXA 1EKRA 3ELHA 3VAIA 1CLFA 2APOA 4TYBA 3CDAA 1X4DA 2F8HA 3BPSP 2KJVA 3MR2A 3M6VA 3M8QB 2CJ9A 5H1SV 2OLWA 2MQPA 2CPHA 2FJBB 4EFAC 7FD1A 1NXIA 1HNIB 5CYMA 1RWPB 4DUYF 3H7HB 1LWXA 5FD1A 1RACB 2XS7A 2WTFA 4DV1J 3CE8A 2I1RA 4DR2J 1D09B 1JLCB 4ZN3A 3CJKA 1WG1A 2OEMA 2IVMA 4DV0J 2CQBA 2YKQA 4HH0A 1SB6A 5BR8F 4PXEA 1B4SA 2IC3A 2CPFA 1TVRB 4ANCA 3R5AA 4NYZA 3PR4A 4WCEQ 3W5YA 1M1KT 5A8KB 4M5HA 4CLUA 1B7FA 3MURP 4ETXA 1TKZA 2MTLA 2MZRA 3FEYB 4U6PA 5E3CA 3B8HA 3H8YA 1ZA1B 1JLAB 2EFPA 1WUUA 2VG5A 4NCGB 1N34F 4QWAA 2W25A 1HNVB 1TMMA 2QMWA 2V9KA 2ZZNA 4TU9A 3S7RA 4YFUA 5KT2A 1KQFB 1YIJS 1TUVA 3VGUA 4NA2A 3K59A 3PFOA 3ZZYA 4NWBA 1P8GA 3MR5A 1LWCA 2BRLA 1I5OB 5DM7Q 4M5NA 2MYFA 1S57A 3R6LB 4DXLA 3ZTPA 1VOMA 4OYMA 1H72C 3CDWA 3M6UA 5HP1A 2KYZA 1WI8A 2RH3A 5GMKa 3VWSA 1R6VA 1TKXB 3P3DA 2H51B 3CCMS 1WDDA 2IM0A 1LQ9A 2XMAA 2BJ8A 3BGRB 2W1BA 4DR3J 4EZ9A 4KE5A 3VGVA 5T7LA 4K4YA 1OQ3A 4DN0A 3DLGA 3GJQB 1HI1A 2YQ1A 2KFYA 4C8KA 2C2EA 3MHYA 2IIHA 4ICLB 2YTCA 5D0EA 2IMOA 2QO3A 3EGVA 4Q44A 2GS8A 2GIRA 3R5CA 3QNWB 2LEBA 3DLJA 2E5JA 4C9DA 1H2VZ 1YJWS 5DLFA 1KRPA 3CJ2A 5D0HA 2OUGA 3R9LA 4TYAA 2CG8A 4DL4A 1S9GB 1LWEA 3EM1A 2ZBRA 1HNWJ 2JFDA 2ZVIA 3OUYA 2D3UA 3IWNC 2C2NA 1RWOB 5J2NA 1B0VA 1IKVA 4QW8A 2YKMA 4JYAJ 3I96A 5ADZA 2HS0A 4DG1A 3DRSA 2BM0A 1RT5A 4ED6A 2H5JB 1TL1B 2HHPA 5KG3A 3C14A 4DL3A 2AGOA 4IFVB 1HHQA 1QVGR 4OHVA 2BJ7A 2RMLA 1HNXF 5KFSA 3CCRS 1EP4A 1WI6A 4YB5A 4HTJA 5EHHA 3FDSA 1O5JA 2IA0A 4P2SA 1KLMB 5J1EA 2CA9A 1RYSA 4O23A 2AYGA 3HT0A 1JKHB 2BVZA 2HFVA 3MPUB 1YJ7A 3DDNA 3T9NA 4F50A 1AT1B 4KH1B 3QLHA 1FJGF 1M5OC 2BANA 3JSBA 3OFFA 4ZVQB 4HTIA 4LF4J 1HW8A 3PO4A 4ZJQA 1YITS 3HSGA 3ZZZA 5DS7A 2HFNA 3J7Z5 2PDAA 3EDQB 2MKIA 1YVFA 4B02A 3I55S 4L72B 1NJWA 2XGQA 1N36J 4RNFA 4CO3A 3KMSA 4PYAA 2VBYA 3OQ2A 2WVCA 1U8SA 1R8AA 1U0HA 4OI0A 4P74A 1QUPA 4K4SA 4B3OB 1TZ0A 5BYQA 2HK2A 2ZOFA 2W2OP 3N5BA 3BM7A 2N4DA 4YDXA 2MZJA 4X64F 5DGBA 2C2OB 2CQPA 3I5BA 4X65F 2ZM6J 3CCJS 2E5HA 1RWXB 2H9ZA 2MQMA 4C8MA 2AEFA 2B8PA 1FXRA 4RBUA 2G1DA 2AHOB 3KJVA 1HR0F 3I56S 4KBIA 2K7KA 1JLGA 2IY5B 3Q2TC 2FVCA 3MM6A 4HR2A 1YRTA 2DGSA 1Z4UA 3JSMB 3BGFA 3CCUS 2L3MA 2Y1RI 4QIVA 1QSSA 2ZH8A 1FI4A 2NZCA 2EFGA 4QW9A 2VG7B 5KFWA 3HK2A 1FFWB 5J2MA 2QGFB 2F8MA 1U2FA 5HLFA 1TP7A 2AEMA 3FMWA 3UDVA 3MAQA 3W2WA 4CM0A 1ZS6A 4UF4A 3R8YA 1F9FA 3QT6A 5GAGU 1DBDA 2RUGA 4WIQA 5IM0B 2IJFA 3GYNA 3W7BA 2GMLA 3HHLC 3NAHA 4CO5A 4EI2A 5ETKA 1NK9A 4AYBD 1F9HA 2DH7A 5E3QA 4DV3J 1RT2A 1EJ7L 4X4UA 3TEGA 4FVMA 3THPA 3ZZTA 2KFZA 3IO1A 2RKIB 2ILZA 1J5OB 2OPQB 3GB0A 4RUBA 4TLQA 3OVSA 4WBFA 1T9TA 1N5TA 4KHPF 4DJBA 2FTRA 2UUAJ 4IQMA 3R5BA 1VJWA 3IRXB 1KTQA 3I0RA 4LF6J 4WP9A 1SUQA 4ZPVR 4GMKA 1GTEA 1LW2A 4ED4A 4FKYA 3ZTQA 2VC1A 3M8PA 3IM8A 3IMQJ 3C46A 1SJ1A 5HMYA 1JIHA 4AD6A 3MAAB 2BV3A 3RBEA 2E29A 2WSEC 4CNYA 3F41A 3G82B 4OYIA 5AXNA 2HMIB 1U1MA 2BJEA 1P1TA 2KU7A 2A1BA 2E5IA 2IYIA 5I3UA 3L9ZA 1GX5A 1OMSA 3ZZOA 2XMTA 2J7WA 2Z4PA 3R1HA 1QTNB 2I0XA 1UVJA 2VH7A 5KFMA 4CDIA 4ERDA 3D4JA 3TAMB 3TW0A 2AJ0A 2FGOA 1GH8A 3WHIA 3H4DA 2AP6A 3UFCX 5KFJA 3I4HX 2LU1A 3BV8A 1AW0A 4DLGA 2UXDF 2BKNA 3GMGA 1TKTA 2GCFA 3U02A 1RAHB 2ZE2B 1F3VA 1KR4A 4JI8F 2QMXA 2DCLA 1N0VC 3ONQA 2BABA 3J7AN 3M1VB 2V2ZA 3V4IB 1S0MA 2H4WB 4KGXB 4NMXA 1EZZB 1R0AA 4EUVA 2VIHA 1RKJA 2JH3A 3BSCA 1FD8A 4YY3F 3UI3A 3IBCB 3TJ9A 2XNRA 1UCNA 2VA2A 4NE9C 1RT7B 3KK2A 2MQNA 1RCXB 1WHWA 2X3GA 4K59A 1S76D 3SCIE 4ID8A 3M32A 3QGHA 2OSRA 5B7WA 3F44A 4HH1A 2BE9B 2CADA 2MKKA 2J8AA 1UA0A 2DHHA 1FEEA 3RB3A 4I4BA 2M3DA 5DG9A 2XULA 3LP1B 2XBPA 2W8KA 3GIRA 2L9WA 1Y7PA 1WHXA 2IMWP 2DXEA 1S6OA 3WIUA 1RWVB 1QAYA 2NSCA 3LA0A 4NXMF 3NAIA 2NR0A 4OFZA 5A8WA 3CDBA 2LQJA 3H90A 4LVOP 2NXEA 1CJKA 3DMJB 3W9JA 4J9SA 2DGXA 2HIQA 1K1QA 4HEA9 2ZOMA 3BZQA 1CJVB 4DFKA 1XJWB 5E3PA 5HJXA 4FPIA 5B0GA 1HQUA 2MMYA 4J9UE 1AB8A 5LJ3Y 1IBKF 3H2UB 3O2IA 5G4DA 2VUGA 2YBVA 3KLIB 3ETMA 2DNHA 4LFBJ 3CJSA 2HHVA 2CJQA 2RUSA 1Q79A 3QBCA 2FC9A 3UDEA 1IR1A 2Z8QA 1MROA 4HHHA 4DCJB 1R0BG 4JI5F 4NZ6A 2YWEA 4P52A 4PZVA 1RQ0A 4EMDA 3OTCA 2R7QA 2AZ3A 1HBUB 4QCLA 3HSDA 4ZIWA 3DI6A 1Q5VA 5KT7A 3M8ZA 3SCKE 3IR5B 5U47A 4JV5J 1VJQA 1SIWB 4Z7YA 1R43A 1K0TA 4PWDB 4RW6B 4CLLA 1R0CB 1VC6A 3QJJA 2PO4A 2RS2A 3ZZRA 4B3RF 4WK1A 3FBBA 2VPYB 2AJ2A 4F4AA 1D8YA 4C97A 3SCLE 2DNZA 5E0OA 2WW8A 2IDLA 3OL7A 4MYTA 4Z37A 4JI2F 4QJVA 1VYAA 4NRTA 4LF2A 3SDEA 2ZWPA 4NCBA 3H40A 4ED0A 3LP0A 1JJ2R 4A8KA 1T03A 5IC6B 2VQFJ 1B0TA 4YDDB 5KFEA 4KAIA 4ZVTB 1RTJA 3TQ1A 3DDIA 1XNQF 3SEOA 1PJ5A 4B9TA 3DRRA 2RDDA 1GXTA 3BKTA 4USIA 3H2LA 4DL0C 1XQIA 4Y2MA 2N4CA 4FF3A 2J5AA 2M5YA 4A8MP 3CIZA 3G6XA 3OHBA 1JLBA 1A6LA 1LOUA 3OL8A 2VF3A 4IG0B 4QIGA 1MWQA 5AXMA 4PG8A 5LM7E 4C3LA 2KM8B 4FNHA 1X9SA 1VMBA 4M5DA 4W92B 1C0TB 1DLOA 4FXWA 1IVZA 2QMUB 1XK8A 3TRGA 4HHJA 5LXRA 2QV6A 2ZH2A 3MFIA 1NJIT 1HPZB 1S6QA 3SMZA 4F3OA 1F6TA 2BJDA 5E2QA 3Q8QB 3RBDA 4IG3A 1XR7A 1Y4ZB 3SXLA 2DNPA 2UUCJ 4JI3J 1E6YB 1Y11A 2VPXB 2V94A 2J0SD 2EK1A 4Z2XA 2L9DA 1HWLA 1RTIB 1UVLA 2FVPA 2FZCB 3W8GA 3HVTB 1RWWB 3M2RA 5KFIA 5K8OA 3PX0A 2EXUA 1N52B 3G6ES 1SQGA 3A3NB 2XMJA 4UW2A 3OTOJ 5K9FA 3G96A 1YI2S 4DQIA 4ES1A 3O6QA 2GVDB 3SIPB 4OHWA 3KLFB 1FRMA 4LFCJ 3GILA 1HD1A 3TZYA 2FJDB 4HL9A 2K1RB 4CCHA 2V34A 3EWGA 2FHJA 1LXJA 1VQ8S 5EWGA 1SQFA 1P27B 1OYDA 4J7CA 3K0JA 4A8QA 3N01A 3PNIA 4MYUA 5DZ6A 2KG0A 1UWAA 4NLWA 1WTFA 1UTAA 3JB9k 4OL8A 5A8RB 3LF0A 3OFHA 1X4AA 2XWXA 2PE8A 1JK9B 1U1LA 1D1UA 2CQIA 2BYCA 3DOMA 1U0SA 3CD7A 4F4ZA 4OYXA 2MHNA 4B9UA 4JV1A 3W64A 1U25A 4LSLA 4KKOB 1S6PB 3ILJA 2JHEA 3KLVA 2L41A 2IAJA 5D8HB 3PVXA 1O0PA 3ILOA 3GIMA 2BW2A 4BCAA 1VQ6S 5KFNA 4LF8F 4FYDA 3IG1A 2CPZA 1RJJA 1FO1A 1VRUA 3GR1A 1RTZA 1VRTA 5JJBA 5KG1A 5E33A 1AZSA 2CPEA 5D15A 5D78A 5HK4A 2F1FA 3NCPA 5ETTA 3I9V9 1FDAA 1EETA 4NPOA 4C0OC 5C42A 2MZQA 3UDLA 3CJ5A 2R4FA 2GVZB 1FWLA 1QDUB 3QGIA 1S9EB 3HJFA 1RK8A 3QRPA 2DR5A 3JTPA 3NNCA 1FESA 1FX2A 3RU0A 1MU2A 3V6JA 2W4PA 1RABB 4ENOA 3DOLA 1WEYA 3NS7B 3P96A 2I5JA 5C5JA 2RE1A 3L4BC 3UDCA 2VJVA 4QZVB 1F5BA 4KFBA 3IAM9 2MKHA 1BQMA 5GAEI 1FRXA 4QU6A 1BY9A 1OQ6A 5LMNF 3HDSA 3HP6A 1P1LA 5KFUA 1UEUA 3BJYA 3HSJA 2QYCA 1DTQA 2M8DB 4HDHA 1HBNB 2D1CA 5D77A 2Y8YA 5B0CA 5DRKA 1SC3B 1LW0B 1I94F 3R7SB 5EN1A 3O1LA 2VQEJ 3W3SA 4DV5F 4ZP8A 3AD9C 5KFVA 3PO5A 3Q8SB 4F02A 4JI0J 2OIHA 1UKUA 2RDJA 5CA5A 2JEGA 3G6YA 2B9YA 4R25A 4OZ3A 3DLEA 2YKPA 4UOHA 4NLQA 1C2PA 1NDKA 2EC2A 3FSYA 1NCLA 1TL7B 4X66F 2LU2A 1HW9A 1X31C 5LXYA 4NEZA 1RHRB 3QIPB 5C25B 1O8BA 1YBAA 4CIOA 4ED5A 4A4JA 1U1QA 3IS9A 3JQKA 4M5GA 2E1RA 3MUMP 1TR0A 3H98A 3M2VB 1U45A 2NXNA 1N32J 1S5ZA 1OIAA 2G1HA 2ASDA 5D3GA 2EKNA 3RYLA 2KN4A 2XHWA 4TKTA 2W9CB 4FYWB 1RTHA 2M52A 4P75A 2A6OA 4I7FB 5A0YB 2DH8A 2V4RA 3KK3B 1XMBA 3EXYA 3QT7A 3FQLA 3FNNA 4OI2A 3ZFVA 4ILMA 1NBEB 4O0NA 1HQEB 3MEGB 4FBTA 2WRMA 2V9WA 3UD4P 1WOOA 2HRYA 4USMA 3BGUA 3D3CJ 2QA4S 4O4GA 1XTZA 3H25A 4TY8B 4DS4A 2ZH7A 3TJ8A 4RW4B 2OD4A 1M5SA 3TZWA 2ALZA 4F7VA 1PAEX 3KJQB 4LREA 2X1AA 5IWAJ 2BX6A 2OHDA 4LQ9A 1CC7A 4F26A 2MQQA 1R8HA 5F8MA 4C0HA 1G4CA 3AODA 4K4UA 3J80U 1V6HA 5FIIA 4CLWA 4WTYA 3KYLA 2ZH3A 4OYAA 4KPCA 4JV2A 1S1WB 2GFFA 1UEKA 4I68A 1N5YB 2XS2A 1UWBA 2Q79A 1CJTB 1GXUA 5M2PA 1EHWA 4GKKF 4ZPCA 2DIUA 1PG5B 1DQ8A 1NNDA 5AE3A 4Y0FA 4Q45A 4JI6J 3N79A 3DGVA 5KTQA 4K5RA 3HHKA 4OZ1A 4KGKA 2V68A 2MSTA 4CH0S 2YY3A 3V2UC 2FB0A 2NYHA 4ETZA 1S1TA 4K50A 2Y9HA 3DCAA 4RBTA 3NWRA 4P2FA 4NEYA 1TMJA 1ROFA 1IQTA 3B78A 1WELA 2JNJA 3ZNUA 5J2MB 1KLNA 4ZPAA 3VAHA 1Q7YT 4Y65A 5KT3A 2HWTA 4RUCA 2M70A 4MFBB 2G13A 3KDOA 3QO9A 1LEOA 3CDEA 4B9MA 2HSEB 2Z2ZA 1VGYA 4RU9A 4DFMA 2MGZA 3D5MA 1U2CA 1HWUA 1QTMA 1DURA 4OMFG 1PYOB 2HZVA 3ENAA 2RQKA 2HRTA 2O67A 1GX6A 2RHQB 4H4OA 3ZNJ1 2ADCA 3V4MA 5SUHA 2IPOB 1W26A 1GNKA 5LJ5Y 2D3ZA 2GJFA 1WC6A 4LBHA 1FNMA 3CIMA 2R3VA 4KB7A 5KFLA 5KFPA 2BQRA 1R31A 4YEAA 2RF2B 2KT5A 5FDLB 4GO5X 4GVBB 3JS9A 1DAXA 1WSVA 2B4UA 5BJRA 1G3OA 2LXUA 4EEYA 1UFLA 3PRDA 3GFZA 2KHCA 2PI4A 1QUVA 4G6VB 2ZBPA 4ELTA 3HMJG 4B3MJ 3GP9A 2Z56B 4DR7J 2DCUB 2VICA 3SBMA 3RZAA 5ITHA 5I3UB 3JTNA 4F0HA 4N8NA 2B6AB 4RL1A 1XMOJ 5ETMA 4ECZA 2FJXA 1U4BA 2QIFA 5B0AA 2XEXA 2UXCJ 2R2TA 4WFXA 1RAGB 4PUOA 3FZBA 3CCLS 1YDLA 4TLRA 3A8KA 3KLGB 3V6DB 4I2PA 1M5HA 1FTCA 4J9OA 2W9BB 1FRHA 5L1KA 5HBMB 2F65A 3C16B 2FLLA 2DXDA 4UOFA 3G9CA 2HLUA 1HMVA 1BC6A 2EBEA 3VF0B 2GV1A 1V3SA 1CQNA 2OPPA 4DR4F 3DYAA 4OYPA 4F67A 2D9OA 2AGPA 4JOUA 5M2RA 3UCZP 2NPIA 3ZZPA 4L73A 1R0AB 5B08A 2KJWA 3QPIA 2ZH5A 2ATCB 4L3KA 1KQSR 2ILYA 3U1LA 2FUG9 5HQLA 1RADB 3NEKA 2HHWA 4OJ1A 2RVJA 3HHLA 2J9DE 4GO7X 2M2BA 1H73A 1OY6A 2J6SA 5KFKA 1YJ9S 3AT1B 3Q8VA 2FHKA 1B99A 3T1YJ 3G6VA 1Q81T 4DR6F 2HBYB 1HBMA 4F8RA 1T11A 3CB4A 5KFDA 2EK6A 3LPYA 4XAKA 2L08A 4LFAJ 4FYVB 2G2ZA 4D3HA 4PWWA 2UVRA 3MCSA 2DR8A 3DOKB 2WOMB 4A8FA 1LWFB 3D6MB 3CC7S 2UV8G 1NB2A 2DRDA 1WWHA 3BQ2A 1S4FA 4FNIA 2M8HA 1GAOA 3BO3A 3EE3A 3UVJA 4DX5A 1S7IA 3TA2A 1FRJA 2GHPA 1CJKB 4GRSA 3D1HA 4RWWA 5GADU 3PEJA 2RB7A 3CD5A 4A47A 2WONA 1B0PA 4J37A 1H6KX 2HGNA 1SL2A 2J8SA 2CIMA 4ZPBA 2LCWA 1MG7A 1RWNB 2AYMA 2NLWA 1OSCA 1AYEA 1HQUB 2HQ3A 3BO2A 1Q95G 5L1IA 3RW6A 4AE5A 1DQAA 3E8OA 1FRKA 1FDNA 3IWLA 3A12A 5HROB 3KG0A 2UUBJ 4CO0A 1YX2A 3E01B 1PKUA 1NLKL 1JXLA 1URNA 2ZKUA 1WACA 2ZH9A 5DDOC 1SJFA 2WAQD 3NBPB 3K8VA 1RYRA 4TQSA 3MECA 3QYYA 2FJEB 2D41A 2O01C 4LF9J 3S1TA 2NPFA 1NKCA 1UEVA 1UW9A 2XY7A 2DHAA 2OAUA 1JJ4A 4M63A 4CT8A 4NYPA 3AD7C 4F3QA 1FF2A 5DG7A 5MAOA 3MTJA 1HNZF 2PMWA 1ACMB 3LW5C 3MMCB 2JL9A 4JI4J 1KDNA 2AYBA 3I82A 2V50A 4AL7A 4C2MA 3IN5A 2YNFA 2HFZA 1KVIA 1EAYC 1UETA 3DLHA 3GFYA 4OLOA 1ZYQA 1RT4A 3C66A 2MLXA 1V9OA 5L1JA 3DXBA 3EUNA 4IO1A 5IT4A 4LRAA 4WFYA 3QFHA 4NASA 1HNWF 2ZHAA 2J76E 5D0RA 4OZ2A 4OX9J 3Q8RB 2EFNA 4GC6A 3RRHA 3FRYA 3X1LB 2V63A 4OI4A 2ZEJA 4ZVHA 3QRRA 2GAHC 3POTB 4HT5A 5AJ3F 3RJMB 2ZBCA 1EX8A 3MM7B 2A10A 5KOWA 4ELUA 2UZAA 1XNRJ 1WHVA 3NWGA 4EWTA 3FVYA 3BKUA 1X4HA 1IWGA 4ZLLA 4KJIA 3QAEA 5H9EK 3V81A 3KHHA 3JQJA 1FK9A 2ZZMA 1X4BA 4XTTA 2XMWA 2MQLA 3LAKA 3L09A 2DPIA 2ZUGA 3TX0A 3IGNA 2GJ2A 3EYZA 4ZLJA 1PCAA 2BA9A 1C1BA 1LK5A 2HHHF 3PJ9A 1X9WA 2XI2A 3P5TL 4WF9Q 2LDIA 1RT6B 4ECXA 5JUMA 1N6QA 5F8LA 1WC5A 1U47A 5K14B 4KV8A 3J7YU 2CQ0A 1VFJA 2E7XA 3QFWA 3K5PA 1RA7A 5L39A 4NRUA 4Q0BA 2EEYA 3DLKB 2DITA 5KT6A 4LSNA 1X4FA 3BR8A 4DF4A 1T9WA 2VPWB 3NGTA 2DR7A 4OX6A 3QRQA 1J5EF 4XPCA 3BQ1A 1UPPA 4NI2A 3F56A 3NGRA 2FQQB 2ZM6F 3EZOA 4DUYJ 2R2RA 5I42A 2R7RA 3LWLA 3OXGA 3PV8A 2B5JB 3SV4A 1N8RT 2N3LA 1SL1A 3CMQA 1KBRA 3G2XA 3OR2A 3MI7X 2YNIB 5T14A 1TK8A 4OJGA 2ZHBA 5BR8J 3OLAA 4ECSA 2RIJA 4LF1A 3ISND 1IM6A 1UZDA 2XSFA 2DR6A 4CO4A 1N0UA 1ZH5A 4N8OA 3PCOB 3GU0A 5HAOA 3ZZ0A 1X8DA 4U8VA 5DGAA 2E5LF 5KG6A 3C15A 5GAHU 3RB4A 1Z1ZA 3H5YA 4NLPA 3NGKA 2R8GA 3BH6B 4DSFA 4DV4F 3AQOA 1QM9A 3DFEA 3DGPA 5EDWA 2B0GA 4C48A 1Q53A 2Q6BA 1BGXT 2CVEA 3W2VB 1DARA 3C6TA 2MKSA 4C8LA 4QIFA 4Y2KA 3AJ1A 3MM5A 4QR1A 1AFJA 3V5RA 3AA9A 1FWPA 2GGPB 2XMMA 1PO6A 2DEIA 5J2QA 3GPAA 3RAXA 4ZCLA 5ETOA 1JLQB 1S1UB 2AWZA 2QLJB 4ZLNA 4WPAA 1SIZA 5LL6d 3R27A 1WKJA 3T1HF 1T94A 3DHWC 3ZTRA 2CQ1A 3IXQA 4F3MA 3HHNB 1GXLA 2QL5B 1S1VB 3LANA 2F5GA 2VFUA 3JQMA 2P6TA 3CCZA 1RT1A 1YZ7A 2CJAA 4DSEA 2CFXA 4JUZA 2HNZA 4PYDA 4PQAA 2XS5A 1BQNB 2ZHOA 2QLFB 4DI6A 1T9VA 4F36A 1CQMA 4DHVA 4J90A 1APSA 3GLJA 2AX0A 2LEAA 2PN6A 1NM2A 1U1KA 4NMLA 1QJHA 2MDAA 3RR7A 3M30A 2W24A 2JJ4D 4IRKA 2B4OA 4DR5F 4RW7B 5LT5A 3ULHA 3LWMA 2WB4A 5B0BA 1YBUA 1OWXA 1CC8A 4NLOA 4K0KF 4ZVEA 1K9MT 3LH2S 3A8EA 1HNXJ 2K3IA 4M94A 2F4FA 2JLGA 2UXBF 2IM2A 1RA6A 2WCXA 4UY85 4V19J 1CJUB 3AOAA 1GFWB 1FJGJ 4QIEA 3VAGA 2ZZTA 1A0OB 2KHDA 1RTDA 2DXFA 3EMTA 5EGYA 3KK1B 1KHWA 1BQXA 4QWCA 2CJXB 1RU2A 2HQGA 4KH0B 1TV6A 1QE1A 4QIWD 5F41A 4K4TA 2KM8C 5BYSA 3OL9A 3K7RA 3KLEB 2HZAA 2B9EA 2EI5A 2ROPA 5J2PB 2M4MA 3FC9A 5F0WA 3GSIA 2UUTA 3JXOA 3P49B 3QAUA 1JLEA 2XLJA 1S1XA 5CD4A 3TX8A 1F2GA 2Z2YB 1Q86T 3VHQA 1RT3A 1XN9A 4CLSA 4X64J 2CRLA 2QN6B 2DGWA 2OP5A 4NLSA 1KOHA 3NS6A 4X65J 4ID5B 2VG6A 1QY7A 3MR6A 1JJCB 4OYOA 3DLBA 3N6NA 4DS5A 2YX7A 2KT3A 4DZDA 3N0VA 2FIUA 3N5FA 1HR0J 4NLXA 3ET6A 1KKHA 3GFHA 3I87A 4DR1F 2HHXA 4YR3A 2AJ4A 3RAMA 5C24A 1Z2ZA 1RKIA 4PPDA 1FRIA 2BE2B 3R7BB 4WXWA 3PW5A 2AJQA 2O5DA 4WE1B 2FJVA 4C11B 2GX8A 5D6GA 1U02A 3KG1A 4HACA 1UVIA 4DU8A 1TFWA 1PBAA 2AT1B 1RZMA 3BS9A 3ZO7A 1M0SA 3CC2S 4NZ7A 1JWWA 1N5QA 1V5IB 2KO1A 1KHVA 5KFGA 2A6MA 2XSJA 2YNHB 2QTWA 4LVNP 1UP1A 3U1NA 3FKBA 2HHQA 2GMHA 3QT5A 3OV7A 4WKYA 3KHRA 2ZJQQ 2RRNA 2L9NA 4ANDA 4KHPJ 2EBGA 3I4PA 4KO0B 2RHSB 2R8HA 1KWMA 1H0HB 4EO6A 1GMVA 4JB8B 2OJ3A 3W60A 4OIXA 1UZHA 3K89A 1RUSA 1NJZA 5CZVA 1IR0A 4A8XA 2HIYA 2V6AA 3MEEB 4OYBA 4IDKB 3EPIA 2B4PA 1NSQA 2E1MC 5C2CA 2RSQA 1FT8A 3VV2B 3N28A 3RGIA 1VQLS 2CAJA 2OEJA 4MKBA 3K57A 5FLXY 1I6JA 2FVQA 2KB2A 3FFIB 1VC0A 2VFTA 3PKMA 1C0UB 5F3ZA 2FLNA 1DZ5A 1S0OA 2GQCA 3I0SB 3W61A 5KG7A 2UXDJ 2V4JA 4IFYA 4K5SA 1ZM2A 3E51A 2J7UA 4Y34A 3BSAA 4TQRA 3SFGA 3Q89A 2NXJA 1G6BA 3H2VE 4HT7A 3Q86A 4JI8J 4TU7A 5SZTA 4DX8H 2CNKB 4WTOB 4JI7F 4JI3F 2PMHA 1Q7LB 4OQJA 1X60A 1GMWD 1IM4A 4C8ZA 3EXCX 2Z2MA 3BH7B 2AJFE 1FCAA 2DEJA 3DLLQ 2MKYA 1TU0B 4WP3A 4YY3J 1FVQA 3OTOF 4Y28C 3M8QA 1EKSA 5HMXA 4MK8A 2Y0BB 5KFYA 2WVDA 5IOLA 1S12A 3SYZA 2PD1A 4F4KA 1HNIA 3BO4A 1RWKB 3MCNA 2WK4A 5KG2A 1D8ZA 1R8PA 5L1LA 2Y0SD 3GJTB 2A18A 4R0JA 3CC4S 3O5TB 3LGMA 2FVSA 3CO9A 2WSFC 3W66A 1JLCA 1T0TV 2QT7A 4EO8A 2EW9A 2HNYA 2JEIA 3SSRA 4WK3A 3W65A 2MZTA 4FBUA 1ZZNA 2H5IB 1N5SA 1VIOA 1TVRA 4CI0B 4NXMJ 2XLKA 5A8KA 1ZM3A 2CQ2A 2AMCB 2LYVA 2MEWA 1T9UA 3VALA 4S0MA 1PYTA 1AFIA 5KFHA 1P9QC 3OR1B 2QA4G 1RAIB 4RJVA 4KHMA 4K4VA 3OTDA 3IRWP 2MZ1A 1T05B 3PACA 1HD0A 3DNCA 2VU5A 3DRPB 1JLAA 1U09A 1HBOB 1Q5YA 3T6BA 2VBXA 4NCGA 1HYSB 4P6QA 5IT0A 1HNVA 4BWJA 3QSYB 1IBKJ 2E1CA 1UVMA 2J9EA 3QQCD 2Q43A 5FJ4A 4ED7A 3ZTOA 2XQCA
chains in the Genus database with same CATH topology
1LW0B 1LWFA 4P7VA 4M1KA 3IAS9 1D9DA 5CYQB 3NNHA 2ZH4A 3CGIA 4K2XA 1I94F 2RD5C 2C42A 7FDRA 1HA1A 3CCES 4DV0F 5EN1A 1W2IA 3O1LA 2HHSA 3H5UA 3LAMA 1Q82T 1R7IA 3W3SA 4DV5F 1UJ6A 2J6TA 2JEJA 5IT9Y 4ZP8A 1FDDA 5KFVA 4IQXA 3PO5A 3Q8SB 2D74B 1FDBA 4F02A 1N4LA 3HPOA 2V8VA 3THTA 1LV5A 5E3RA 3M05A 3MMBA 3PDNA 3JAMY 3MPYA 5HN0A 2EG2A 5A8WB 3M2UB 1TKXA 2OIHA 2DVIA 1UKUA 2E9ZA 4ZA1A 5HO4A 1W25A 5CA5A 2RDJA 2FY1A 2JEGA 2JLEA 5AXLA 3G6YA 1F0XA 2B9YA 4R25A 5KFRA 2DJWA 1UVNA 3IA0A 3DLEA 4OV1A 3R5DA 2YKPA 1Q16B 1REVA 3BGRA 1S77D 3PIPQ 2UV8A 4NLQA 1C2PA 3D2WA 4N41A 4BS2A 2KVIA 3MEDA 1Q4RA 5F8IA 2WBMA 2C3UA 3FSYA 2KXHA 3SI8A 4A46A 2OPRB 5JVGQ 5KOXA 4X66F 4R8UA 2LU2A 1HW9A 5EX3A 4FF2A 3HO1A 4ILRA 5LXYA 3HHEA 4PPZA 4L3NA 5C25B 2F40A 3QIPB 5L9NA 1RTDB 3HVAA 3PXGa 1O8BA 4OHYA 4ICLA 4ZPTR 1YBAA 3PR5B 3LP2A 1Y0HA 1VQKS 1N54B 2LXIA 4CIOA 2CYYA 4A4JA 3CCWA 1U1QA 4ED5A 4FS1A 3IS9A 1N88A 1Q8BA 1TV6B 2VKRA 1QE1B 1RAJA 3CJ4A 3T1YF 2HYIB 2NUHA 1DJ0A 2E1RA 4IYQA 2HWIA 3MUMP 1FJ7A 1HFEL 1TR0A 2RQMA 3H98A 3M2VB 1U45A 1VBYA 2JOQA 3PIOQ 1AROP 1FERA 1OIAA 5E5NA 4C7QA 2ASDA 1K0VA 5D3GA 2R2SA 5DG8A 3I6PA 4LFAF 2CVIA 4PG4A 2KN4A 3RYLA 4JI1F 2FLOA 2XHWA 3MM8B 4BBYA 4TKTA 2UP1A 2KFNA 1IJEB 5HROA 2W9CB 5LSLA 3KNGA 1QSYA 1XR5A 3CWJA 1FKOB 1ZAXA 3SQGB 3E01A 3I9ZA 3R3TA 1RTHA 1S9GA 2HNDB 1Y5LB 3MZIA 2GHWA 4F2SA 4DFJA 2CKWA 2KKHA 2M52A 3OTEA 3U7JA 2ERRA 2PIIA 2HVIA 4H4MA 4ILLA 1MROB 1JLEB 5LSOA 2EKYA 3D0GE 5HL7Q 2W4DA 3RB6A 4EU0A 3AAWB 3GIKA 1S1XB 5KFTA 4C3KA 1R27B 4PG7A 3NBPA 4I7FB 4QU7A 5A0YB 2DH8A 2V4RA 4A48A 3KK3B 3FMBA 3QJLA 1UAWA 2XZWA 1S0NA 1XMBA 3OFGA 1TL3A 2R7VA 3EXYA 4QQBA 3T1AA 3C2PA 1RT3B 1U48A 1N48A 3OHAA 1GT8A 3B82A 3FQLA 4KT0C 4JI0F 1VK3A 3DC2A 3FNNA 4IR9A 2JC0A 4FXDA 3EPGA 4NA3A 4OI2A 4IRDA 4ZVFA 2HS4A 2AW0A 2B9WA 2PGCA 3ZFVA 3CUNA 2MKCA 4ILMA 2MJNA 3DI6B 5K8MA 4OX7A 1HQEB 3MEGB 4FBTA 1XBWA 2JRSA 3TUJC 1NK7A 2JX2A 2WRMA 4H4KA 5H9FJ 2V9WA 3UD4P 2ZJPQ 4WIIA 4AUKA 3QMQA 3PY8A 2POKA 4DR3F 2HRYA 1FKPA 3BGUA 1NH8A 3J7A1 4IFVA 2QA4S 4O4GA 2IM1A 3HXMA 4KTQA 4DPOA 1XTZA 1YG0A 1SQEA 3ENQA 3NCRA 3H25A 5F8HA 3MD3A 4TY8B 2YNFB 4DS4A 1U26A 1HBUA 3ICLA 2ZH7A 1KFDA 4Q8EA 2EFQA 2V8GA 4RW4B 4WFAQ 4DSJA 4DSLA 4IUFA 2OD4A 1XMQF 1M5SA 1U7LA 4DN9A 5C24B 4J9KA 3GV7B 1KLMA 2ALZA 3MMCA 4H54A 4X4QA 1IQZA 4WFBQ 1JKHA 1V3ZA 5A6WA 1YJTA 2OMOA 5KT5A 4CQ1A 5CCMA 4R5PB 4NLGA 2X1AA 1JNRB 1R6YA 4QOTA 4NYOA 2ZNYA 4N5SA 3PW7A 3NL0A 4MIBA 2OSQA 4UQGA 1IKXA 1SBRA 1ZPVA 1NZAA 3IR7B 5H9EJ 3Q24A 4RW9A 2K2PA 4LQ9A 3G8TA 2LKZA 1VQNS 1CC7A 4F26A 2MQQA 1R8HA 5F8MA 5MLCV 3VAMA 3S8SA 1VBZA 4C0HA 4EGLA 1UL3A 1E6VB 4K4UA 3M9MB 2HRUA 4KIAA 3SDEB 1P6TA 1V6HA 5FIIA 1SH3A 2FLPA 2Z0GA 4WTYA 4U7UK 3Q2SC 3E3XA 3LP0B 4DUZF 4Y6IA 3KYLA 1T03B 2FC8A 1KN6A 1F5AA 2I2YA 2XI3A 4PQUB 2ZH3A 4M8LA 4MIWA 1M5VC 1TL5A 1DQ9A 1Q8IA 3DU6A 5KFBA 4JV2A 3H5XA 1S1WB 2GFFA 3G4SS 4J9PA 4X4SA 1RWUA 1CPZA 2DNQA 4I68A 2LDYA 1RTJB 2RILA 3JYTB 1N5YB 2WB1D 1FD2A 2OPSA 4LUBA 4JYAF 4KSEB 1NO8A 1YJVA 4LF9F 3A1YG 2XS2A 3LGNA 2KRRA 3POTA 3KFWX 2BQ3A 1ULRA 5G0RA 1UWBA 3DRRB 3MM7A 1K73T 4PRFA 4DBQA 2R7OA 2Q79A 4DF8A 3GIIA 4MH8A 1PILA 4Q2MA 2CZVC 2XGPA 2XSJB 1GXUA 5M2PA 3QZ8A 1WF2A 4XDDA 4GKKF 2NUUG 2G0CA 4B3OA 4ZPCA 3HM9A 2DIUA 2LMIA 1O51A 1SV5A 1DQ8A 1JLBB 1NNDA 1C1BB 3O8WA 5AE3A 1TAQA 1S48A 4Y0FA 4Q43A 2IJNA 3TAQA 4Q45A 4O3NA 2MY7A 4ZOSA 3D1OA 2DHXA 2ZNZA 2E7WA 4YHHF 3N79A 5KTQA 2HVZA 1M90T 1HWIA 4K5RA 2ATLA 4URSA 3HHKA 3TI0A 2PT0A 4OZ1A 5K8NA 3CTRA 3EGNA 4IH5A 4KGKA 4ES3A 6FDRA 2RRAA 2MSTA 3CJ0A 2YY3A 4CH0S 2R8KA 4JI4F 3V2UC 3QGPA 3V6KA 2C2DA 4DL5A 4M5DB 3SFUA 2A2DA 5K5MA 2FB0A 3TARA 2HW3A 1DLOB 1FKAF 5IWAF 2EWHA 3WC0A 4ETZA 1S1TA 4K50A 4RLEA 3DCAA 2ZOGA 1H38A 2MHEA 1S6QB 2G9OA 3EGZA 4RBTA 2ZC3A 3KHLA 4LF4F 4Y2CA 5L38A 4AL5A 1RT6A 2EPIA 4JBCA 1FHTA 2YKNA 3BN7A 3FRZA 4B9VA 4QBUA 1JB0C 2XO7A 4IG3B 1TAUA 1H7XA 5KG4A 1ROFA 1IQTA 3B78A 1WELA 3MMAB 2GQ2A 1JLFA 1JJHA 2M7SA 2DIVA 5J2MB 1KLNA 2VPZB 4ZPAA 3JSMA 3VAHA 4NOHA 5K14A 3GFXA 1Q7YT 4Y65A 5KT3A 4K4ZA 2XMKA 2HWTA 4RUCA 2M70A 4MFBB 3KTQA 2G13A 3NS5A 3QO9A 1R8CA 1N36F 4C4WA 3CDEA 4IOBA 3Q0AA 2BQUA 4B9MA 3WC2A 4YUDA 3NCQA 3DLKA 1WF0A 1VQMS 2IA6A 3M2RB 2COLA 1FRLA 2VG7A 1VGYA 2XWYA 5E41A 1T3OA 4RU9A 1ZBTA 2KG1A 4DFMA 2MGZA 3K5OA 1IXKA 3D5MA 1ELOA 2YNGB 1YHQS 2C3MA 2ZVSA 4ZHRB 2CPIA 4FPRA 1HWUA 2K7JA 2XG8A 1QTMA 1DURA 4OMFG 3ENVA 4ECTA 2DGQA 1AXQA 1FEHA 1XNRF 4NLTA 3GG1A 1NK8A 2RQKA 1DTTB 2JLFA 1IUJA 3ITHB 1Y9OA 3MWBA 2XCPA 2O67A 3OXLA 4KRWA 4Y2AA 1GX6A 2FGCA 2ZD1A 2AV5A 1SC6A 4O44B 3TP2A 5IM0A 4H4OA 1Q78A 4ES2A 4ED2A 1VQOS 4RNMA 4RW8B 3V4MA 1VLYA 2ADCA 1KTVA 3HVWA 4Q2LA 3C6UA 5SUHA 3RTVA 3BREA 2KH9A 2HZCA 3TYTA 2V4JB 4IFYB 2PA8D 1S97A 4MK9A 1GNKA 5LJ5Y 2D3ZA 2LECA 3ZZUA 2DGTA 1FNMA 4J9NA 3LALA 3CIMA 3CXCR 1J2VA 5JVHQ 4MKYA 2X1GA 1M5PC 3BF4A 4KB7A 5KFLA 5KFPA 2BQRA 1L3VA 2JVRA 4ZPWR 1FE4A 1U1OA 3GG0A 4IH7A 1R31A 2FHJD 3CCTA 4FP9A 2B5JA 4YEAA 2W7PA 2RKIA 4WJBA 1H2UX 1ZM9A 2RF2B 4IO9Q 2KT5A 4ECYA 3CEDA 1J5OA 5DDRC 2OPQA 5FDLB 2PC6A 4GO5X 1L3SA 4B3SF 2YWGA 1N5VA 1IBMF 1IKWB 1DAXA 2B4UA 3H20A 5BJRA 1G3OA 2DGOA 2LXUA 4EEYA 1UFLA 3JSRA 3T5KA 3K8WA 3PRDA 2YNIA 3GFZA 2KHCA 2PI4A 1QUVA 2BZ2A 4G6VB 2ROGA 2HG4A 3UQSA 2JVOA 4ELTA 4F4WA 4RKUC 4N56A 3HMJG 1T7PA 3NRBA 2LQ9A 4FZVA 2L48A 2VBZA 4O0IA 2F7VA 2VOPA 2CQDA 2DCUB 1YSJA 4ZKAA 1SXLA 3RZAA 3O3LA 4LSLB 5A2QY 3L7PA 5ITHA 4P7TA 5THWA 2XY6A 2C3YA 2FDNA 2DD8S 3OFEA 5I3UB 3MFHA 2OFHX 2X1FA 4G1PA 4UOCA 2RJZA 3JTNA 3GZ7A 2IAJB 4I2QA 2F4VF 3OXFA 1CLFA 3VAIA 4N8NA 2ACYA 2B6AB 2MKJA 3DM2A 2APOA 2ZFHA 5BYRA 3MM9B 4YB6A 4TYBA 3CDAA 3KLHB 1X4DA 2F8HA 4I6AA 2JWNA 4O3OA 3E2EA 2HMIA 2JZ5A 4J9RA 4DOZA 2OTJS 2KJVA 3MR2A 4G1QB 5EWFA 5F8NA 3M6VA 3M8QB 2Q1LA 1H98A 4ECZA 2ABYA 2FJXA 2CJ9A 4DSKA 1U4BA 5H1SV 3IG1B 2QIFA 1S72S 5B0AA 4AXIA 2XEXA 4EYHB 3FCHA 2OLWA 4ZCMA 2R2TA 1SI9A 2MQPA 4WFXA 2CPHA 2U1AA 1VRUB 1NKBA 4PUOA 3SSQA 3FZBA 1VRTB 3CCLS 4TLRA 2VL1A 4X4RA 2FJBB 3HHDA 3KLGB 4EFAC 7FD1A 3V6DB 4BC7A 1HNIB 4I2PA 4IH6A 3NNAA 1C4AA 1M5HA 5CYMA 3BQ0A 4DUYF 1A7GE 1FTCA 1C4CA 4J9OA 3TAMA 2FPHX 2W9BB 4K4WA 5FD1A 1CSJA 1FRHA 2CPXA 3JTOA 4DV3F 2XS7A 4FF4A 3BSNA 5L1KA 1EETB 2WTFA 5J2QB 3CE8A 3NLCA 5HBMB 3W2VA 5C42B 3OVBA 2I1RA 3LUYA 2FLLA 3OPKA 4X4VA 2DO0A 1VIXA 1ZETA 3G9CA 1JLCB 2BM1A 2HLUA 3TOQA 1L3UA 1HMVA 4X2BA 3CJKA 1WG1A 1BC6A 2EBEA 2IVMA 2FJAB 3VF0B 2GV1A 1V3SA 4NL5A 1N33F 1CQNA 2GGPA 2B7CB 2OPPA 2UUAF 4DR4F 3DYAA 2CQBA 2YKQA 2ZE2A 4HH0A 1SB6A 4F67A 5BR8F 4LF6F 4PXEA 2IC3A 4B3MF 3NMRA 2CPFA 1MU2B 2D9OA 2YH1A 2AGPA 4JOUA 1TVRB 2FJWA 2QSWA 5IZHA 2MSSA 5M2RA 1JLQA 3UCZP 1S1UA 3R5AA 1S6UA 4NYZA 2VOOA 3PR4A 4WCEQ 2DTJA 3DOLB 2NPIA 3NMAA 1M1KT 3ZZPA 4DV6F 5A8KB 3FEZA 3FZ2A 1U2RA 3HF5A 1U6FA 2I5JB 4CO1A 2PFFB 3WDOA 3CF5Q 1B7FA 3TVYA 1R0AB 5GVQA 3MURP 5B08A 2KJWA 4KFBB 4ETXA 4DWIA 3QPIA 2ZH5A 1TKZA 1KQSR 1IKYB 1OO0B 2ASJA 5HMZA 2ILYA 4J9QA 4H4KC 2ZJRQ 2MZRA 3U1LA 4CZCA 2FUG9 3FEYB 1MWZA 2YWKA 3L3CA 4U6PA 3HVRA 1VHFA 4I64A 3M1VA 1BQMB 2HHWA 5E3CA 3B8HA 1S1VA 4OJ1A 2RVJA 3HHLA 3V4IA 1VBXA 3H8YA 2J9DE 4GO7X 1M5KC 5D4OA 2M2BA 1JLAB 3VQSA 4NX9A 2ADBA 2EFPA 3T9ZA 3HZGA 5D4PA 2J6SA 4X4PA 2GMJA 5KFKA 1YJ9S 3PJWA 2VG5A 4NCGB 1N34F 1MSWD 3N6LA 3LO3A 4QWAA 2W25A 3EZUA 4PG6A 2FHKA 5CYJA 1HNVB 1CG2A 4A8OA 4OI3A 3G6VA 1Q81T 2QMWA 2V9KA 2ZZNA 4TU9A 4DR6F 4F8RA 1HBMA 3S7RA 1RDRA 2V0NA 3CB4A 5KFDA 4YFUA 5KT2A 4CTAB 2EK6A 1DTQB 3N6MA 1KQFB 1TUVA 3CCVS 4NA2A 1YIJS 3I5CA 1RT7A 3LPYA 1S7HA 2LLZA 2YQ3A 2HHUA 4OJHA 4XAKA 1VC5A 2L08A 4MK7A 1FXDA 3K59A 1BQNA 3CMES 3PFOA 3ZZYA 1X9MA 4NWBA 1P8GA 2LEPA 2MQOA 4D3HA 3T5HA 2VBWA 2F3JA 2UVRA 3MCSA 3MR5A 5KT4A 4NLRA 2Y1IA 2DR8A 3DOKB 2WOMB 3M6WA 3IBWA 3U27A 1LWCA 4A8FA 1LWFB 4USHA 4DQPA 3CT9A 2BRLA 4OZLA 5DM7Q 2MPUA 3CC7S 3MD1A 2UV8G 5B0DA 1X4GA 2MYFA 1WWHA 4KR0B 4QWDA 3BQ2A 3AH6A 2CDQA 1S4FA 2VODA 1VOMA 3HZEA 4FNIA 2M8HA 2NYIA 3CDWA 3M6UA 1GAOA 2NS1B 5HP1A 1LFWA 2KYZA 3BO3A 4X4TA 2AD9A 1WI8A 3M8SA 1SKSA 1SH2A 2HQIA 2EG1A 2RH3A 3D28A 3MMBB 5GMKa 3VWSA 2UVUA 4RW7A 1TKXB 3P3DA 2B4VA 3TA2