2KJWA

Solution structure and backbone dynamics of the permutant p54-55
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
96
structure length
96
Chain Sequence
MDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures and backbone dynamics of the ribosomal protein S6 and its permutant P(54-55)
pubmed doi rcsb
molecule keywords 30S ribosomal protein S6
molecule tags Ribosomal protein
source organism Thermus thermophilus
total genus 16
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kjwA00
4DV1F 4LF4F 1LOUA 5BR8F 3ZZPA 4JI0F 3T1YF 1IBLF 4DR2F 4B3SF 1N32F 1HNXF 1IJFB 3OTOF 1I94F 4JI4F 4JYAF 3T1HF 2UUAF 1QJHA 2BVZA 4DV4F 1FKAF 3R3TA 4LF8F 2UUCF 1XNQF 1N36F 4DV2F 1IBKF 4DR1F 2UUBF 1CQNA 2KJVA 2RJZA 4LF7F 2YY3A 4DR6F 4GKKF 1RISA 4DR5F 1FJGF 1XMQF 5LMUF 2F4VF 4JI6F 1HNZF 5IWAF 4DUYF 4NXMF 4B3MF 4JI3F 4JI1F 2UXBF 2UU9F 4DV0F 1B64A 5LMNF 2UXDF 4LF6F 1XNRF 2VQEF 1G7CB 1GH8A 1XMOF 1N34F 4DV7F 1G1XA 5AJ3F 4YHHF 4LF9F 4LF5F 4DV3F 1HR0F 4DV6F 2UXCF 1F60B 4DR3F 1CQMA 4JI8F 2B7CB 4JI2F 4DR7F 4NXNF 4YY3F 4LFAF 4B3RF 1J5EF 4X66F 2KJWA 4X64F 2HHHF 4JV5F 2BXJA 2ZM6F 2B7BB 2VQFF 4X62F 4DUZF 4KHPF 2E5LF 1IJEB 1IBMF 1N33F 4OX9F 2J5AA 4DR4F 4DV5F 4AQYF 4GKJF 4K0KF 1VMBA 4LFCF 4JI7F 1HNWF 4B3TF 4LFBF 4JI5F 4X65F
chains in the Genus database with same CATH superfamily
4Q44A 2HHHJ 2OPQA 2RHQB 1WNEA 4DJBA 3CEDA 4OZ1A 1IBLJ 4L6V3 1AFJA 3H59A 3CDBA 4USMA 4QWDA 1UPMB 1VJWA 2Y1RI 3E3XA 1Y5LB 1DTTB 4KYZA 4FF2A 1NSQA 4OI0A 5AE2A 2J0SD 1FD8A 3LP0A 4F25A 2OLWA 1YJ7A 5L1KA 2ZEJA 3SBMA 3KLHB 1RTJA 3KG0A 4EGLA 4ILRA 5F8NA 3SYZA 3DCAA 3VALA 3VAJA 1Z4UA 1QSLA 2Z2YB 1AZSB 3CNQP 3PRDA 1P1TA 3R97A 4CLPA 5J2PB 2CQGA 5HK4A 4F4AA 3Q8YA 1KOHA 3O3LA 1I5OB 4CLUA 4HHHA 2EXUA 1E6VB 3LH2S 4NI2B 2FLPA 1TL3A 5HLFB 3T5HA 2CKWA 4DS4A 3QBCA 2AQ4A 2NXNA 3TAQA 3F41A 4MKVA 1YRUA 3TAMB 1S4FA 3ICLA 3SZ2A 2NPFA 5KG0A 1Q0NA 4HDHA 1WC1A 4A8YA 4O4GA 2MHNA 1SBRA 1RWMB 3CCSS 4IRDA 5CZXA 4IRKA 4AT1B 3MFIA 2XB2D 4PWDA 1FJ7A 4U7UK 1WJ9A 2QV6A 3CC7S 2C3OA 2EFVA 3QJLA 3KLVA 4LBHA 3VZHA 2JJ4D 2Y1LB 4HH1A 2VQEF 3T6JA 5KOWA 2Z2MA 2E9RX 1TFYA 4Y65A 2HVIA 2R7OA 1Z2LA 1RA6A 4RW6A 2BJ8A 3NL0A 3VAIA 3K89A 2HIYA 1RT6A 2IVFB 1UZDA 2JEFA 2XZTB 3GV7B 3OTCA 2GJ2A 4ZVRB 4DPWA 2POKA 3KLGB 2A6MA 1N54B 3GLJA 4OZJA 2F9DA 2FUG9 3DU5A 4Q5VA 4DR2F 2DRAA 2MZQA 2AJ4A 4KGXB 1NK7A 5D77A 3RB6A 5B0AA 3R9LA 2MYFA 2WZ1A 4B9LA 2IBOA 1DAXA 1OQ3A 2G1HA 2ZJPQ 4LF2A 4I6AA 4KBIA 5EWFA 3EZ5A 2GVDB 3C6TB 1MMDA 2YY3A 3ZNJ1 2I38A 2GQCA 2AYGA 3D9BA 5T7LA 1HNZF 4RU2A 1RHMB 3MCNA 4OMFG 1RE1B 2C3PA 2PE8A 5B0FA 1VRTA 5H9EJ 4ID5A 4DCJB 3G96A 3RZAA 3S1TA 3DGPA 1RI7A 5D4OA 3Q8QB 4QYZJ 1M1HA 2V2ZA 3G2XA 1T8EA 3DOMA 1L3UA 4C7QA 1UWAA 1WTBA 5KFBA 3RBDA 4N8OA 3FMWA 4UF4A 2FHKA 1X4AA 4G65A 1RTDA 1RWOB 5K14B 2BW7A 2R7WA 3W3SA 3QGPA 4B3SF 1UFWA 2NS1B 4Q45A 2N4CA 2JZ5A 2CZ9A 2K8GA 2MXYA 4DG1A 4KH1B 3WZ0A 3MMBB 4FN5A 3EWGA 3Q86A 3ZZ0A 3DRXA 1RACB 2R9LA 5K9FA 4P72A 2A0FB 4BCAA 2PIIA 4KE5A 2OELA 1Q5YA 1TAUA 1ZAVA 1Y0HA 5GMKa 1S1UA 3VHQA 4RUAA 4F50A 4DPYA 4Q2LA 3W8GA 3KTQA 1G3OA 2AHOB 4JI2F 2C22A 1RAOA 5HO4A 4NXNJ 4AXJA 4X66J 1HNVB 2HHTA 5JVGQ 1JNRB 3GIMA 1X9MA 1WC3A 1Q8LA 3MM6A 4ED1A 4GKJF 2PT0A 3SQOP 2EVZA 1L3SA 5I3UA 5T14A 1LWCA 1DTQB 2DHGA 3QIPA 1VK3A 2MKYA 2OD4A 1W26A 3AOBA 3D1HA 3RR7A 1SJQA 1X31C 2Q6CA 3GCXP 1YI2S 4DV4F 1KR4A 1L5UA 1RK8A 1YBAA 1QD1A 3JSYA 1UA1A 2HFZA 1T94A 5LMUJ 3VR1A 4ZN3A 1FNMA 4JI3F 5KFLA 3DLHA 4JB8B 2EG2A 1FRJA 2NR0A 3LP2A 3VGTA 2HHVA 3NXZA 4URGA 3H42A 1OPZA 4AE5A 2CQBA 4OHWA 5CD4H 4CNYA 3NLCA 3KJVB 2CJBA 1KHWA 2QA1A 3KLHA 5DLGA 4ES3A 4WZQA 3PY8A 2B7BB 3HLUA 3I56S 4GRSA 4G1IA 2E5LJ 2FJAB 1AZSA 2KT2A 4F36A 3KHGA 1MW7A 3W2WB 2PDAA 4PG8A 3CW2C 5J2PA 4C98A 4EWTA 3BQ0A 2YWKA 2ADBA 1O0PA 1FRLA 4ECXA 2XMMA 1T05B 1BGXT 1E6VA 3GJQB 1HA1A 4NI2A 2CVIA 5HLFA 5IFMA 4X4UA 1DRZA 3OV7A 3P8BB 5HP1A 2ILYA 1WOSA 1RWNB 1N8RT 4ZITA 1RT5A 1NSPA 4ZPWR 1S7IA 1I51B 2BE7D 2YX1A 1XMQF 3TAMA 1NHVA 3ENAA 2JH3A 1H98A 3C8YA 4FVCA 4NXMF 3R8YA 3FSIA 3ADAC 5CYMB 3ZNUA 5HMXA 3W62A 2QL9B 1S5ZA 3L09A 1TL7B 1ZS6A 2HHHF 3GYGA 2DITA 3TX0A 2VA3A 1RLDA 4WJBA 1YJRA 4ECSA 2MGZB 4Z7CA 4B9NA 4DR3J 2GHWA 1RGVA 2R7SA 4O23A 5KG1A 1XR7A 2DGUA 1NK6A 3RYLA 1Q82T 1UFKA 1AUDA 4B9UA 3QO9B 1RTZA 1AROP 1DQ9A 2CPYA 4M95A 5HMZA 1LNQA 1TV6B 5IXUA 3BGLA 3PW7A 3M9OB 4CLWA 2L48A 1NB2A 3DYAA 2VPZB 3BV8A 5F41A 4LBPA 5D0GA 2DNQA 3I55S 1E6YB 3KLGA 3PW4A 4RW8B 2ZITA 3LGNA 3C19A 4OX6A 1RHKB 2DNYA 3ILIA 3TR5A 2UUBJ 4LF9J 3MM8B 3C6UB 3Q22A 3OTDA 2GVDA 3C6TA 1IKWB 4K4UA 3BBBA 4EBEA 5B0GA 2GO8A 3TW0A 4QIWD 2EFNA 3WQPA 3QT7A 2ACYA 3NGRA 3CCMS 5K5MA 4CDIA 1BWVA 4N56A 2XY5A 1QUVA 1RUSA 3OXFA 6FDRA 3DRYA 2HBYB 3OT9A 4K4SA 4C11B 1VDHA 2VC0A 1JLQA 2B8PA 3QZ8A 2R7RA 3K2YA 3GIJA 2F3JA 3SI8A 1S9FA 2ZH2A 2MQ8A 4DV5J 5HAOA 1QJHA 1U09A 1FKAF 1S48A 2HWIA 4KFBB 5GADU 4AFFA 2IMOA 1T03B 2V50A 3DLEB 2LKZA 3BSNA 4LQ3A 1P9YA 2OMLA 5I3PA 2W9CA 2FJBB 5K14A 3L7UA 5DM6Q 3M8PA 5H9FJ 4JI1F 2QA4G 1WF2A 2GX8A 4OYWA 4I68A 5DLFA 1UA0A 5B0CA 4F4WA 1NXIA 4URSA 4PXBA 2F4VJ 4DMZA 5DDPC 3HP6A 2G13A 2ZE2A 4X4VA 2LFVA 4NZ0A 2AEJA 4DSEA 3KK3B 2E44A 2XMWA 3KHLA 1NZAA 4OZLA 4RW4B 3V81B 2CZ4A 5CH7B 3D6HB 4IH7A 3IR6B 4ECVA 3R2DJ 4ERDA 1NBEB 2J6UA 2V5HG 3KJQB 3GIIA 4QPTA 1F6TA 1N6QA 3QGIA 1HNVA 4W4MA 5HI7A 1GMVA 1QSSA 3NWRA 3AB2B 4M5NA 4PYDA 2R7UA 2DGSA 1TVRA 4MJKA 4LF8F 3JB9k 1S77D 4ZLNA 2NPIA 2W2MP 1DURA 3S01A 1DTQA 2HNZA 4F7VA 2HQCA 2XM3A 5AT1B 3I9V9 3KDOA 3H90A 4NCGB 3G8SA 4A4JA 4PQUB 1YX2A 2C2RA 3M2RB 3UPFA 3VV2B 1KHVA 1KBRA 2RB7A 2OIHA 5KTQA 1ZOTA 1J5OB 1PYTA 2F65A 4TYBA 2HQGA 4P10A 3HX9A 1EZZB 3VQTA 4RNOA 1D9AA 5HJXA 2IRYA 4FYXB 2YNFB 4IKAA 3D3BJ 4CI0B 2DHSA 2QFJA 3KJVA 5LJ3Y 2MKJA 2Z4PA 4DUZJ 1Q78A 2KL8A 2DHHA 4KKOA 4DZDA 3FJ2A 2D3O1 3HSJA 4NE9C 2R3VA 2MHEA 4ZCLA 3R2CJ 3W2WA 1HW9A 3CD5A 2IRUA 3M8YA 2WSEC 4CQ1A 4CT8A 5K8OA 2ABYA 2CPIA 3PTWA 2XLJA 1GMUA 2LQ9A 1HWIA 1H6KX 4MFBB 3OFGA 3J81j 1T05A 2UU9J 3K5NA 3PKMA 2MSTA 2VU5A 4PCQA 4JUZA 3P96A 2BEFA 4GC7A 2V8PA 3A8EA 3TNVA 3E8OA 2PSZA 2K3IA 2VG7B 4CWBA 2BJEA 4HHUA 3NOCA 4K59A 5GAGI 4WXWA 3IFEA 5DRKA 4CLTA 2MKSA 1J27A 1M5SA 3OUYB 3BJYA 3VTIA 5ETQA 2UXCJ 5CYMA 1DJ0A 2L9DA 3CULA 1TL7A 2ZBRA 4URQU 4ANCA 5E0OA 3TO8A 3UFCX 2FIUA 1VHIA 1V6HA 3N01A 1IWAA 5KFTA 3QSYB 3UO0A 3AJ1A 4KPCA 1O51A 4UW2A 3Q8VA 4C6AA 4TYAA 1XR5A 4JI0J 1JLGB 2BYCA 1WF0A 4QYZK 2HFOA 3D6TB 1WI8A 4DLEA 3U02A 3LA0A 2M5YA 1YTYA 2X3DA 3B78A 3CT9A 3KDNA 1RA7A 1TV6A 3RR8A 1RT3A 2XLKA 4J37A 4TU7A 5EN1A 3QATA 2ZZTA 2XZWA 3EICA 2AX1A 2BE9B 3HF5A 3CCTA 4P75A 1E6YA 2AZ3A 4DL0C 1OMSA 2COLA 4RW8A 1RTHA 4OX8A 3DM2B 4RWWA 2EBEA 4BWJA 1SIWB 3OSNA 1IBMJ 4OYOA 3EPGA 3RW6A 1OYDA 4PYAA 2ADCA 3DDIA 3T3FA 5ITHA 2KRRA 3C6UA 1S1WB 4A8KA 3SEOA 3G6YA 3K59A 1IKWA 5C42B 1BQNB 2RSQA 1R31A 3ITHB 4O0NA 1FT8A 1B3TA 2H3EB 4DSLA 4FDFA 4KSEB 3T9ZA 3AA8A 1X5TA 2YKOA 3BO3A 2OEKA 4IFVB 1JLFA 2XHCA 4RUBA 2KYXA 4YQWA 1PCAA 4NYZA 2ATCB 4P71A 2FJWA 4DR5J 1X4FA 4C11A 3FDSA 3T41A 4ES1A 1U0SA 2OFHX 4FPIA 1A6LA 2Y0SD 3FUYA 3SXLA 3B8HA 4KFBA 4DR3F 4ZVHA 1T03A 3DLEA 1AFIA 3RRHA 3UCGA 2IJNA 2FZCB 1YRXA 3WX8A 3JYTB 4FXVA 2V67A 4ALZA 3DHWC 1ZYQA 3P4UB 1YBTA 5L39A 1YJTA 1RWPB 1HD0A 1U25A 4KQZA 3GYNA 3TVYA 1S1VB 1ZBTA 3NCRA 1U2FA 3HSGA 3FK4A 3IWXA 3DGVA 6FD1A 3PW2A 3RJMB 2XMAA 3KK3A 1H2VZ 3GYXB 3W5YA 3PRBA 3PJ9A 3BKUA 1HKAA 2AYMA 2UUBF 4RW4A 2AJ1A 2F7VA 3V81A 2CAJA 6AT1B 9ATCB 2V9KA 1HNXJ 2LA4A 2KYZA 2MKHA 4P52A 2LQ8A 2YKNB 4LJMA 2DNHA 4M5KA 5D0EA 3R5BA 2ZDOA 1NDCA 3IR7B 1FWKA 2RE1A 2FJEB 3K8VA 4QWAA 2DR9A 4LR8A 2B7CB 2DCUB 1VFJA 3THPA 1TK0A 1S0OA 3CIZA 3JS9A 5CA5A 3BM7A 1VQ5S 2GVZB 3MMAB 3JQKA 1T9WA 2GIFA 1JLCB 4DV5F 2OTJS 4PQUA 1Y5NB 3H5SA 4DV3J 5B0BA 1VQSA 4IDKB 1WEZA 1J5OA 1K1SA 5E5NA 3FRYA 4NLDA 4ECZA 4E8UA 2Y8WA 2VD3A 1RWVB 1OY6A 5KFRA 4NLXA 1TUWA 4JI4J 5IC6B 3KJFB 4JBCA 2RQCA 1BXNA 2M8HA 2YNFA 3T19A 4J90A 3C3LA 4MTPA 3CCLS 2OPPB 1F3FA 1IVZA 3CMAS 2F4VF 2RDDA 3KFWX 2VODA 1Q81T 2VBYA 4OL8A 2HQFA 1JLAB 2D3OR 2AU0A 3NOGA 2H4YB 2CNKB 1HR0J 4R8UB 2R42A 5LOQA 3SSSA 1RU1A 2BABA 3G8TA 3I32A 3UN3A 1JJCB 4MFBA 4NX9A 2GHPA 2IYIA 2WOMA 4YB1P 2VJUA 4DZ6A 3EZUA 3MAQA 5KFFA 2VOPA 4CYUB 3JSRA 4LFBF 2MY7A 2HGMA 2CFXA 2WB1D 2P6SA 3DRRB 4FKXA 2KB2A 4FPRA 1FNOA 2VG7A 3GSIA 2DGVA 3MCOA 2XG8A 2LA6A 2B56A 1RHQB 3ZZRA 3A4TA 1SQFA 3IS9B 3UNGC 4RW7A 1A7GE 1FTCA 3GP9A 4DWIA 4DR1F 1NSAA 4F8RA 1UL3A 1F9FA 2DGOA 2YH1A 1FERA 1XTZA 4JI6F 4OYIA 2YX7A 1F0XA 3I0SB 2QLWA 1IBKJ 2GS8A 2IRXA 3G8QA 2Q1LA 3HFZB 3CCVS 1YK9A 3GIKA 4QPXA 2CQHA 5KFMA 1JLGA 4AL5A 3RBEA 1HPZB 3J7AN 3H98A 5D0HA 4NLWA 4OI2A 3QAUA 3PFEA 2VQFF 3H7HB 4DUZF 3TP2A 3HHLC 2R2UA 3BREA 1SUQB 3MWBA 4Q2MA 3FKBA 1MWQA 1TUVA 5LSRA 3FCWA 3W65A 3DLJA 4QU7A 1VIOA 4B3TJ 5KG5A 4H4MB 3K57A 2MKCA 2F9JA 5H9FK 4Q8FA 3MPUB 3UR0A 1ZPVA 1UKUA 1N48A 1MMLA 2EW9A 5DQHA 4J9PA 3OTOF 3CXCR 3DM2A 1C1CA 3HPOA 2YNGB 2E5JA 1XK8A 2RU3A 2IBKA 3R3TA 3M05A 4WFNQ 2ZNYA 3PEHA 2DK2A 5C7PA 5LXRA 2Z56B 1IR2A 1ROFA 1S1WA 4K4XA 2GAGC 1WG4A 2VL1A 2B9XA 1TK8A 3ITHA 5A76A 3OJUA 1LW0B 5EHHA 4LIWA 5SZTA 2DY9A 4K4WA 2CG8A 3M8SA 2UXCF 5AJ3J 4IFVA 1N56A 1VRQC 3EDQB 4ZVOB 2JOQA 3KNGA 2DB1A 1HLWA 5HQMA 3KK1B 4EZ6A 4U67Q 3IBFB 1H0HB 4KJIA 2DJWA 3KXDA 3ZZZA 5IT9U 3BH7B 2EFQA 1AXQA 5FLXU 4JI0F 1X7VA 2CPXA 1OS5A 1JIHA 4ED5A 4EO8A 2NSBA 2AX0A 4L76A 3JYTA 3KHHA 4TQRA 3MDFA 2ERRA 4EK2A 1OSCA 3HHKA 1RWUA 1M90T 2QLJB 2L41A 1UW9A 2DIVA 2FVRA 1UVNA 1S79A 4OYXA 4CLZA 3GJTB 4ZCIA 2F4FA 2XCPA 1SL0A 2BRLA 1F5BA 2HSEB 5ETNA 1I3OB 1RT7B 4TN2A 3HT0A 1IKXB 1GH8A 4UOHA 4OI3A 3KKFA 1HQUB 3R6GB 2WVBA 1MWYA 3HDSA 4DV6J 4HACB 1SJRA 1B4SA 1B0PA 2AV5A 3W66A 4USTA 1VR6A 2WSCC 1MNEA 5IM0B 3DN9A 1HL6A 4J9LA 2YKNA 2EFOA 2XNQA 3CDWA 4CLFA 1CJTB 2CA9A 2FB0A 2G0IA 4ZDNA 3B54A 2AJQA 3T5JA 3TUIC 3N5BA 3BR9A 1WKKA 3CJRA 3ZO7A 5D4PA 4EUVA 2E5GA 1VJQA 1CS4B 1BLUA 1TR0A 4FS1A 1FDBA 3V4IB 3TJ8A 2IDEA 2GVZA 1LFWA 1NUEA 5HBMB 4ELVA 2EWHA 3MMAA 1IKYB 2R8KA 2MLXA 4K7QA 2DGWA 1JLCA 1U1RA 1TKTB 3EUNA 1VC6A 4C8KA 3GV5B 4IDKA 2XO6A 1JQGA 3MHYA 4D3HA 1JJ4A 5A0YB 3GZ7A 1B64A 4AD6A 4DSFA 5DZ6A 2RRNA 2RIJA 1RCOB 5HANA 1YITS 4I0WA 2WK4A 2LEPA 2E7WA 2OPPA 1J5EJ 1Y00A 4LUBA 4P2SA 3OXLA 2IYGA 3BH6B 2JSXA 1HHQA 3BO4A 2W4DA 1L3KA 3SQGB 4ZKAA 4I6YA 1JLAA 2QMWA 3W2VB 4AQYJ 3CD6S 2CUYA 2E5HA 2P9EA 1FA0A 3JTOA 3NKYA 4WK1A 3MEDA 4ZCMA 4OI4A 4U7UD 2IAJB 3FSXA 3MEEB 4R8UA 2FHJA 2LXFA 4ZHRB 5KFNA 1HNXF 1RADB 3PW5A 2AWZA 2FTRA 3UWTA 3RB4A 2XYPB 1FWPA 1I94F 4K0KJ 1WORA 2OPSB 2B6AB 2HNYB 4CYUA 2WB4A 4KB7A 2X1FA 4X4RA 3DRRA 1FJGJ 3KLIB 2HK3A 3AXKA 1Q7LB 4DUYJ 1YQHA 4ZVFA 1O5JA 4K5RA 3OPKA 3ENVA 3IS9A 1TP7A 4DV3F 1S99A 5KFOA 2VBZA 3I31A 1VQPS 1EETA 2MQOA 2R8HA 5A6WA 2W7AA 4JV1A 3ZTOA 2VFUA 2PI5A 3MTJA 1C4AA 3EGVA 2QX0A 3VWSA 1G6BA 2BZ2A 3I0SA 4ECYA 1UFLA 3I87A 2ZDPA 1YVFA 2YNIB 1APSA 4V19X 1HPZA 3BPDA 5T41A 1JJHA 4ZVEA 3GSDA 5C2GA 3V6KA 5HVHA 4Y34A 3DU6A 2KG0A 1SUQA 3HVRA 4LSNB 3AJDA 1VQLS 2J7WA 3IO1A 4RBTA 3CCZA 2QA4S 1RAFB 2KRBA 4H4MA 4IH6A 1ZTTA 5GAGU 2HHSA 4P2FA 3J7ZT 2X1GA 1QVGR 1NB7A 2BANA 2HMIA 3L3CA 2YNGA 2H48B 1LQ9A 3BO2A 2KM8B 2BQUA 3CO0P 5DGAA 1XIQA 4MK8A 1PIEA 3CDEA 1FI4A 2QIFA 3NY0A 1YBUA 4X64J 2VDHA 2FHJD 1KKHA 1HWJA 3QRQA 4X62F 2XS2A 2KZMA 5D3GB 2E29A 1LW0A 2ZC4A 3PYFA 1U8SA 2X51A 3D1QA 1DQ8A 4LFCJ 1X0FA 1VQ4S 1H72C 3CJ3A 2E9TA 3D5MA 2ASDA 1TL4A 2VDIA 3M2UA 2V8DA 2KVIA 2MKKA 4ITSA 2VBWA 1YZ6A 4H4KA 2F63A 1Z2ZA 2DH9A 2ZBCA 3IAS9 4ZVQB 2CQCA 1IBKF 2QRRA 1NJWA 5L46A 3BKTA 2HPUA 3N9UC 3PKYA 1XQIA 1S12A 1UVIA 4EYHB 3KMSA 3RB3A 4WP9A 2JEIA 2UXBJ 2EBGA 2BE2A 2FLLA 2LDIA 2KU7A 1X9SA 1S4EA 1F60B 1SC6A 3QJJA 1EP4B 4OQJA 5IT4A 3RUBL 1JKHB 1KFSA 3MPYA 2QLBB 3CCES 4CO0A 3D66A 4YB7A 1RT7A 1VOMA 5DDOC 4WBFA 2VHGA 1UVJA 1IKXA 4MIWA 3FEZA 2QLXA 4NL5A 4LVNP 4A8QA 1HQUA 4GMKA 4LREA 2JLFA 4QW8A 2Y1IA 5C24A 4HACA 4QJVA 4ILMA 5HL7Q 5FJ4A 5IM0A 1F1BB 1QUPA 2G9OA 4CH0S 4Q0BB 5SUHA 4NYOA 3N6MA 3A8IA 1CJTA 1D3WA 4ZJOA 4CCHA 5ETTA 4B17A 1A9NB 3ZTSA 4ANEA 2DTJA 3T1AA 5JJBA 1CS4A 3ZTRA 1YJVA 1OIAA 2W4CA 2FD2A 3I82A 3V4IA 3K0JA 2LEBA 3PVXA 4WFXA 5HBMA 4ED3A 1UETA 1IKYA 4C8ZA 4IOCQ 2CADA 1TKTA 4F3QA 2DNKA 2QJ3A 1PYSB 1CQMA 3M2VB 2KKHA 3D2WA 1EKSA 2C2KB 4NA1A 1D8YA 3PZPA 2RS8A 4YMEA 1X0PA 2V4JB 2YTCA 2E1AA 2XS5A 5A0YA 1NJXA 3K5OA 2QSWA 4DU7A 4J9KA 1T11A 3IN5A 4PG6A 4OV1A 5KG3A 4ZMMA 1RSCA 1KQSR 3GCWP 3OFFA 2F5GA 3CUNA 3L4BC 3PDNA 3S7RA 2HHWA 1KSPA 3CPWR 2BVZA 1RHUB 1DARA 3W2VA 2GQ2A 4NYPA 2HBRB 2RJZA 2CQ3A 4X4PA 4I2QB 1DY3A 3MEEA 4QIFA 2VJVA 4ZHRA 2E1CA 2BM0A 2EKNA 4ZVGA 3OL8A 1HQEA 2OPSA 4FZVA 2VQEJ 1A0OB 4OZ0A 1IN0A 1RTIB 2MDAA 2HNYA 3EVWA 2DHAA 3LP0B 5LSOA 3GTYX 3KLIA 3BGFA 2MEWA 2HQ3A 3OBIA 5EWEA 3CJQA 3GONA 3L95X 1SV5B 2AGOA 4X65F 4M94A 3BYRA 4CO2A 1UTAA 1FEEA 4RJVA 1QDUB 3G71S 1SH3A 1ZM9A 2NZCA 1YWXA 3OL6A 2BQRA 4OYZA 3W7BA 4Y6IA 2LECA 3P6YC 2Q43A 3H4DA 2YNIA 2LXUA 2X1BA 3LANA 3RAXA 1D9FA 4Q7AA 1S9EB 4KHMA 5HN0A 4NLRA 4GVLA 1ZM2A 2YPYA 3PEJA 4PG4A 3F56A 2OFGX 2BW2A 4LSNA 2VPXB 1N5VA 2J6SA 4C0OC 1R8CA 4C8LA 4JOUA 1QAJA 4HTJA 1PBAA 4ZPTR 1FE4A 2KJWA 3UDCA 3PM9A 3CJ8A 3FQKA 1R0CB 2RKIB 2AMCB 4F4KA 4RNFA 2J0WA 2ZOGA 1VQNS 5E41A 1WACA 4K0KF 2KI2A 2R2RA 4HLBA 1HNWF 1G2EA 1C1BB 2D74B 2B4VA 1O8BA 4PXCA 4MKBA 4GVBA 2OUGA 1CEZA 1WG5A 5KFKA 1I1GA 2ZM6J 2BRKA 4RW6B 4O44A 1NJZA 4B3SJ 4C4WA 1LXNA 1RHJB 4ZVPB 5D3GA 4FF1A 3TVZA 4UZBA 4J5OA 2CQ1A 4FVMA 5C2CA 1RT6B 3S8SA 4CP5A 2RUGA 3PJWA 1U48A 4HTIA 4QIEA 2HBQB 1S9GA 5M2RA 4ED0A 3AFGA 4HKQA 2IA6A 3NEKA 1D09B 5L1IA 2QEXS 3ETOA 2QL5B 3AQOA 4HI2A 1N4LA 2RNEA 1VS3A 2WVDA 2BDPA 3US5A 2M0GB 2CJQA 2C2MB 3VVTA 5HVFA 4ZN1A 1PJ7A 2JFKA 5KT6A 3A3NB 3M9MB 3TA0A 1VQKS 3HVTB 5KFYA 2HZVA 4JI2J 1KWMA 4YR3A 2ZBIA 2AIRB 4WZMA 2XHWA 4HT7A 4F0MA 1IJEB 3BPSP 1FDDA 2PMHA 4Y2MA 4W90B 4F4XA 3J81U 2AYBA 2Z0GA 2IJFA 2ZBQA 4WCEQ 2AGQA 2HK2A 4ZIWA 2ASYA 1EP4A 1JKHA 3NCPA 3P49B 5K8NA 2WONB 2QTWA 2O5DA 2FJDB 2A18A 1LEOA 2VG5B 2HEKA 4DL6A 5A2QU 1Q86T 5LXYA 2L08A 2AKWB 3VF0B 2V34A 5HQLA 2MZJA 3R5DA 2NYHA 2DEIA 1HWUA 4Q0BA 4Z7YA 4OHXA 3VGSA 5FIIA 4M5DB 5THWA 4A48A 3IG1A 3HJVA 3TEGA 5DGBA 2I8EA 1UWBB 2WCXA 4IR1A 3H0PA 1XN9A 1SH0A 1U2RA 1H73A 1Y10A 3HHEA 5ADZA 4FBUA 1GT8A 1XNRJ 2V8HA 2CYYA 4PZVA 2JLEA 3WC0A 2ZKTA 1YJ9S 2XI3A 4DX6A 3Q8RB 4KPYA 3U27A 3DRPB 2H5EA 3M2VA 3Q2SC 3CCRS 3CMES 1RCXB 3UN5A 4N7TA 3G4SS 4OV6A 4DI6A 1DZ5A 4RWXA 1UVKA 4I69A 1PGZA 4TKTA 4C0HA 4WE1B 2PC6A 1YKWA 4ZJQA 5I3UB 2NXEA 3M8QB 4FKYA 2PEBA 2K06A 3F44A 1XMQJ 4N41A 4U6PA 2JL9A 4WU3A 1Y5IB 1CLFA 4ENOA 1MU2B 1C4CA 5LL6d 4NXMJ 4IQXA 3BGOP 1WEYA 1GFWB 4USUA 2IA0A 4QR0A 1U1PA 2HVDA 5BYSA 2FZKB 4XAKA 4I2QA 4X2BA 1YGYA 3FVYA 4LQ9A 4DPXA 3HD1A 3U1LA 5JUMA 4EBDA 3HXMA 3CMQA 3PX6A 3Q24A 2QZ8A 3AQPA 2HZAA 1HWLA 2YQ3A 2ROGA 3LP2B 2JEGA 5F9LA 5CAAA 2V94A 3C66A 2MSSA 1RTIA 2EK6A 2ZWPA 2QMUB 4ZP9A 2XMVA 1K9MT 1ULRA 4IOBA 3DDKA 2D69A 3PO4A 1LXJA 1OJ4A 1SV5A 4DF4A 3ZZTA 1NM2A 2DNNA 5KAKA 2C2ZB 3QWPA 2VONA 2GMHA 2WVFA 4WXOA 2NXJA 2UXDF 2AP6A 4O0IA 1XBWA 4ZLJA 3SV4A 4DF8A 2M70A 5HP1B 1OO0B 2ZOFA 2V4QA 1PJ5A 1RT5B 1S6OA 3G6ES 2J76E 2DNGA 3DNCA 1P6TA 2RS2A 2V63A 4N47A 5IQ6A 2VOOA 3WDOA 1S9EA 2DBBA 4Y0FA 3H8YA 3D67A 1R3NA 2RVJA 4B9SA 3H5YA 4JI8J 3N4WA 3T1YF 1B99A 3P3DA 1WC0A 1VC5A 3B4DA 3VGUA 2FVCA 3TEHB 2RKIA 4R25A 3SIPB 3FFIA 5GMEA 4RW9B 5D8HB 3ISNC 2UUCF 2R8JA 2XYGB 1BMQB 1C1BA 2VFTA 4BDPA 4XTTA 2KJVA 1F5CA 3JTNA 5KFWA 1VQMS 1FO1A 4J9MA 2IMWP 2ZZMA 1IQTA 2DCLA 4JI1J 1H7WA 1UJ6A 3CC4S 3LO3A 3I9ZA 3DYAB 2LVWA 2XC9A 1TTHB 2Q66A 3I4HX 3KHRA 4KAIA 3OLBA 2CPZA 3HJFA 1ZH5A 1VMBA 4DQIA 4USVA 5ETRA 1R0AB 4F0HA 4LIRA 1WC6A 4Y2KA 4RNNA 3HVTA 1NKBA 1BQXA 4RPFA 1CJUB 1U49A 4LVOP 4A8MP 1N32F 4KHPJ 3ZZYA 1U4BA 2HVZA 4P6QA 3ILJA 1Q1KA 3NP5A 1SQEA 1EHWA 1Q53A 2O3DA 4LF8J 3W9IA 4WWSA 3P5TL 2Q79A 3E01A 2NXUA 3FQLA 1JLQB 2BV3A 4M5GA 2VUGA 4HEA9 1T02A 2WONA 1ZZFA 2R2TA 1N5YA 2PGCA 3BQ2A 2XMJA 3MZIA 2VG5A 2E7XA 4OLPA 1K8AT 1T9XA 1IR0A 4M5MA 2YKAA 2W9CB 1JWWA 5IC4B 2ZM6F 4WP3A 3I4PA 1SKUB 1REVB 3M8PB 1N33F 4OX9F 2J0QD 1RAEB 1HBOB 1OYEA 3NNHA 4M5DA 3DLGA 4ER8A 3IWLA 4JV5J 1UWBA 3N5FA 2H4WB 1ZZNA 2CG4A 3AD7C 4F02A 4NLUA 2ZE2B 2P2CB 3CIMA 1UEKA 1EB0A 3TX8A 1B0VA 3SFUA 4OI1A 4PXEA 5MLCV 1XNQF 4K5SA 1LFPA 2CNLB 1LV5A 2YKPA 3DRPA 2BJ3A 1R43A 3I5BA 1N6QB 3HZEA 3CJKB 3TVKA 4B02A 1S59A 1KS2A 4CTAA 3D4JA 3W9HA 4CO3A 2RDIA 5L1LA 4WE1A 2DGTA 3M7VA 1TVRB 1U26A 3LPEA 1WG1A 3M8QA 4DR7F 4XPCA 1R6VA 4Y00A 5I3QA 2HNZB 4ZPDA 2BOPA 3W61A 4ZLLA 2AYEA 2ALZA 1FX2A 5B0EA 4DFJA 1MU2A 3OTEA 3NS5A 5KT4A 4DV1F 5E3AA 5KFVA 3BN7A 2R7VA 4PAAA 2KDOA 3BF4A 1FFWB 4KGZB 3H4BA 1U8WA 3MM7A 1CC7A 1WHXA 1T9TA 3W60A 2YWWA 4C48A 4R5PB 1W2IA 5ETLA 3LPYA 2CPJA 4LF7F 3J80U 3MUTP 2ZUAA 3WIUA 3BS9A 1FDNA 3F0NA 4DQSA 5AXMA 2G1DA 4UTGA 3PW0A 4KKOB 5LMNF 1WI6A 1XNRF 4P2MA 4TQSA 2DXEA 2OO4A 4YHHF 2W9AA 3OR2A 5KG2A 1M5OC 4OZ5A 3JAMU 1TELA 4TLRA 5D4NA 3CJ4A 4IOAQ 2QSFA 4GC6A 4FYWB 1PKUA 5LJ5Y 4NZ6A 4YB5A 3GG1A 4AUKA 2XLIA 5B0DA 1HARA 2D1CA 4AL7A 1AYEA 2I9SA 4F26A 1R27B 2ZD1B 1HBUB 1NZ8A 3K58A 2HZCA 1S6UA 1NJIT 3V2UC 1U1OA 3MR7A 4RNMA 1YJNS 3SCIE 3MMCB 2W8KA 2JVOA 3T1HF 2JFDA 3LAMA 2R7TA 4USWA 4PR6A 2DR5A 5C5JA 2EG1A 1RLCL 5ETOA 3UD4P 3WHIA 3VAGA 4O3QA 2DHXA 3ZFVA 2LU1A 4RW9A 2H5JB 4OHYA 1OY8A 2RUSA 1KTVA 1FRMA 4NLPA 3QT6A 3GB0A 1WF1A 3CCWA 2GHVC 4R0EA 4YY3F 2P9CA 4B3RF 1FD2A 1R0BG 2MZTA 2PMWA 3NBPA 2JVRA 4BWMA 2UVWA 5K8MA 1EJ7L 1BE4A 4FF3A 1RT3B 5JVHQ 1Q7YT 3PV8A 4FP9A 2ASJA 1LOUA 2WVEA 2GO9A 3J7Z5 3M6UA 1LKZA 3G6XA 3NMAA 5F8GA 3BSOA 2RQKA 3EGNA 1RTHB 4F0KA 3R7SB 2Z57B 4WPAA 4AYBD 2RF2A 2FVQA 3D0HE 4UZCA 1QLNA 3ET6B 1R0AA 1RBOB 2OI2A 3EJMA 2ZJRQ 1QM9A 4NCBA 1CJUA 3G9CA 3QAEA 4BLGA 1Y4ZB 1X8DA 3DLKA 1NJYA 4A47A 2ZVIA 2FDNA 1KN6A 2FLNA 2HLUA 1FVSA 4DN9A 4ED7A 4KIAA 3E51A 1JLFB 5RUBA 1PC4A 4JI8F 5B08A 3LOUA 2ZHOA 1YIJS 3GWCA 2D7SA 1S1TB 3FBFA 4XPEA 4ZIVA 1M5PC 2MZSA 2G4BA 4S0MA 4C8NA 1EARA 1KOOA 2UVRA 1NDLA 1KDNA 3TJ9A 1REVA 2UVVA 4RL1A 2VF3A 4B9VA 2DIUA 4RLEA 4YS2A 2CPHA 3R5AA 3H2LA 1HBOA 1B7FA 1JMTA 3V6JA 2KVQE 3PNIA 3FRZA 5M2PA 2A3JA 1L3VA 3M6VA 2W25A 2QT7A 2RQMA 4A46A 1ITPA 4J9SA 2YVSA 2ZH4A 3D7SB 5GAHU 3HHLB 2VFRA 2GW8A 3PR5B 4C3KA 5BXIA 2OPRB 3MEKA 4M5HA 3EXCX 4ZS6A 5G0RB 4KHPF 4WTYA 3CJKA 4NEZA 4IH5A 1X5SA 2FC8A 1FK9B 4NA2A 4DL7A 4LFBJ 5AXLA 5CYJA 4HI1A 1DLOB 2BKNA 1Y9OA 4RKUC 3RB0A 4ECQA 3P5BP 1JLBB 4NLVA 4ICLB 2KFZA 3IP0A 5GAEI 4PRFA 1T0TV 3I5AA 2VFSA 3CD7A 1C2PA 4CH1A 3A13A 4DOZA 2DVIA 4NOHA 4DR1J 1FXRA 1GTEA 1RT1B 3NRBA 3RRKA 2A6OA 4OYBA 3MR2A 4C97A 4JI6J 2F40A 5D0RA 2CQ4A 3IA0A 1N34F 2GA7A 4R5PA 2K3KA 2YQ0A 2K2PA 1YJUA 4JV5F 4A8XA 3QJPA 5A8WB 2VQFJ 2IM0A 3LAKA 5KFUA 2MB0B 4FYYB 4TXSA 5J2MB 2JX2A 1RT4B 3G82B 1GX6A 2VG6B 2YNHB 5KFSA 4MT1A 4QWCA 3RAQA 3I6PA 4LT6A 1RYRA 4KY3A 2QL7B 2KH9A 4BBYA 2OP5A 5KFHA 1KNZA 2MQMA 1DFDA 2KT5A 3IRXB 4OJGA 4FYVB 3KOAA 2MTLA 4MIAA 1PSDA 1UAWA 1NPPA 2HAIA 3OTOJ 3TZXA 2BX6A 4JV0A 4C3MA 2UUAF 2WOMB 3BGUA 1N36F 1MG7A 1H7XA 4IUFA 4G3IA 3W1YC 2EK1A 3A3OB 2ZD1A 2PI4A 1HBUA 4EU0A 2QN6B 1FKPB 1HI8A 3MMCA 4ZP6A 1OWXA 4RX6A 1LWEB 4RW7B 3W5XA 4E0DA 4PWWA 3WC2A 3MCSA 2KFNA 1B70B 5C25B 1QSYA 1FJCA 1VIXA 3UCZP 3A8KA 4Z2XA 5KFJA 5IWAJ 2HS0A 3QT8A 2CXEA 4KGKA 3GR0A 1XMOJ 3JSMB 4WFBQ 3M8RA 5H9EK 2YQ1A 1R6YA 3MAAB 1SVDA 5KG4A 1YLXA 2B5JB 3Q89A 3LF0A 2BR0A 1VRUB 1Q5VA 3O6QA 4X4QA 4LR9A 2EFPA 4ANDA 4BC7A 4O3SA 4IRCA 4NLTA 2DT9A 2ZHBA 2ASLA 3C2PA 4J9VA 4CLKA 4W92B 3TQ1A 2XULA 2HS3A 1NK8A 3UQSA 4DL3A 1X60A 2WW8A 5AXKA 2XSJB 1YG0A 1C1CB 3NCQA 1U1KA 3OXGA 2NUHA 2Y8YA 3CB4A 4OZ2A 3ET6A 4UY8T 2BQ3A 2C2EA 4MK9A 3GU0A 1WHWA 4YFUA 4KV8B 3N6LA 4C8YA 4ZP7A 3MURP 2VPYB 4QU6A 3BBFA 5DQGA 5B09A 4O3RA 5E7OB 3MF5A 4WIQA 1HW8A 3FMBA 2DR6A 4XK8C 3PACA 1URNA 1JJ2R 4TNOA 3QFHA 2CQ0A 1FCAA 4K4YA 5U47A 4BS2A 5ETMA 1O6XA 1BQMB 1NU4A 3QQCD 1S1TA 4OJ3A 2AJ2A 4JI5J 1SJFA 2RHSB 1TFWA 2GMJA 2HS4A 2JDJA 1WC5A 4C3LA 2M88A 2HGLA 3KNAA 1NKEA 4UUXA 5J1NA 4FS2A 2CJAA 1VISA 4QIGA 3L9ZA 2JC0A 1Q8IA 1U24A 3GPAA 1SXLA 3POTB 4IG3B 3ILLA 3EX7B 4LRAA 4RBVA 2N3LA 1U02A 1EAYC 4DEZA 2ACMA 1S10A 1DHMA 4DR4F 2FJVA 4OYMA 1VLYA 2G0CA 3CDUA 4LRDA 4L72B 3HHLA 4UOFA 3D1OA 1WC4A 4HH0A 4C2MA 2J7UA 4MH8A 2OPRA 1L3TA 3I0RA 4QWBA 3R7NB 3SDEB 2C28A 5G0RA 2P8IA 1FJEB 1I94J 2DNMA 4ED2A 2JRSA 1HBNB 1ZA1B 3EM1A 4YB6A 4USHA 1FK9A 1FWLA 2BJ1A 2C42A 3KUHA 2C3YA 3MPVA 1DLOA 3JTPA 4CLLA 3O8WA 2MLYA 3ZTPA 1YRTA 1JLBA 1QVFR 3HI9A 4ICLA 3MM9A 1RAAB 1PAEX 2BA9A 2GJFA 2N3OA 3BDPA 4WFZA 4MYUA 3QGGA 2B9YA 1PC5A 1RWKB 4I1TA 3W9JA 2H51B 4IFYA 1RT1A 2A2CA 2ZWOA 4OJ1A 4LF6J 4X4SA 1P8GA 2J5AA 2KHCA 3CJTA 3FZBA 5F9NA 4AL6A 5F8IA 3QRRA 4DFMA 1AUSL 2V8GA 2VZ9A 2B9EA 3B6BA 3SMZA 2JHEA 1B7YB 4CLSA 1T3NA 7AT1B 2ILZA 3TARA 5E2QA 5A8WA 1KTQA 2VPWB 4U8YA 4PUOB 2XWYA 2QYGA 4A8WA 5FDLB 2WBRA 5J2MA 5F3ZA 3O2IA 4ZVUB 1RT4A 4FNIA 3G82A 2PA8D 2VG6A 2YNHA 2B3TB 3MEDB 2BKPA 1K47A 3C14B 1ICEB 3OL9A 3WBZA 1UW4A 3K7RA 1GTHA 3IRXA 3OVAA 2GV1A 1GXLA 4K2JA 2W4PA 4G1QB 4MIBA 3J81Y 4GKKJ 4NLSA 4IQMA 3ENQA 3HHLD 3GFZA 3U1MA 2D3UA 3HO1A 4FYDA 3CVKA 3RTVA 1WEXA 2HW3A 4X62J 1FKPA 2HYIB 1T9YA 1BWEA 3DXBA 1NNDA 1H2TZ 4LRFA 1R8HA 2C2OB 3RBXA 3FEXB 1LWEA 2B4PA 3MFHA 1V3RA 5C25A 1SL2A 5A2QY 1RYSA 3GMGA 3T6BA 4NASA 1HMVB 1BUXA 2F8EX 5J1EB 1EQ0A 5IT0A 2FQQB 1N0VC 4ED8A 1EETB 2FPHX 2EEYA 3IGNA 4ATNA 4CM0A 3IGVA 2ZH5A 4C8MA 1P1LA 1WDDA 3Q0AA 5A8RB 3JSMA 2LXIA 4OZ3A 3LQVA 3N79A 2SXLA 3FCHA 5HJYA 1LW2A 2O01C 3HM9A 5HQ8A 4U7CA 3OVBA 3MAAA 2Y3YA 2V8VA 5CQGA 4P7VA 3RU0A 2B5JA 1F2GA 2V68A 3A8JA 1VRUA 1U1MA 1D1UA 3KWMA 2YBVA 4Y2AA 2RD5C 1T7PA 5F3TA 1PO6A 3KYLA 3GQCA 2LYVA 1RABB 1KQGB 5ETSA 1KVJA 4V19J 1DTTA 3CC2S 2Z30B 1GAOA 2ZVSA 1T95A 2BANB 3DOLB 2CNNB 2XSJA 2HMIB 1XJWB 2JWNA 1CVJA 4NZ7A 4A8SA 3MPDA 3IBCB 3DLLQ 5BR8F 4KRWA 4XIUA 2NREA 3OHAA 4UOCA 3AY0A 1AT1B 3D0IE 3FBEA 1R89A 2HURA 2GMLA 2J8SA 2CZVC 2V2KA 2W7PA 1CJVB 3CJ0A 4KV8A 1NSKL 3G86A 1U0HB 3EMTA 3TRGA 2D3ZA 3MAHA 1MMNA 2AT1B 2OEJA 3DKDA 2EKYA 2LP4A 1JB0C 3KLFB 1QE1B 2MQNA 4YOEA 2QYCA 3BSCA 3M2UB 2A1BA 5IWAF 2L3MA 1BQMA 2CPEA 1P27B 3GFHA 3OQ2A 2YWEA 5GVQA 1XMOF 2NUUG 4YR0A 1SB6A 4CNZA 1NEEA 5DM7Q 4GO5X 2CQ2A 1KD1T 5CXTA 5F8JA 4QYRA 1XR6A 1FXLA 3LGHA 3CJSA 3UN2A 1TAQA 2BE2B 2B43A 4NRUA 3ZXWA 4D3GA 3QZ7A 4B9MA 3POTA 3NG8A 1Z1ZA 1IBLF 1LWFB 3GIRA 4IG3A 1PYOB 5IZHA 2XYHB 2VH7A 2MQQA 4OLOA 3W64A 4O3NA 3FNNA 1OPIA 1M5HA 3ZZOA 2XMKA 3GV8B 1XC9A 1CQNA 4NPOA 1SC1B 1U1LA 2PFDA 4QR2A 2OH2A 3ZC4A 5C24B 3I96A 4QCLA 3IAM9 1YHQS 1M5VC 1TKXB 3SDEA 3X1LB 2C3UA 2FY1A 3IWNC 2MY8A 3BR8A 1HBNA 2KG1A 2DH7A 4N5SA 4PKDB 1IM4A 4UQGA 3Q83A 2WBMA 2CJXB 1VQ9S 2NLWA 3PJXA 4DS5A 3Q23A 3TJAA 1VGYA 3SSQA 3M6XA 1U1NA 1U6FA 4ED4A 1BHNA 3R5GA 1VQ8S 4JI5F 1K0TA 4TU9A 1UVLA 4X65J 2V6AA 4K50A 2KXNB 3ELHA 4V1Ak 2A10A 1RT2B 3R7BB 2HGNA 4ZP8A 3M4XA 3OHBA 2M2BA 4PWUA 4YEAA 1NH8A 3B4MA 4NWBA 1F2HA 2V9WA 3NNCA 2HWTA 1GX5A 1GXTA 3CCQS 3FZ2A 2E1MC 4DPTA 2E66A 1FVQA 3IC1A 1ZAXA 2W7OA 1RISA 3ETMA 3E2EA 3Q8PB 4AXIA 3BZQA 2VKRA 2YPZA 1S1XB 3W5ZA 4PPDA 5F8HA 5CYQB 1X4HA 4UQTA 1KQKA 5IV3A 3EZOA 4PUOA 5FDLA 3V4MA 3PRVA 4F2SA 1FF2A 3M6WA 3HFVA 3R1HA 3LP1B 5GAEU 4NLQA 2CDRB 4WFYA 2BM1A 1X4GA 3C14A 3PYGA 4LRCA 3BBCA 4ID8A 4ECTA 4J9QA 3MMBA 1HQEB 1HNWJ 3MM5B 5KFCA 2KFYA 3VQSA 4G1QA 3EGWB 1QY7A 5FD1A 4EZ9A 3DHXA 5A6PA 3TA1A 4YN3B 2HAFA 2U2FA 3BGRB 3PIOQ 2AJ0A 1Q79A 2CDQA 2CWXA 1URRA 2GC8A 2AGPA 4B08A 3B82A 2DEJA 2RT3A 1IUJA 3HFKA 3HULA 1HMVA 2ALYB 1P9QC 2KXFA 4OI6A 3OD2A 5J1EA 1JXVA 3CE8A 4L3NA 4LF6F 1S0VA 3IXQA 4IG0B 5J2QB 4PXDA 4FNHA 4EFAC 5A8RA 2K1RB 4DU8A 4K4TA 2O1PA 1IXKA 4YDDB 3MGJA 1FTRA 1KC8T 3AD9C 4B3MJ 2UV8A 2W9BB 5KFEA 1NDKA 3R6LB 1AB8A 3N6NA 4J7CA 2IC3B 5I4MA 2DNLA 2CWKA 4KGMA 2ROPA 4LF5J 3TWZA 2MQLA 2I1RA 5HVGA 2B8QA 1SI9A 2ZH9A 5IS2A 2CPFA 1YDLA 4LSLB 3SCJE 3Q2TC 4U95A 4PG7A 2UP1A 1Y3JA 2XEXA 1IJFB 1FX4A 3QSIA 1W25A 2XTJP 1OY9A 2BBEA 5AE3A 3DOLA 2V0NA 1T9UA 4ZJLA 1JNZB 3AB4B 4OIXA 5HSPA 4GKKF 4GVBB 4PPZA 1U6ZA 5F8LA 1XMBA 2ZH7A 1HNIB 2N7CA 2PO4A 4Z37A 1JXEA 4O44B 1S6PB 1CJVA 1QAIA 8AT1B 4ZOSA 1TKDA 4F4ZA 2LCWA 4W98A 1U0HA 2YX4A 3MR6A 2MJUA 1RKJA 1RP5A 3PXGa 2CPDA 1PBUA 5IOLA 1S9GB 3ULHA 3M30B 4NXNF 4X66F 3KLFA 1QE1A 3HK2A 1X9WA 2WSFC 1TL5A 4NLYA 1RAGB 4HYKA 4RUHA 3NGKA 4NMXA 1S97A 1IQZA 2RH3A 4QQBA 3W63A 2H54B 2IFXA 1NHUA 4LFAJ 2W1BA 3J80Y 5KOXA 2Z8QA 3S6EA 4ELUA 4DFKA 3FCVA 3HHDA 7FD1A 2ZH1A 4OYAA 4NLOA 4CLYA 4USJC 4P7TA 5KG7A 4KGVB 1WOOA 3BYPA 3M1VB 2M3DA 9RUBA 2J8AA 4LF4J 3UR3C 3UD3P 4RNHA 2R7QA 1U45A 5KFZA 1HQ2A 2W01A 3CSKA 1X4BA 3T5LA 2ZKUA 1YSJA 1LWFA 4ED6A 5LMUF 3JAMY 2R8IA 3H5XA 1FRIA 2MGZA 1NDPA 2BOAA 4EI2A 4WTOB 1RB0A 4NMLA 3HMJG 1K0VA 4HDGA 4DV2J 2WVCA 1RJJA 2G0JA 4Q43A 2IVMA 4DUTA 5DJBA 3QO9A 2LQ5A 4J9RA 3D0GE 2DGXA 2J7KA 3FBBA 2E5LF 1TKXA 2CQIA 2J9EA 3HVAA 1SL1A 4OZNA 2OSRA 2DH8A 4NA3A 5DO2A 4DX5A 3SFGA 3MD3A 4IO9Q 3NNAA 3IG1B 4F4YA 1IKVB 1AA1B 3L7OA 3RG6A 4B3OB 2RU9A 5L8RC 3THVA 4IR9A 3SV3A 4KH0B 2X1AA 1ZPWX 2I0XA 4R0JA 5D78A 1VYAA 3MUMP 4XDDA 2FGOA 1UEUA 3CO9A 4J91A 2AW0A 3MM8A 2CQDA 2CNOB 1BC6A 4X4OA 1FEHA 4OYPA 2VB6A 2W24A 1SH2A 2HWHA 4LBIA 4DSKA 1RT2A 1C0TB 4F04B 3D3CJ 2FVSA 5D6GA 2GFFA 3DDNA 3AT1B 4MAKA 1RWWB 3D6MB 2UXDJ 1N5SA 4DN0A 4CO5A 2FC9A 4RBUA 2B9WA 1C0UB 3G6VA 2F1FA 2JLGA 3BEGB 1HI1A 1RAIB 4ZPCA 3TANA 4P74A 1ELOA 1VQYA 2MPUA 4RZRA 2DR8A 1QTMA 1GEHA 3UDLA 2Y9HA 1S1XA 5CCLA 4M63A 5CYQA 1RKIA 4DL5A 4MKAA 4USIA 3MR3A 5BJRA 4M8LA 1BY9A 4O3OA 4KR0B 1T9VA 3GR1A 3MECB 3T1YJ 2KO1A 3LP1A 1WOPA 2Q6BA 5EX3A 1MN7A 3D68A 1TUGB 4UT4A 5HMWA 3H40A 3HKZD 3K17A 4YR2A 2HKEA 2DRDA 1S0MA 2UUCJ 1RBAA 2IJRA 4J9UE 2EPIA 3MM5A 1ZETA 1SKRA 1S57A 2XI2A 1PG5B 3UD5A 3PHEA 1JK9B 4C8OA 1WKJA 1X4CA 5EDWA 1JLEB 4G1PA 3BGRA 3DRSB 4F67A 3K5PA 1FXDA 1R7IA 1MROB 5KT7A 1G1XA 5KT3A 4LF9F 2GGPB 1IM6A 2DISA 1EIYB 5E3CA 2PN6A 2QFIA 3PYDA 2UZAA 4L74A 4RU9A 4M5LA 3K5LA 1N88A 2HHXA 4LMZA 3TUZC 3U1NA 4IG0A 5J2QA 4YUDA 4M5JA 2X7IA 4WKRA 5EGYA 3CD0A 1V5VA 3AD8C 1SC4B 2K1RA 1YZ7A 3TAPA 2CIMA 1WDTA 1VHFA 4TY8B 4NCGA 1N32J 2G2OA 2W9BA 1UPPA 2LMIA 3M2RA 4UOGA 4EBCA 2IC3A 2FYXA 2WTFA 4P9SA 3OL7A 2KXHA 4KO0B 1GXUA 3UVJB 1NMEB 1F5AA 4DX8H 2Z2LA 2XSFA 3HZGA 4LSLA 3BSAA 4ETZA 3G87A 2Y0BB 3DMJB 3PR4A 1ZTWA 3FBCA 1N0UA 3SSRA 4KTQA 3FFIB 3DI6B 5KFAA 1NLKL 2DPJA 2IM2A 3UI3A 4DR6J 4Y3CA 1NO8A 1HWKA 3IBWA 5JMNA 1QAXA 1EQMA 5J1PA 4LR7A 2H1YA 1HNIA 4N77A 1S6PA 2KTQA 1N33J 4A8FA 4WU2A 4OX9J 4DV7J 2VICA 3PYEA 4NCAA 1NK0A 3CJ5A 2DNOA 2CVEA 5CHCB 4DX7A 1VBYA 1N5TA 5K8PA 3HT3A 2C3MA 2WHOA 4I56A 3M30A 2C2NA 3AJ2A 1S6QB 3VAKA 2U1AA 5EUHA 3VAHA 5KFIA 1FFSB 3LWLA 5F8MA 4UY85 1UEVA 3KMQA 1XNQJ 2QO3A 3OW2R 3RBZA 3N0VA 3V5RA 1PJ6A 3DOKB 2LDYA 2RRBA 3TOQA 3KG4A 3H5UA 2NQPA 4DLGA 3ZZUA 4DPOA 4B3MF 2RILA 4G6VB 3GFYA 3OUYA 1RXOB 3PX4A 1GMWA 1NHKL 1F9HA 4USKA 3HHNB 2RAQA 5LM7E 2LLZA 3M1VA 4LF5F 4O4RA 4DL4A 4OX7A 4ES2A 4U8VA 4MYTA 4X4TA 3H2UB 4DR7J 1EX8A 1SKSA 3E01B 2J9DE 1CJKB 2DXDA 3KLEB 4QWEA 1HBMB 5H1SV 1BD6A 3O1LA 2ZHAA 1N5YB 1FKOB 4RUCA 3A1YG 1REGX 2Z2ZA 4DV1J 4ECRA 1D0EA 2AEMA 4OHZA 3CF5Q 4I64A 1FRXA 5KT5A 3H2VE 2DYAA 2OTLS 5CZVA 4QBUA 1TL1B 4U96A 1FESA 4QZVB 3CCUS 3CGIA 4ZVTB 3CDAA 1S0NA 1X4EA 5E3QA 4LF7J 3DLGB 4B9TA 5BYRA 1IKVA 3BB5A 3ILOA 5F0WA 2OMOA 4B3OA 2W2QP 2KT3A 1NK4A 4CRJA 4JYAJ 3MTKA 4NEYA 1KVIA 4I4BA 2UU9F 5E3RA 1U47A 5MAOA 1WD6A 4CO4A 5LMNJ 4N76A 2DNRA 1PILA 2N7YA 4ZK7M 2M4MA 5D4LA 4YHHJ 5C42A 3H20A 1BQNA 4LFAF 2W2NP 3NAIA 2PA3A 5ETPA 1D9DA 2DR7A 1C0TA 1WKLA 1PAUB 3O5TB 2LQJA 2DRBA 2MZRA 5J2NB 3KK2B 5KFDA 3FGVA 3LGMA 2HFNA 4CTAB 2YH0A 4C0BA 1UJ5A 3PG9A 1UMJA 1C0UA 2BKOA 4LF4F 4TU8A 2ZNZA 2BJDA 2F8MA 4DCPB 2OKQA 4DQQA 3TQEA 2GQQA 1XWLA 4JI7J 2HNDB 3T1HJ 1GMWD 3QMQA 2DO4A 2K7KA 2D9PA 4J9NA 4DV2F 3HKWA 1GQEA 4DSJA 2OAUA 3ENWA 5GMDA 2P5VA 3J7YI 1IWGA 3MECA 3UCUP 4M1KA 1CG2A 2OHDA 3Q8SB 3IRWP 4WF9Q 2NYIA 1FDAA 1M1GA 2R8GA 3MM7B 1MWZA 5HROB 3AHPA 1Q4RA 2PEHA 1R8PA 1U2CA 4E98A 4EYIB 4ZLPA 4YDXA 2YXLA 4P73A 2N82B 3MOZA 1S1VA 2EC0A 4EMDA 4YY3J 4B3RJ 2ZH3A 3T9NA 3QYYA 4YP3A 3PHTA 3LW5C 1N52B 2WRMA 2LEAA 1IBMF 2WW4A 1JLEA 3RW7A 2B4OA 3DRSA 4DHVA 3BKFA 1MROA 2J9CA 1SCJB 3QLHB 1ACMB 2GGPA 2DNZA 3FC9A 3OR2B 1Q16B 3BDEA 2YWFA 3NWGA 3ISND 3JQMA 3OR1B 1ZM3A 1QAYA 5LSLA 3PFOA 5DDRC 2HRUA 2E1PA 2YKQA 1H2UX 2UVUA 2J6TA 1MLAA 4DR5F 5DDQC 1KVKA 2XS7A 2ZOMA 3BQ1A 4TY8A 1HIYA 2I2YA 1SIZA 4FXDA 4I7FB 4KT0C 1WELA 2FZGB 2H5IB 2HQDA 4QOTA 2MQPA 1M0SA 1KLMB 3QIDA 4KO0A 2QG9B 3UVJA 4DPUA 4OJHA 4OFZA 5CCMA 4LSZB 3V6HA 4H4OB 3L7PA 3DMJA 1FFGB 2D9OA 4WYWA 3DI6A 2ZJQQ 1TMJA 1VLOA 4U9RA 3SCKE 3ZZPA 2FVPA 3TZZA 3MXHP 1S76D 2RMLA 1IBCB 3D28A 2HHUA 2CQPA 2E9ZA 3SCLE 3NBPB 3FSYA 1D8ZA 2Q3PA 3CJ2A 1KLNA 3M8WA 3V6DB 3KG1A 4I6WA 1HD1A 3TYTA 2X3GA 3QNWB 2NCKL 1KQFB 5ETKA 5DQIA 1CPZA 3KUGA 2W2OP 1RQ0A 3DC2A 3TA2A 1KRPA 1Y3KA 4KHRA 4K2XA 5AE1A 2GZOA 2YWHA 3GILA 1S6QA 1NH7A 2IHR1 2VIHA 2HBZB 3UW1A 4HT5A 3M32B 4H54A 4MK7A 2RF2B 4DQRA 1X5OA 1KEKA 4Y2CA 4ZPBA 3I5CA 2PD1A 1U7LA 2V4RA 1H74A 3MMJA 3DOKA 2A2DA 1DBDA 1XEZA 1EKRA 3DLKB 4A8OA 5BYQA 1SJ1A 1WSRA 1TK5A 3HVWA 3QRPA 3UE2A 3AAWB 3VAMA 4OHVA 2G2YA 3U7JA 4WP8A 1V9OA 3JSBA 5A8KB 1V3ZA 2O66A 1UCNA 5E3PA 1CJKA 2KN4A 2V2VA 2XGQA 3KLEA 4JI4F 4ZPVR 2Y1JA 1RHRB 1HBMA 1S72S 2OGUA 3UNYA 4DCOB 1R8AA 2AJFE 2AD9A 1SQGA 1FKOA 3UDVA 1Y11A 5DG8A 4DR6F 2CJKA 1CBKA 2AEFA 2QE5A 3GG0A 5G4DA 3AH6A 1S7HA 4CT9A 2DGQA 3CTRA 2H9ZA 3TI0A 2K7JA 5F0UA 2MKIA 2QLFB 1U1QA 2E7VA 1MN9A 1TL1A 2HLTA 1OQ6A 4DV7F 3MOJB 2QC3A 1N34J 1UJ4A 1HR0F 3KUEA 1FNXH 5L9XA 5D15A 3GFXA 3RRGA 2HFVA 2FY8A 1WSVA 3O44A 4J9OA 1WHYA 3N28A 1NCLA 4X84A 1VCTA 2NXCA 1VQ6S 1CC8A 2M8DB 5I42B 1Q8BA 4O3PA 3VCDA 3TZWA 3HSDA 2XNRA 2Z58B 3QGHA 4DFPA 5HATA 5K20B 1NPRA 2PMZD 1KP6A 3OLAA 3MCMA 5L38A 2N4DA 4CO1A 4NLGA 2HHQA 3WX4A 3ZTQA 2M9KA 3NGUA 2B51A 4GO7X 4EO6A 2HRTA 1VBXA 1VI7A 2L9NA 2RDJA 5J2NA 2E1RA 3KK2A 2UUAJ 4F3MA 5AXNA 3LTOA 4L3KA 1HHSA 2XO7A 1N36J 2RRAA 1GNKA 3MR5A 5L9NA 3FEYB 2XCAA 4TY9A 3KK1A 2UV8G 2ZZNA 1YJWS 2GIQA 1S49A 1I6JA 2CJ9A 2I6WA 2DXFA 2MJNA 1NK5A 3IM8A 4DSIA 2HHPA 2HNDA 4HVZA 1LWXA 2IPOB 2MMYA 3LALA 1HYSB 5DETA 2QMXA 3GJRB 4ECUA 2J0XA 4PG5A 1NAQA 3F73A 4WYLA 4DV0J 8RUCA 5EX0A 3C16B 2H65B 1RWXB 2ZBPA 4EEYA 5HROA 2FGCA 2QGFB 4B3TF 2ZH8A 2DKOB 4ILLA 1J2VA 1CULB 2R4FA 3KJNB 3QFWA 2YKMB 2IIHA 2JNJA 1AW0A 1RZMA 1TKZB 2C2DA 3K5MA 4JYAF 1SKWA 2RQ4A 2AZ1A 2MLZA 1W2BR 2FHMA 3C15B 2XBPA 4ETXA 2G2ZA 2AF6A 4I2PB 3QLHA 3EYZA 1ZM4A 1VBZA 2EC2A 5IT9Y 1KONA 1FE0A 1R8BA 5DZ7A 1F9EB 3NGDA 5FLXY 2DD8S 4P2XA 5EWGA 4UUWA 2HQIA 3OTBA 1W7WA 3OR1A 1U6BA 1H38A 2ROEA 2XGPA 2NZ4A 1WTFA 1G7CB 5CD4A 4KC5A 5JXSA 5AJ3F 3H25A 2HIQA 1RAJA 4PEOA 3DXSX 4ELTA 4Y2IA 1H3DA 3NMRA 1UZHA 2OSQA 2APOA 2CRLA 2DNPA 3T5KA 2VKZG 4DBQA 4I7FA 3NGSA 1TMMA 1MSWD 4JI7F 4C9DA 1V3SA 1TQLA 1KLMA 3RGIA 3VZIA 3MEGB 5E33A 1NKCA 2ZFHA 3J7A1 4JV2A 2I5JB 4H4OA 2JEJA 2VA2A 3GJSB 3MPWA 3CWJA 1KFDA 2W2PP 4MMOA 4MKYA 3QT5A 3M8ZA 1SJ3P 4CH7A 4QIVA 1M1KT 1K1QA 4K4VA 2QA2A 3RAMA 3SQGA 5IV4A 4WFAQ 2CJYB 3EPIA 2DY1A 4HL9A 3EVMA 4Y28C 3V6DA 1UP1A 4DV6F 2D41A 2XY6A 4DXLA 3MI7X 2OPQB 2IAJA 2OEMA 3TUJC 2R7XA 4LF1A 8ATCB 4E2FB 2XMTA 2JC1A 1QTNB 7FDRA 1Q95G 1N5QA 4Q8EA 1RAHB 2B6AA 4ZCKA 4DR4J 2GNKA 1DQAA 3M32A 4ZPAA 4K8RA 3BN4A 4H4KC 4L73A 3VVUA 1RTJB 2FLOA 1Q8KA 1VQ7S 2V69A 2PFFB 2O67A 3DLBA 1SPBP 4DDFA 3IR5B 2IM3A 1V5IB 3AXMA 3GE9A 3PIPQ 3MUVP 4F2RA 1UVMA 2GIRA 1ZA2B 4DR2J 5L1JA 2UUWA 1VK8A 4FXWA 1G4CA 3EGZA 4RO0A 1TL3B 2XMUA 5A8KA 4DL2A 3VGVA 4QR1A 1ZAWA 1TZ0A 2IM1A 3QWUA 1NPKA 4WKYA 2UUTA 3CCJS 5IQQA 2B0GA 4FBTA 5DG7A 1J5EF 2EFGA 1X4DA 1HNZJ 3R5JB 4M5IA 4ZA1A 4O4GB 2M52A 3M9NB 5CABA 2MZ1A 4AQYF 5KFXA 3HSZA 1WUUA 4NRTA 5KG6A 4PWDB 1XERA 3HCXA 2YWGA 3PO5A 2KHDA 2V2QA 1T3OA 3HD2A 5I42A 3A12A 1RBLA 3THTA 4CZCA 4TLQA 2OD6A 2P6TA 3R27A 2HVEA 3EVOA 1FJGF 3AOCA 3EXYA 4LRBA 2XQCA 2HFUA 4DUYF 3I0RB 4L75A 4WK3A 2KZZA 2DO0A 3LWMA 4ZVSB 1TU0B 1M5KC 4JP8A 2ZH6A 1Y7PA 4CM2A 3OJSA 5GADI 5DS7A 4K4ZA 2ATLA 2VASA 2XZDB 4RR5A 5KFGA 2BJ9A 3X3UA 3NS6A 3ONQA 4X4NA 3MM9B 5KFPA 3R5CA 1FRKA 4IYQA 5B7WA 4TVAB 3QPIA 2IY5B 2VFVA 4FF4A 2B4UA 2M7SA 1LK7A 2VBXA 1HYSA 1JXLA 2LU2A 1FRHA 2LQBA 5M2UA 2GJIA 3C46A 5KT2A 4IFYB 4F3OA 5T7LB 2DPIA 3IM9A 1K44A 4GKJJ 3C16A 1RU2A 2F8HA 3AA9A 3D6FB 4ECWA 3NAHA 3OFEA 4PABA 1FHTA 1GK8A 5GAHI 1VRTB 4ID5B 2IDLA 1HI0P 1CULA 3DGPB 2ZC3A 2YKMA 1CSJA 4PQAA 2WAQD 2EI5A 3D54A 1TKZA 2HFSA 3LUYA 3OSPA 3DOMB 4DV4J 2XY7A 3DFEA 3JQJA 3NS7B 3K8WA 4HR2A 2XWXA 3C15A 4I2PA 5ETVA 1RTDB 3IMQJ 2GAHC 3PCOB 4X64F 1F3VA 1NRKA 3Q8UA 2C1EB 4JI3J 2W8LA 2BUNA 1B0TA 5KFQA 3OVSA 4DG1B 4LFCF 5LT5A 4XDCA 1LK5A 3J7YU 1K73T 1JX4A 4N8NA 5BR8J 2NSCA 4XO0A 4QW9A 2GCFA 2L9WA 1S1UB 2ZUGA 2BMBA 3AODA 4WIIA 3UDEA 4BC9A 2BACA 3WIVA 3AOAA 1RDRA 1WWHA 2HVHA 3VAFA 2R2SA 1IR1A 2VV5A 3MEGA 3R1LA 3MD1A 2V4JA 3ISZA 4I67A 1VBKA 2I5JA 3MM6B 3EE3A 4BHQA 2UXBF 4DV0F 3EDRB 1HHTP 2P9GA 5HMYA 1OSDA 2BJ7A 1VC0A 1WHVA 2J9DA 1LWCB 3TZYA 3P45B 2OJ3A 3QIPB 2FHOB 3OFHA 1SJ4P 3PX0A 1LW2B 4HHJA 2E5IA 4IO1A 2BXJA 1NK9A 2KM8C 3JXOA 1X5PA 4DQPA 4CIOA 1VQOS 2IVYA 2HG4A 3TUPA 3W8PA 1HFEL 2HRYA 2FJXA 2VC1A 5DG9A 1SC3B 3A3PB 3NGTA
chains in the Genus database with same CATH topology
4AL7A 4Q44A 3SFGA 2I9SA 3MD3A 4F26A 4IO9Q 1AXQA 1R27B 4JI0F 3NNAA 3IG1B 4F4YA 2OPQA 2ZD1B 1X7VA 1IKVB 2CPXA 1WNEA 1HBUB 1OS5A 4DJBA 3L7OA 3K58A 2HZCA 4B3OB 1S6UA 3CEDA 1JIHA 4OZ1A 4L6V3 4ED5A 4EO8A 2NSBA 2RU9A 2AX0A 1NJIT 3V2UC 1AFJA 1U1OA 3H59A 5L8RC 3THVA 4IR9A 3JYTA 3KHHA 4RNMA 4TQRA 3MDFA 2X1AA 3SV3A 2ERRA 3CDBA 1ZPWX 1YJNS 1OSCA 3SCIE 1VJWA 2I0XA 1RWUA 2Y1RI 3E3XA 3HHKA 4R0JA 5D78A 3MMCB 1Y5LB 3MUMP 2JVOA 2W8KA 3T1HF 4XDDA 2FGOA 1DTTB 1UEUA 2JFDA 1M90T 4FF2A 3CO9A 3LAMA 2R7TA 2AW0A 2L41A 4OI0A 2DIVA 2FVRA 5AE2A 3MM8A 2CQDA 2J0SD 1FD8A 1UVNA 4PR6A 3LP0A 4F25A 1BC6A 2DR5A 1S79A 4X4OA 1FEHA 2OLWA 5C5JA 5L1KA 2VB6A 3KLHB 2W24A 1RTJA 1SH2A 3KG0A 4EGLA 2HWHA 2EG1A 4ILRA 5F8NA 3SYZA 4DSKA 1RT2A 3DCAA 4ZCIA 1C0TB 3VALA 3VAJA 2XCPA 1SL0A 2FVSA 5D6GA 2GFFA 1Z4UA 3DDNA 4MAKA 1QSLA 2BRLA 1F5BA 3UD4P 1RT7B 3PRDA 4TN2A 2DHXA 4O3QA 3VAGA 3ZFVA 1IKXB 2LU1A 4RW9A 1GH8A 1P1TA 1N5SA 4DN0A 4CO5A 4OI3A 4OHYA 2FC9A 4RBUA 2B9WA 1C0UB 1KTVA 1FRMA 4NLPA 3KKFA 1HQUB 5J2PB 1MWYA 3HDSA 3GB0A 2CQGA 1WF1A 3CCWA 1SJRA 2GHVC 2F1FA 4R0EA 3G6VA 2JLGA 1B0PA 3BEGB 2AV5A 4YY3F 1HI1A 2P9CA 4B3RF 4ZPCA 1KOHA 3TANA 3O3LA 1ELOA 1FD2A 1VQYA 2WSCC 2MPUA 4RZRA 2MZTA 1MNEA 5IM0B 2DR8A 3NBPA 1QTMA 2JVRA 3DN9A 1E6VB 3LH2S 1HL6A 4J9LA 2YKNA 3UDLA 1S1XA 2EFOA 2XNQA 4M63A 4BWMA 5CCLA 2FLPA 2UVWA 1TL3A 5K8MA 5HLFB 3CDWA 3T5HA 4FF3A 2CKWA 2FB0A 5CYQA 1RKIA 4DS4A 4DL5A 4MKAA 4USIA 4ZDNA 2AQ4A 2AJQA 1RT3B 3T5JA 3TAQA 3MR3A 5JVHQ 5BJRA 1Q7YT 3F41A 3TUIC 1YRUA 4M8LA 4FP9A 1BY9A 3PV8A 3N5BA 3BR9A 4O3OA 2ASJA 1LOUA 4KR0B 2GO9A 3GR1A 3J7Z5 3TAMB 5D4PA 1S4FA 3ICLA 3M6UA 3MECB 4EUVA 2E5GA 1LKZA 2KO1A 3G6XA 1BLUA 3LP1A 3SZ2A 3NMAA 2NPFA 1TR0A 5KG0A 5F8GA 1FDBA 3BSOA 4FS1A 2Q6BA 5EX3A 2RQKA 3V4IB 3EGNA 4HDHA 1LFWA 1RTHB 5HBMB 5HMWA 3H40A 4ELVA 2EWHA 3HKZD 3MMAA 1IKYB 4A8YA 4O4GA 2MHNA 2R8KA 4YR2A 1SBRA 2DGWA 1JLCA 1U1RA 4AYBD 1TKTB 2RF2A 2FVQA 3EUNA 3D0HE 3CCSS 4IRDA 1S0MA 1VC6A 4C8KA 2EPIA 5CZXA 4IRKA 3MM5A 3GV5B 1QLNA 1R0AA 4IDKA 1ZETA 1SKRA 3MFIA 2XB2D 4PWDA 2XI2A 2ZJRQ 1QM9A 4NCBA 1FJ7A 4U7UK 2QV6A 3PHEA 1JK9B 3MHYA 4C8OA 3G9CA 3CC7S 2C3OA 2EFVA 3QJLA 3QAEA 3KLVA 1Y4ZB 4D3HA 1X4CA 1X8DA 3VZHA 1JLEB 5A0YB 5EDWA 1JJ4A 3DLKA 4G1PA 3BGRA 3GZ7A 1NJYA 2JJ4D 3DRSB 4HH1A 4A47A 1B64A 4F67A 3K5PA 2VQEF 1FXDA 3T6JA 5KOWA 1R7IA 2FDNA 1MROB 5KT7A 1KN6A 4DSFA 2FLNA 1G1XA 5KT3A 2HLUA 2Z2MA 2RRNA 1FVSA 2GGPB 4DN9A 4ED7A 4LF9F 2E9RX 2RIJA 4KIAA 3E51A 2DISA 1TFYA 4Y65A 2HVIA 1JLFB 1PC4A 5E3CA 4JI8F 2PN6A 2R7OA 1YITS 1Z2LA 4I0WA 1RA6A 5B08A 2WK4A 4RW6A 3LOUA 2LEPA 2E7WA 2OPPA 2ZHOA 1Y00A 1YIJS 3NL0A 2UZAA 4LUBA 4RU9A 4P2SA 3GWCA 3OXLA 2IYGA 3VAIA 2D7SA 2JSXA 1S1TB 3K5LA 4XPEA 3BO4A 1N88A 1RT6A 2W4DA 2IVFB 2HHXA 4LMZA 3TUZC 1L3KA 3SQGB 1M5PC 2JEFA 4ZKAA 4I6YA 3U1NA 3GV7B 1JLAA 2MZSA 3OTCA 2QMWA 3W2VB 2G4BA 3CD6S 2GJ2A 4IG0A 5J2QA 4YUDA 4C8NA 4WKRA 2E5HA 5EGYA 3CD0A 2POKA 3KLGB 2P9EA 2K1RA 1FA0A 3JTOA 3NKYA 4WK1A 3TAPA 3MEDA 4ZCMA 4OI4A 1N54B 2CIMA 2IAJB 3FSXA 4OZJA 2F9DA 3MEEB 1KOOA 4R8UA 1VHFA 2FHJA 2UVRA 2FUG9 2LXFA 3DU5A 4Q5VA 4DR2F 2DRAA 4ZHRB 2MZQA 4TY8B 5KFNA 1HNXF 2AJ4A 4NCGA 3PW5A 2AWZA 2FTRA 3UWTA 1NK7A 2W9BA 5D77A 3RB6A 3RB4A 5B0AA 2LMIA 1REVA 2MYFA 3M2RA 1I94F 2UVVA 4B9LA 4EBCA 4B9VA 2IBOA 2IC3A 2OPSB 2WTFA 2DIUA 4RLEA 1DAXA 3OL7A 1OQ3A 2CPHA 3R5AA 2KXHA 2B6AB 4KO0B 2HNYB 1GXUA 3H2LA 2ZJPQ 2WB4A 1HBOA 4I6AA 4KBIA 5EWFA 4KB7A 1B7FA 3EZ5A 1JMTA 3C6TB 3V6JA 1MMDA 2X1FA 4X4RA 3PNIA 3FRZA 5M2PA 2YY3A 1F5AA 4DX8H 2Z2LA 2XSFA 2I38A 3DRRA 3HZGA 3KLIB 4LSLA 2GQCA 3BSAA 4ETZA 2AYGA 2A3JA 1Q7LB 3DMJB 3PR4A 5T7LA 1HNZF 1ZTWA 4RU2A 1L3VA 3M6VA 1YQHA 4ZVFA 1O5JA 2W25A 2QT7A 1U6BA 4K5RA 1N0UA 3OPKA 3SSRA 2RQMA 4A46A 4KTQA 4J9SA 3ENVA 3FFIB 3DI6B 3IS9A 5KFAA 1TP7A 4OMFG 2DPJA 2IM2A 2C3PA 2YVSA 2ZH4A 4DV3F 5GAHU 2PE8A 3HHLB 3UI3A 1S99A 4Y3CA 5B0FA 1NO8A 1HWKA 3IBWA 1VRTA 2VFRA 1QAXA 5H9EJ 4ID5A 5KFOA 5J1PA 2VBZA 3G96A 3I31A 2GW8A 3RZAA 3PR5B 4C3KA 1VQPS 3S1TA 3DGPA 1RI7A 2OPRB 1EETA 3MEKA 5D4OA 3Q8QB 2MQOA 3EXCX 4QYZJ 2R8HA 5A6WA 4ZS6A 2W7AA 1HNIA 4JV1A 5G0RB 4KHPF 4N77A 4WTYA 2VFUA 2PI5A 3MTJA 1C4AA 3CJKA 1S6PA 1T8EA 2KTQA 4A8FA 4WU2A 3DOMA 1L3UA 3VWSA 1G6BA 1X5SA 2BZ2A 3I0SA 4IH5A 2FC8A 4NCAA 1NK0A 4C7QA 4ECYA 1WTBA 3CJ5A 1FK9B 4NA2A 5KFBA 4DL7A 1UFLA 2DNOA 2ZDPA 3I87A 5AXLA 3RBDA 2CVEA 4N8OA 5CHCB 1VBYA 3FMWA 4QWDA 5CYJA 2FHKA 1N5TA 1DLOB 1X4AA 1YVFA 1Y9OA 4HI1A 4RKUC 3RB0A 5K8PA 3HT3A 4ECQA 2C3MA 1RTDA 2YNIB 2WHOA 4I56A 5K14B 1JLBB 2R7WA 3M30A 4V19X 1APSA 1HPZA 3W3SA 3QGPA 5T41A 4NLVA 4ICLB 4B3SF 1UFWA 1JJHA 2KFZA 2NS1B 4ZVEA 3GSDA 5GAEI 4Q45A 4PRFA 2N4CA 2JZ5A 3AJ2A 1S6QB 3V6KA 3I5AA 3VAKA 4Y34A 2VFSA 3CD7A 1C2PA 2U1AA 3DU6A 5EUHA 2KG0A 3VAHA 2K8GA 1SUQA 4CH1A 3HVRA 5KFIA 2MXYA 4LSNB 4DOZA 4DG1A 3LWLA 2DVIA 5F8MA 4UY85 4NOHA 1UEVA 1VQLS 3KMQA 3WZ0A 2J7WA 3IO1A 2QO3A 3MMBB 4FN5A 3OW2R 4RBTA 3CCZA 2QA4S 3ZZ0A 3DRXA 3N0VA 3V5RA 1FXRA 2KRBA 1GTEA 4H4MA 2R9LA 1RT1B 5K9FA 3DOKB 2LDYA 2RRBA 3NRBA 3RRKA 4IH6A 3TOQA 4BCAA 2PIIA 3KG4A 4KE5A 1ZTTA 5GAGU 3H5UA 2NQPA 4DLGA 2HHSA 3MR2A 3ZZUA 3J7ZT 2X1GA 4C97A 1QVGR 4DPOA 1TAUA 1ZAVA 1NB7A 1Y0HA 5GMKa 2RILA 4G6VB 1S1UA 3GFYA 4B3MF 2BANA 2F40A 3OUYA 2HMIA 3PX4A 2CQ4A 3IA0A 3L3CA 3HHNB 2YNGA 4RUAA 1LQ9A 3BO2A 4F50A 1N34F 2LLZA 3M1VA 2KM8B 2GA7A 4Q2LA 4R5PA 4LF5F 2BQUA 2K3KA 4O4RA 5DGAA 4DL4A 4OX7A 4ES2A 3KTQA 4MYTA 1G3OA 4MK8A 3CDEA 4X4TA 2K2PA 3H2UB 4JI2F 2C22A 2QIFA 5HO4A 1YJUA 4JV5F 4A8XA 4AXJA 3QJPA 1HNVB 2FHJD 2HHTA 1SKSA 1HWJA 3E01B 2J9DE 5JVGQ 5A8WB 4X62F 2XS2A 1JNRB 2IM0A 3KLEB 2KZMA 3GIMA 5D3GB 1X9MA 2E29A 1Q8LA 3LAKA 3MM6A 1LW0A 5KFUA 4ED1A 4QWEA 2MB0B 2ZC4A 1U8SA 1HBMB 4TXSA 5J2MB 5H1SV 2JX2A 4GKJF 2PT0A 1BD6A 3O1LA 2X51A 2ZHAA 1L3SA 2EVZA 3D1QA 5I3UA 1DQ8A 1RT4B 1N5YB 1FKOB 1GX6A 4RUCA 3A1YG 1X0FA 2VG6B 5T14A 2YNHB 1LWCA 5KFSA 1VQ4S 3CJ3A 4ECRA 2E9TA 1D0EA 1DTQB 3D5MA 2DHGA 4QWCA 3RAQA 3QIPA 1VK3A 2ASDA 3I6PA 4LT6A 1RYRA 2OD4A 1TL4A 4OHZA 2KH9A 4BBYA 2OP5A 5KFHA 3CF5Q 3M2UA 4I64A 3D1HA 1KNZA 1FRXA 2MQMA 5KT5A 2V8DA 3RR7A 2KVIA 2MKKA 1DFDA 2KT5A 3IRXB 4OJGA 4ITSA 1SJQA 3H2VE 2OTLS 3KOAA 4MIAA 5CZVA 1PSDA 1UAWA 2HAIA 2VBWA 4QBUA 2Q6CA 4H4KA 4JV0A 1TL1B 4C3MA 2UUAF 1FESA 1Z2ZA 1YI2S 4DV4F 2DH9A 2WOMB 1KR4A 2ZBCA 3BGUA 3IAS9 1N36F 4QZVB 3CCUS 1L5UA 1H7XA 1RK8A 2CQCA 2QRRA 3CGIA 1IBKF 4IUFA 4G3IA 1NJWA 3CDAA 1S0NA 1YBAA 1X4EA 5E3QA 2EK1A 3DLGB 3JSYA 4B9TA 2HPUA 3N9UC 3PKYA 1UA1A 2HFZA 1T94A 5BYRA 2ZD1A 2PI4A 1IKVA 3BB5A 1HBUA 5F0WA 2OMOA 4EU0A 4B3OA 1FKPB 2KT3A 1NK4A 1UVIA 3MTKA 3KMSA 4EYHB 3RB3A 3VR1A 1KVIA 1FNMA 4JI3F 1HI8A 5KFLA 4I4BA 3DLHA 2UU9F 2JEIA 5E3RA 2EG2A 2EBGA 2BE2A 1U47A 5MAOA 1WD6A 3MMCA 4CO4A 1FRJA 4ZP6A 4N76A 2FLLA 2NR0A 1OWXA 3LP2A 4RX6A 2DNRA 2LDIA 1LWEB 1PILA 2N7YA 4RW7B 2HHVA 4E0DA 2KU7A 4URGA 1OPZA 3WC2A 4AE5A 3MCSA 2M4MA 4ZK7M 2CQBA 1X9SA 4OHWA 1F60B 5D4LA 4CNYA 5C25B 5CD4H 3NLCA 1SC6A 3KJVB 3QJJA 2CJBA 5C42A 3H20A 1BQNA 1QSYA 1KHWA 4LFAF 3NAIA 1EP4B 2PA3A 2QA1A 4OQJA 1FJCA 5IT4A 3KLHA 1VIXA 1JKHB 5DLGA 4ES3A 3UCZP 1D9DA 3PY8A 4WZQA 2B7BB 4Z2XA 5KFJA 2HS0A 3HLUA 1KFSA 3I56S 2DR7A 1C0TA 3MPYA 3CCES 4CO0A 4KGKA 3O5TB 3GR0A 4G1IA 2LQJA 2DRBA 2MZRA 5J2NB 3KK2B 2FJAB 4YB7A 2KT2A 5KFDA 3FGVA 3KHGA 3LGMA 1RT7A 1VOMA 5DDOC 3JSMB 1UVJA 1MW7A 2HFNA 4CTAB 1IKXA 2PDAA 2YH0A 3W2WB 4C0BA 4MIWA 4PG8A 1UJ5A 3FEZA 1UMJA 1C0UA 2QLXA 4NL5A 4LVNP 4WFBQ 3M8RA 1HQUA 4A8QA 4LF4F 4GMKA 5J2PA 4TU8A 2ZNZA 4C98A 2JLFA 2BJDA 4QW8A 4EWTA 2Y1IA 5C24A 3BQ0A 1R6YA 2YWKA 2F8MA 2ADBA 2OKQA 4QJVA 4ILMA 5KG4A 1O0PA 1FRLA 5HL7Q 4DQQA 5FJ4A 4ECXA 2B5JB 2XMMA 5IM0A 1QUPA 2GQQA 1XWLA 1BGXT 3LF0A 1T05B 2G9OA 1E6VA 4CH0S 2BR0A 4Q0BB 1VRUB 1HA1A 3O6QA 5SUHA 4X4QA 4NYOA 2CVIA 3N6MA 2EFPA 5IFMA 5HLFA 1DRZA 4X4UA 1D3WA 2HNDB 4BC7A 3OV7A 4CCHA 4O3SA 5HP1A 3QMQA 2ILYA 4B17A 4IRCA 4NLTA 2DO4A 2DT9A 2D9PA 2K7KA 2ZHBA 4J9NA 4DV2F 2ASLA 1A9NB 1N8RT 1RT5A 2DTJA 3HKWA 4ZPWR 3C2PA 1GQEA 4DSJA 3T1AA 2OAUA 3ENWA 5JJBA 2P5VA 3J7YI 4W92B 3TQ1A 2YX1A 1XMQF 3TAMA 2XULA 3MECA 3UCUP 1NHVA 2HS3A 4M1KA