2KJWA

Solution structure and backbone dynamics of the permutant p54-55
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
96
structure length
96
Chain Sequence
MDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures and backbone dynamics of the ribosomal protein S6 and its permutant P(54-55)
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S6
total genus 16
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kjwA00
4YY3F 2UUCF 1HR0F 4YHHF 1N34F 4JYAF 4B3SF 4LF4F 2ZM6F 2E5LF 2VQFF 1IJEB 2BVZA 2UUAF 4NXMF 2B7CB 3T1HF 4DV3F 3ZZPA 2BXJA 1I94F 4X66F 4LFAF 4DV2F 4JI0F 1G7CB 1FKAF 2UXDF 1N33F 2RJZA 4JI3F 1F60B 4LF7F 4DR2F 1HNWF 1XNRF 4GKJF 4JI2F 4DV7F 4X62F 4DR7F 2YY3A 2J5AA 1RISA 4DR5F 3R3TA 1J5EF 1QJHA 4AQYF 1HNXF 2UXCF 3OTOF 4DUYF 1LOUA 5BR8F 4GKKF 1IJFB 1G1XA 1IBLF 4LFBF 4LF6F 4DR1F 1B64A 4DR6F 4B3MF 2UU9F 2VQEF 4JI8F 2UUBF 4OX9F 2HHHF 4LF9F 4JI6F 2KJWA 1HNZF 4JI5F 4K0KF 1CQNA 4LF8F 4JI7F 4DV0F 1XNQF 1XMOF 4DV4F 1FJGF 5LMNF 4JI1F 2UXBF 1N36F 1N32F 1VMBA 4DUZF 4DV1F 4DR4F 1XMQF 5LMUF 4DR3F 4X65F 4LFCF 4JI4F 1IBMF 4LF5F 4DV6F 2F4VF 4B3RF 1CQMA 4JV5F 4B3TF 1GH8A 1IBKF 4KHPF 5AJ3F 4X64F 2KJVA 3T1YF 4DV5F 4NXNF 5IWAF 2B7BB
chains in the Genus database with same CATH superfamily
1R8AA 1KOOA 1NNDA 3ILIA 4OI4A 4CO4A 5DO2A 5IOLA 1TL3A 3M32B 5KG5A 3IN5A 1VQMS 1OQ6A 2HGMA 1IKWA 3NGRA 3N4WA 3VQSA 3W65A 2KH9A 2RU3A 5ETQA 2JC0A 2B43A 3MMAA 3ZTRA 1IKXA 2FJDB 5BYQA 1J5EJ 4LFAJ 2RQKA 4ZLNA 3CJRA 3OJSA 1WHWA 3ZNUA 4F4AA 3OUYB 1XMOJ 4B9TA 4F7VA 1HMVB 3OQ2A 1IBMJ 4C8OA 3W2WB 1JLBB 2VKRA 2MZSA 3GE9A 3KLHA 2Q3PA 1NM2A 3FSIA 5B09A 4I2QB 4I64A 2IA6A 1FWKA 2ZNYA 2I5JB 1TK5A 2VV5A 2DNHA 2MQMA 3R7NB 1NDCA 2NXCA 5KFYA 1NZAA 4CYUB 2Y3YA 4DZDA 3RB0A 2R42A 2B5JB 2VG5B 2A3JA 3F0NA 4QU7A 1O8BA 3HHKA 3QMQA 1HARA 1MWQA 4WXWA 4NOHA 1UCNA 2BE7D 4GKJF 1URRA 4OYIA 4ID5A 4ZHRB 3GFHA 1KWMA 4LBHA 5KFOA 1BC6A 3M9OB 3UN3A 3I0RA 1RAGB 1VQSA 1S1UB 3OTCA 3TI0A 2AU0A 3D1OA 3KK1A 3CC7S 1TZ0A 3TZYA 4NZ0A 3AQOA 1NHVA 3V6JA 2Z2LA 4FBUA 1Y3KA 1ZAWA 5KT5A 3QLHB 1NBEB 4AQYJ 1LWCA 1NJWA 3H4DA 5GAGI 4JV1A 3OR2A 3H59A 4QYRA 1JIHA 2K1RA 5KTQA 2XLIA 4ELUA 5CYMA 1SC6A 4XDDA 3E01B 1SV5A 5KT7A 4RLEA 3LOUA 1GMVA 1C4CA 3I0RB 4AXJA 1S1UA 3T5HA 4IRDA 3V4IB 4LF6F 1YX2A 2MGZA 4UQGA 1X0PA 1XERA 1WJ9A 3G2XA 4WTOB 1QY7A 2XB2D 1EETA 1RKJA 1IR2A 2GAGC 2I38A 3D3BJ 4G65A 5A6PA 2FPHX 1QLNA 2C2OB 2LQBA 3ISZA 3TVZA 3QT6A 2IRYA 1TL1A 3PRDA 5A0YA 2V94A 4ZCIA 2ZOMA 2VJUA 2C22A 3D5MA 5A76A 1CJVB 1TQLA 5J2NA 4IRCA 2OTJS 4NMXA 1S0VA 5DM6Q 4OV6A 3ZTPA 2BJ9A 4LR7A 4R0EA 4DR5J 1NEEA 2LYVA 4JV0A 2O01C 3IRXB 3D6FB 2A1BA 1EHWA 1Z4UA 3NS6A 2B8QA 2HBRB 3GTYX 2I6WA 4KFBA 2EK6A 3ISNC 1TL7A 4F4ZA 3IGVA 4ZITA 2W1BA 3AJ1A 3BM7A 3D6TB 2VG7A 3CDUA 3FC9A 5DDQC 5D6GA 5E3AA 3MMAB 1SH2A 2HLUA 3OR2B 2LU2A 3I5AA 3POTA 3IRXA 2Z0GA 5K9FA 3BKFA 4E8UA 2HKEA 2M7SA 1SKUB 4NEYA 5DDPC 5EWEA 4JI5J 3CD5A 3UD4P 4LF9J 4OX8A 2AV5A 1Q8BA 2BANA 4QJVA 1NB2A 2DEIA 4QWCA 2DNOA 3R8YA 3MXHP 1T9WA 5E41A 2GO9A 2OPPB 4CLTA 3KTQA 4F2SA 2XO7A 4ED7A 4CM2A 4IQXA 2AMCB 2CJBA 2YX1A 3PYEA 4USTA 4C48A 1HNIB 2HS0A 4P10A 3Q8PB 3J7A1 2BE9B 5IQQA 2GQ2A 4A8OA 3KMQA 1TUGB 3MMBA 3LP1A 2B5JA 4TQSA 4U6PA 2V4QA 2MZTA 3BO2A 4WKYA 2KFZA 4OYAA 3ZZUA 3CULA 1Y00A 2B0GA 4IG3A 2XY6A 2H1YA 3V6KA 3IXQA 2LQ5A 4JBCA 4JYAF 4R25A 3UDVA 3KJVB 2UXDJ 4ID5B 3GR0A 2LQJA 4ZHRA 4C2MA 1U02A 3EM1A 3RB6A 1TKZB 2J7KA 2CJYB 2F63A 1AUSL 2HFZA 2QC3A 3CT9A 3MM5B 5E2QA 5I4MA 5KFFA 3OW2R 1TL7B 3QO9B 2BJEA 4PWWA 5C2GA 4ILLA 4ZVFA 1F5AA 1KQSR 3PACA 1E6YB 2GMHA 2Z58B 4O4RA 2M3DA 2UUAJ 3DRPB 3HVRA 3JB9k 3LTOA 2XMUA 4KAIA 2XGQA 4JI6J 4ZA1A 2PFFB 1B0PA 1VI7A 3HJVA 1U1KA 4B3SJ 1S1WB 2C2MB 2KKHA 1E6VA 2O1PA 3LGNA 3TJ9A 3VGVA 2HHTA 1FVSA 1CVJA 4ICLA 2AF6A 2NPIA 4NWBA 4ECRA 3W5YA 1XBWA 3K89A 2UUCJ 3RRKA 4NA3A 2R7UA 4NXNJ 1FXDA 4B9LA 2HURA 2R7XA 1UPPA 4Y2IA 3MECA 1L3KA 2W2QP 5ADZA 1QAJA 2BKOA 1NPKA 2HRTA 3QQCD 2MQOA 1HBMB 1HHSA 4TY8A 3LQVA 2DNKA 3PFOA 4M5LA 4WK1A 3NY0A 1SQFA 4C8YA 2RMLA 3I31A 3MEGB 2ZM6J 4J9PA 4ZIVA 1HKAA 3LGMA 1U1RA 1KN6A 1N34J 4ZPCA 3FNNA 3VAFA 3IM9A 2EG1A 3NGTA 2WAQD 1RT6A 1V9OA 1JJHA 2ZC4A 1N56A 5HN0A 3ILJA 1I1GA 3NOCA 1T9YA 3NAHA 2NYIA 3V2UC 3OL9A 3H5UA 1WKKA 3QWUA 3W66A 1T3OA 2E1CA 3FDSA 3ET6B 3UDEA 5HATA 2BJ3A 4IRKA 2E1AA 3K5MA 2HNZB 4NRTA 3W63A 2VB6A 3KKFA 2DR6A 4C9DA 3M2RB 1NSAA 4K4YA 1KVKA 4ICLB 4RNNA 3RW7A 1I51B 1BLUA 2HZCA 2POKA 4WYWA 4FVCA 4QR0A 1M5PC 4K0KF 1U8WA 4O3OA 4RBVA 3EICA 2ZOFA 2V63A 4M5HA 3PX4A 4Q8EA 4Q5VA 1VIOA 2IBOA 2OP5A 4FYXB 4DZ6A 2FLNA 2EEYA 2V8HA 2YKNA 2Y9HA 3HSDA 2MJUA 3M4XA 1RTHA 5BXIA 1U0HA 4RKUC 5D0RA 4W90B 1BUXA 2YPZA 3DOLB 3AD7C 3W1YC 1RK8A 1RT5B 1GK8A 1WTBA 2LA4A 4U7CA 1VHIA 1TKZA 1JNRB 3BEGB 4M1KA 4A8XA 3GIKA 3PW5A 3ZTOA 2PA3A 2L48A 5HQLA 1FRLA 1VS3A 3H4BA 3MF5A 5HBMA 3MPUB 1JXVA 4WXOA 4WFBQ 4DX7A 4DL4A 3SI8A 2BQRA 1HNZJ 1Z2ZA 4DF8A 3UR0A 2H5EA 2Y1IA 2R8GA 3JSRA 1QAYA 4IFVB 2XMWA 3M6XA 2FB0A 2V9KA 2C42A 3A8EA 3D3CJ 2CG8A 3D4JA 1A9NB 4KPCA 4H4KA 2ZJQQ 2HNZA 1K44A 2OD4A 4DX5A 3HKZD 2XI3A 3D1QA 3CD6S 4CIOA 2BM1A 2BYCA 1S99A 2J76E 1NK9A 3GB0A 1M1KT 2OH2A 2WW4A 1RI7A 1M5HA 2DISA 3ZFVA 4CNYA 4YP3A 5KFWA 3GJRB 3Q8QB 2UVVA 3JYTB 1TFYA 2Z2MA 3EGZA 2VBYA 3CB4A 1YDLA 2WVBA 1UFKA 2XULA 3DRRA 4C3KA 4O0IA 1N34F 2B3TB 4PAAA 1N32J 4NCGB 2N4CA 4B3SF 1WI6A 3QLHA 5D4OA 1NO8A 5AXKA 1UWAA 1S0NA 4C4WA 8RUCA 2IDLA 2BRKA 3DMJA 4FS1A 3I87A 5IT0A 1RT5A 2J9CA 1PYSB 4FYVB 2FD2A 4ED3A 3JSYA 3BQ0A 4DR7J 2HWTA 3HCXA 4DQIA 2FC8A 3DXSX 2JEGA 2VD3A 1F9EB 1VQ9S 3K8VA 2DGSA 2HRUA 1X4GA 4HYKA 1CJUB 2ZC3A 3BGFA 3TZXA 3MEDA 3JAMU 1SH0A 2EKYA 5J1PA 5K14A 3B78A 2HAFA 3FSYA 4ZPDA 4OI2A 4HHUA 4PQUA 2C2NA 4Y00A 4M95A 3I96A 5J2NB 1UVMA 1G6BA 1IBCB 2Y1JA 1WSRA 2YKMA 3UWTA 4DR2F 2HQFA 3K59A 2WSCC 3C19A 3HHEA 4OJHA 1TAUA 1D09B 2PD1A 5KOWA 3RUBL 2W4DA 1F3FA 2DNQA 2E44A 3HLUA 1BQMB 4X62F 1RYSA 2YY3A 1TKDA 3ULHA 2D41A 3MMJA 3PKMA 4EUVA 1YLXA 2CPYA 2YQ1A 3D66A 3DRRB 3RAXA 1GX5A 1X9MA 2C3YA 4GKKJ 3M6WA 4NASA 2XLJA 4NLGA 2CQBA 1C1CA 3CVKA 4Y28C 1KFDA 3IWLA 4A8QA 2XZDB 2RT3A 1ZH5A 4ZLJA 4RR5A 1HW8A 1OY6A 1HNVB 1NH8A 1RCOB 1N0VC 2EW9A 2ZUAA 4OZ3A 5CAAA 2N3OA 4RNHA 3OR1B 4M5GA 2N82B 4YHHJ 4B9SA 2XMKA 5I3QA 1RHQB 4CLUA 3MAAA 2CUYA 1XNRJ 2CVEA 2DGOA 4MIWA 2CQGA 3BH6B 3I55S 1P9YA 2BABA 2IJNA 2Y8WA 3TUZC 3M8PA 3KJFB 1YJVA 5J2QB 1CPZA 4WBFA 4JI1J 2HK2A 3H0PA 3KXDA 4ZPWR 4NLWA 4B9NA 1WG5A 2RQ4A 1AYEA 3D54A 4K2JA 1CJKB 3VF0B 4DUTA 4C6AA 3AB4B 5KFBA 1LW2B 3EYZA 4ECWA 4MFBA 5HP1A 3M9NB 2F40A 2HEKA 2NXJA 4X4VA 4X2BA 1X4FA 3DU6A 2IRUA 1Y9OA 1Q0NA 3I5CA 5F0UA 5RUBA 5D4LA 2IVFB 1P6TA 2EWHA 5LMUJ 1W2BR 1FJGF 3MM5A 3DLHA 3TEHB 2IY5B 1MMDA 3QT7A 2O66A 1IKWB 2DXDA 1ZM2A 1R0AB 3MMCA 3TAPA 2E66A 5D0GA 2YKPA 1FCAA 3DYAB 2XGPA 2ZH8A 1JLGA 2ILYA 5HP1B 2P9CA 3GP9A 2A10A 2X1GA 4Y3CA 5A0YB 1X4BA 2JNJA 2QE5A 3K5PA 5F9LA 4Q45A 1CBKA 1UW4A 1QSYA 2FY1A 3CCVS 4Q8FA 2VF3A 3M7VA 3DNCA 1WUUA 1JLBA 3MFIA 2CJQA 3L3CA 4I69A 4RW6B 2LXIA 1MWYA 4ZS6A 2PI4A 2DO0A 2DY9A 3SCKE 3IAM9 1W2IA 2KT3A 1P1TA 2KJVA 3T19A 2NXEA 1REVA 5KFXA 4CLPA 2AJ4A 3PW2A 1SIZA 3K7RA 1RTJA 2QFIA 1FX2A 4N8OA 1SC1B 3SSRA 4X4OA 2MQPA 3B82A 2QT7A 3DI6B 3KLGA 2C28A 2AGOA 4AUKA 1SKWA 2CJKA 1REVB 3HSGA 1X5TA 5J2PA 3Q24A 3A3OB 3ZO7A 1YJ9S 5GADU 1XC9A 3H5SA 1LNQA 4BC9A 2HS4A 2VPYB 5L9XA 3VQTA 1Y5LB 2QSFA 4FXWA 1RXOB 1WC1A 2G9OA 2N4DA 1NPRA 1FKOB 3H90A 1Q7LB 3CCTA 1VRUB 4DV2F 3FRZA 5H1SV 4ZPBA 1B0VA 4NCGA 4NLOA 3SCLE 4NE9C 1JLQB 2CZ9A 2E5JA 1Q8KA 2JRSA 4NZ6A 4HI1A 1Y7PA 1UZHA 3JSMA 1GTHA 2PFDA 4IOCQ 2NPFA 3M8PB 4JI3F 1O5JA 2VQEJ 1EIYB 2BKPA 2JEIA 4WCEQ 2LQ8A 3S6EA 4OZJA 4CO0A 1U25A 3TYTA 3EVOA 2AYMA 4C11A 3HJFA 4AL5A 2AIRB 2DR9A 5KFRA 2V50A 4OI0A 4ANEA 1H7XA 3PY8A 2W9AA 2G2YA 3DLKB 1RSCA 2DHGA 2WONB 4DSLA 3WQPA 2DO4A 1S59A 3DI6A 3KLGB 3NBPA 2EG2A 2CKWA 2R8IA 3R6LB 2F4VJ 1YQHA 5THWA 3KHRA 1DRZA 5BR8F 4DFJA 2XMTA 3W2VB 1DTQA 2VIHA 3EJMA 3NAIA 3NEKA 3TUJC 1FERA 2L9NA 1FX4A 3DDIA 4LFBF 2D74B 2WONA 3FFIA 3GG1A 3TZWA 1T03B 4ELTA 1KLMB 5IT9Y 1T9TA 3PW0A 4D3HA 2RRAA 3K0JA 3D28A 5FDLB 2WRMA 1V3SA 2RS2A 1U48A 2G4BA 1WHVA 4FPIA 1ZM4A 2UV8G 2J8SA 2IYGA 2JDJA 3MTJA 4C8NA 3E51A 3OLBA 3BYPA 4LVNP 1SKRA 4LF9F 4JI5F 2D69A 2ROEA 3W61A 3AHPA 2L08A 3HT3A 3M8YA 3MM7B 4LRAA 4TKTA 4TU9A 3TVYA 4ZVOB 5DQGA 4RU9A 1VQKS 2LECA 4JOUA 2ZH6A 1H74A 4USMA 2GMLA 3DXBA 4WFYA 4RW4B 3QGHA 1XR6A 5KFGA 3J7ZT 4DLGA 1P1LA 1F5BA 2CZVC 2JL9A 2P6SA 4QPTA 3THTA 5GAHU 2GGPA 1XNQJ 1FE4A 5I3UA 3W2VA 4MYTA 3TJAA 1S6PB 5HQMA 4JI4F 2ADCA 1FE0A 5JJBA 2ABYA 2BJ8A 2C2ZB 5L39A 2CPIA 3BPDA 1FWLA 1RA6A 3DGVA 4F4WA 1S9EB 3TA0A 3LPEA 2ACYA 1YRTA 3KLVA 3CMAS 3BGRB 1OYDA 1UL3A 2JVRA 4LSZB 4YN3B 3T41A 4ANDA 4N56A 4DS4A 3NMAA 2BE2A 4DBQA 3K17A 2YTCA 3MAHA 5FDLA 2G2OA 3GJQB 5LJ3Y 1Y10A 3PW7A 1RWOB 1S97A 2CQ1A 4MT1A 1RTDA 3M8ZA 4ZVRB 1VYAA 2QEXS 4DFMA 4ZP9A 3OL7A 2EFPA 1KS2A 5IWAF 1FFWB 3FZBA 5DJBA 3G8SA 4O0NA 4NZ7A 3JSBA 5AXNA 4YHHF 4NI2B 3IG1A 2DCLA 4MK9A 1T9UA 4MKAA 3ENAA 3V4MA 1NDPA 4RUHA 3N9UC 3FSXA 5HAOA 4NYZA 1M0SA 4PPDA 3MR2A 1VDHA 1RLDA 3MEGA 4DX6A 5D4PA 1QAIA 3MPDA 1S1TA 3DRYA 3R5BA 1HPZB 2PDAA 4NXMF 4ZVTB 2LLZA 4XK8C 3T1HF 3ENQA 2DNMA 2OPSB 5LXYA 1S7HA 2GVZA 4Z7YA 1V6HA 2UUWA 3KLEB 2HNYA 2ZKUA 3CPWR 4IDKB 5J1EB 3C15B 7FDRA 5F8GA 1TV6B 4LRBA 4LFAF 3MM6A 3W8PA 4KT0C 2ZEJA 4RW8B 1ZPVA 5D3GB 2YKAA 2E9ZA 1HNWJ 2AGQA 1JB0C 2XLKA 1SIWB 2UV8A 1PYTA 1S1XA 3HVTB 4EK2A 2QLXA 4P72A 4UOHA 3CCZA 4DU8A 2PMWA 4KB7A 3VGUA 1EKSA 2AEFA 2ZJRQ 5L1JA 2IFXA 4ECTA 1M5KC 5F8HA 4MJKA 4N7TA 2JSXA 2HFSA 2J0XA 1BHNA 1TV6A 2XMAA 1CS4B 2OEJA 2FLLA 1N33J 3F56A 3HVWA 2LVWA 3EXCX 3NLCA 2H3EB 4OLPA 2V2QA 1RT1A 1X7VA 2GCFA 2DGUA 2J5AA 1RISA 2AT1B 3KK2A 3R3TA 1RT7B 4FZVA 3MM7A 2XSFA 4CP5A 4J9KA 3VAKA 2V4JA 4UOGA 2UXCJ 3BB5A 5IV3A 1GNKA 3CGIA 3EGVA 1N6QA 2HGLA 1YKWA 4P7VA 1PJ6A 3LO3A 4OHZA 4CLWA 3M1VA 3W7BA 3ISND 3NXZA 2MZRA 2Y0SD 3L95X 4IOBA 4J9VA 4C11B 3HHLB 5DM7Q 5GAEI 3UCGA 4DR6J 4LMZA 2JFKA 4PUOA 2YQ3A 4KHMA 4BWJA 2BJ7A 1LFWA 1UWBB 2AW0A 1X5OA 1RADB 4HACA 2CFXA 2WZ1A 3VAIA 2ZH1A 2VQEF 2XHCA 4KH1B 2UVUA 4K5RA 2HQGA 5JXSA 5D15A 1TFWA 3V6DA 2M70A 3AT1B 4CRJA 3PYFA 2W9CA 2HHHF 4JI7J 1JWWA 2RDDA 3DN9A 1HIYA 3IBCB 2HAIA 3CDAA 4X4PA 1MW7A 3EPIA 3CUNA 1MMNA 4OYMA 3VVUA 4OI6A 3G4SS 2CWKA 3ONQA 4NLTA 5M2RA 3UN2A 3TJ8A 5L38A 5J2PB 1KFSA 4BLGA 4DLEA 4HT5A 2Z2YB 4DL6A 3TANA 4DUZF 2CPZA 1KNZA 2FY8A 3CJ5A 2U2FA 4USHA 1XMQF 1TP7A 1DLOA 1F9FA 3IR6B 3U02A 5LSLA 4OZ1A 2HZAA 4KR0B 4XTTA 1ULRA 3R27A 4ZN3A 5KFCA 1IBLJ 4PG6A 1ROFA 4IKAA 4LF4F 4ZVEA 3O3LA 5B0FA 2EKNA 1K9MT 1IBMF 4CTAA 3LWMA 3J7AN 4G1QA 3FMWA 3HFKA 2FJBB 3QZ7A 1NDLA 2CA9A 1EX8A 4KHRA 2KN4A 1UWBA 3BQ1A 2HGNA 3C8YA 4MMOA 5I42B 2H5IB 5CD4H 2M9KA 3AA8A 4Q0BB 2HHVA 8AT1B 4A8KA 3Q8VA 2HG4A 1PBUA 5D0EA 4RU2A 4FBTA 3DFEA 3K57A 1UJ4A 2R4FA 3AD9C 3CCJS 3G8QA 3QWPA 2P9EA 2KTQA 2A18A 3GQCA 2HBYB 4PXDA 3BGRA 1RTIA 3NBPB 2K1RB 3G6ES 1H2VZ 3D0HE 3AOBA 4H4KC 4J9OA 3TARA 3R5DA 3JAMY 4RUAA 3QYYA 4YB6A 3EX7B 4X4NA 1WD6A 3KK2B 3OHAA 4DPWA 1NCLA 2G1HA 5KFVA 4CNZA 1JLCB 1PIEA 3CD0A 4LBIA 1B4SA 2MHNA 2FJAB 2QYGA 1DLOB 1T02A 1Y5IB 4CH0S 4KKOA 1EKRA 1VQ7S 2E9TA 2ROPA 3OTEA 4AL7A 2E9RX 1UEUA 5DZ6A 2FZCB 2D7SA 2MMYA 2XBPA 3FJ2A 4X4QA 4FF2A 2DNGA 3MCOA 1AZSB 4LSLB 3HXMA 3RB3A 5GADI 3RW6A 3UD3P 4YB7A 2XMVA 4OV1A 2P8IA 3I5BA 4PXBA 1RA7A 1TTHB 4NLUA 3IA0A 1WOSA 4RL1A 3BR9A 1CC7A 1NXIA 5D0HA 2CYYA 5EX0A 1QVFR 2YXLA 5J2QA 4O23A 4JI8J 4NYOA 2FJEB 3DOMA 4HACB 2Q79A 3S7RA 2BEFA 1D8YA 4IR1A 1GMWD 5C25B 1RBOB 3L7PA 3H40A 3DDKA 2XG8A 3IMQJ 4U96A 1Y0HA 4H4MB 3SFUA 1XNRF 2B4PA 2RHQB 4PABA 4JI2F 3TZZA 1YRXA 4PR6A 1E6YA 3LALA 2RVJA 2VFSA 4DPOA 1U09A 5C24A 3B6BA 3NGKA 2XM3A 1VQOS 2QIFA 3GYNA 1FRKA 1U2CA 5CA5A 4BDPA 1U24A 3RAQA 1GMWA 5DG9A 1YIJS 3AXKA 5EGYA 1LQ9A 5F8LA 2FDNA 4P74A 1HNXF 2I2YA 1Q81T 4U9RA 1JKHA 1H6KX 1LOUA 5A8WB 2VU5A 2QMWA 4TU7A 1VOMA 1AFJA 2GIQA 3DYAA 3BZQA 1TVRA 4CZCA 4KSEB 2ZH4A 2PSZA 4CLKA 3GMGA 1FFSB 1S4EA 4LR8A 4ID8A 4I56A 2FLOA 2M8HA 3HZEA 2V2ZA 3M6VA 2QA2A 1PG5B 1JJ2R 1UJ6A 2MKYA 1C4AA 1NHUA 1L3SA 3DLGB 3W64A 5E7OB 3RR8A 3DOMB 2ROGA 2W24A 3KUEA 3PRBA 4V1Ak 2M8DB 4CO3A 1QE1B 4GC7A 3OBIA 2ZZNA 2OELA 1U2RA 4F4XA 1OPIA 1S5ZA 4FF1A 2YNFA 3N01A 2JJ4D 3RYLA 1JNZB 2DEJA 2O67A 4Q2LA 4JI7F 2DTJA 2K06A 2ZDPA 4N5SA 4IUFA 2RAQA 3RBZA 4YFUA 2MQLA 2GHPA 1N5SA 3QNWB 2IHR1 1IKXB 2V8DA 4WF9Q 1FWPA 2DIVA 2HVEA 2C3PA 1P9QC 3MEEB 4OI1A 4C0HA 5IFMA 5HROA 2YWWA 4NL5A 3OUYA 2NXNA 3UNYA 4DFKA 3MD1A 2DNLA 3W62A 4LF4J 1YSJA 4Q44A 1FNXH 4KGXB 1AT1B 3UCZP 4RBTA 3Q8YA 3MM8B 5LJ5Y 1NH7A 2GC8A 2MPUA 4N77A 1NU4A 3IS9A 5AE1A 5B08A 2F4FA 4IG0B 1SJ3P 4LSNB 3BBBA 1F0XA 3PG9A 1WKLA 3CCRS 2MQNA 1VQPS 2NZCA 4CH7A 1HWIA 2X3DA 4JV5F 4B3TF 2C1EB 4DHVA 5A8KB 4X4SA 3C46A 2DB1A 5I3PA 2E1RA 3DLGA 2G1DA 2ZDOA 4Z7CA 1MN9A 2DGWA 2AJFE 3RZAA 3M2UB 2MEWA 4NLYA 2D3OR 2AD9A 4Z2XA 4LF6J 4YB5A 1DTTB 4JYAJ 3VZIA 4EZ6A 2XS7A 2X7IA 1MU2B 3B54A 4O3PA 3TQ1A 3ELHA 2J7UA 4OQJA 4DG1B 4G1QB 4IO1A 1VIXA 4EZ9A 2V4JB 1RT6B 4B3OB 1OWXA 2Z56B 2E1MC 5FD1A 3DLKA 3H2LA 1HL6A 4M5DA 5C24B 1LWFB 1SJQA 3OV7A 2CQ2A 2PE8A 2H9ZA 2ZH3A 2RUSA 5AJ3J 4WU2A 1LXJA 2V68A 5F8MA 5KFLA 1I94J 1AB8A 3UQSA 3GLJA 1TELA 3O6QA 1LW0B 2CQ4A 4AT1B 3QO9A 4OHXA 3FUYA 3SV3A 3O1LA 5A8RB 4ILRA 2FYXA 2PIIA 2OGUA 2RSQA 4ZCMA 2FQQB 2X3GA 2HHHJ 3G6YA 2UXDF 2PO4A 4ERDA 5ETVA 4P2XA 1PYOB 2I8EA 4NI2A 1CJVA 1RZMA 2ZH9A 3D1HA 2NLWA 3CIMA 4DUZJ 4USWA 1KVIA 2RS8A 3BKUA 1UP1A 3CJ3A 3QJLA 1FRXA 3Q89A 4X84A 4L3KA 4HTIA 3VGTA 1S1TB 5KAKA 2UP1A 2E5GA 1NKCA 4WZMA 2IC3B 4F0MA 4DR5F 5GAHI 2KHDA 1MWZA 4IFYB 1QJHA 4WE1A 3W60A 2MKHA 2OUGA 1WC6A 3EUNA 3GIRA 1S1VA 3NS7B 4CT9A 2G0CA 2RE1A 4OX9J 2XS2A 2WVFA 2D9PA 1LWFA 3CIZA 3I9ZA 2MQQA 3TW0A 1ZYQA 2UXCF 4DUYF 1UAWA 4F3MA 3R9LA 2CNLB 4LQ3A 4O3QA 3BS9A 1S72S 3BDEA 1NRKA 2W4CA 4WWSA 1XR7A 1FHTA 3F44A 3KLIA 1WNEA 3CE8A 5LSRA 4FKYA 4F8RA 2HVZA 4B02A 3AAWB 4F0HA 1BQMA 2FC9A 4PCQA 2R7WA 1VJQA 3QBCA 1R6VA 1RT3B 3HD2A 2MY8A 2EFVA 1BWVA 4LSNA 2XSJA 3HFZB 5B0AA 3MM9A 4EO8A 2CQPA 1YJNS 1NK6A 1SJRA 4LBPA 3M30B 2FHJA 2GAHC 3CO0P 4JI0J 3NS5A 3RAMA 2NUHA 3CXCR 2COLA 2FVQA 3PHTA 3G82A 3G71S 4EBCA 4DSEA 1M5VC 4FNIA 2B6AB 3ITHA 4UTGA 1TL1B 2KFYA 1FEHA 3OHBA 2DR5A 1BWEA 4L76A 1ZOTA 3EZOA 3LP2A 1YBUA 4WFXA 3CMQA 2GJ2A 4WK3A 4ALZA 3EVMA 3DOKA 4M63A 5A2QY 2XNRA 1K0TA 2KRBA 1UVJA 3W2WA 3T1AA 2JLFA 2DVIA 2QA1A 4NX9A 2PN6A 2CQ0A 3HHNB 2CNKB 1V5VA 4DR4F 5F0WA 2LXFA 1EP4A 5FJ4A 5LMUF 2WSEC 2ZWPA 4DMZA 4EFAC 1QE1A 2DNNA 2C2KB 2M52A 1WHYA 1S57A 5KFZA 3DC2A 3V6DB 4JV2A 1B7FA 3Q8RB 5B7WA 3AB2B 3DM2A 4LF5F 3EE3A 4XPEA 1BQNB 2HIYA 2YWFA 4GVLA 2HS3A 3AXMA 3QT8A 4Y65A 4UZCA 2XYGB 3SBMA 4B3OA 4AL6A 1WTFA 2DH9A 3HZGA 4OJ3A 2QO3A 4FP9A 4H4MA 2HHUA 1SI9A 2DNPA 1PJ7A 1WF2A 1YWXA 2OPPA 2QG9B 2YNIB 2KXFA 1HD0A 4ZLPA 2MKKA 1UVIA 3CJ2A 4FYWB 1WOOA 1FD8A 1D9DA 2DYAA 4OX6A 4DUYJ 3JYTA 2QMXA 2CPEA 3K58A 4PG7A 1IUJA 1Y3JA 3IC1A 4F36A 4UY8T 1RDRA 4C0BA 3UPFA 1U0SA 3MDFA 4Y2MA 4DDFA 2B9EA 3C6UB 5HMXA 1EP4B 4I0WA 4P6QA 4U8VA 2G0IA 3BYRA 5ETOA 4EWTA 5CD4A 4QQBA 4E0DA 5D4NA 4AFFA 3OL8A 3KLFA 4Q0BA 2W25A 3UO0A 1VQYA 2AJ1A 4URSA 4O4GB 3OXLA 4LF5J 1I94F 5KFDA 3D0GE 4USVA 3SDEA 1K47A 2N3LA 4X4TA 4ZDNA 3D9BA 3M8SA 2R2SA 3ETOA 2X51A 1B0TA 1H72C 4JI0F 5ITHA 1TL4A 3KYLA 1RTIB 3HSJA 1QD1A 3QIPA 5CH7B 3WHIA 1T3NA 5DQIA 4FXVA 3TRGA 1HQ2A 1F60B 2B4UA 2WVCA 4Q7AA 3K8WA 4ZP6A 5HO4A 1IN0A 1U8SA 1XN9A 1XQIA 3L9ZA 2AX1A 3MURP 3HD1A 3BF4A 2ASLA 1Y11A 2QRRA 1V3ZA 5HL7Q 4WIIA 3BREA 4K4SA 2L3MA 2BA9A 1D1UA 5HROB 2V9WA 1AXQA 4OJ1A 3M2VB 3C16B 4QBUA 4RJVA 3GSIA 2B8PA 2OFHX 2RF2A 4HI2A 5KG2A 5KG6A 1SV5B 2WK4A 4TN2A 2E5LJ 1HBNA 4KYZA 2MHEA 2WW8A 3P5TL 4HLBA 1HBMA 2V8GA 4QW9A 4FXDA 5ETLA 1VLOA 4P73A 1VQ4S 3VGSA 5L46A 3RR7A 1NJXA 2OEMA 3U7JA 4F4KA 4WZQA 1NMEB 1KC8T 2GMJA 5JMNA 2J9EA 1RABB 2RF2B 2Y1LB 4GKJJ 2IC3A 3OFHA 3OT9A 2R7TA 2HRYA 1RT4B 3M9MB 3JTNA 2C2DA 3IAS9 2RIJA 2XI2A 1S79A 3I6PA 1HHTP 2UUBF 3F41A 2DGTA 1FXLA 2CRLA 1NSQA 1ZBTA 4RZRA 2IAJB 5SUHA 5K8OA 2X1AA 4OIXA 1QUPA 4RPFA 4NEZA 1CJKA 2HNDB 3M8RA 3MCMA 1SL1A 4FF3A 3M2RA 3UDCA 2YNGB 1OS5A 3GWCA 1HLWA 1QM9A 1FJCA 2RKIB 1Q8IA 2D1CA 2WVDA 4WPAA 3KUGA 4ECSA 3C16A 1N54B 4HR2A 3OFFA 1YJUA 2OPRA 4JI1F 2UXBF 1RLCL 3K5OA 3UDLA 2N7CA 4UOFA 3G6XA 3KHLA 4DV1J 2MZ1A 4IR9A 4CT8A 5EN1A 2YWKA 5J1NA 2MKIA 1SCJB 2P6TA 3SQOP 1JLCA 2Z30B 3G82B 3DLJA 5F41A 5HK4A 1VBKA 3RBDA 2MZJA 1NK8A 2XYHB 2J6TA 1T05A 1FDDA 1KP6A 4F04B 3VALA 2L9WA 4I2PA 5DG7A 2Q43A 1HNIA 1WACA 4S0MA 2RQMA 3GU0A 3LP1B 3QGIA 4TXSA 4U7UK 4PXCA 5C42B 4QWDA 4ECYA 4K4WA 2J6SA 4DCJB 1WDDA 1I6JA 3GIMA 4Y34A 2C2EA 4DQSA 1QDUB 1S77D 3E2EA 4K5SA 4RW7A 4ZVQB 2ZH5A 4JV5J 1S4FA 1BXNA 4I2PB 1RWXB 3DCAA 3MFHA 4OYWA 3T9ZA 2B7BB 2ZKTA 5G0RB 3IR5B 1FI4A 4DN0A 2BANB 1C2PA 2ZVSA 4DR2J 1JXLA 1BY9A 4XO0A 5B0BA 5HVHA 3Q2SC 3ILLA 2KG0A 1C0TB 2FVSA 4J91A 3AJ2A 2CZ4A 1M5SA 3EXYA 3PFEA 1S9EA 3TAQA 3BO3A 3BN4A 2QTWA 4HVZA 3CJ0A 1UPMB 3FZ2A 1GEHA 2VQFF 2DJWA 2G2ZA 3HDSA 1WC4A 4OFZA 4TLQA 2OEKA 1KQFB 2V8PA 1NJYA 4DV4J 3WZ0A 3CSKA 1PKUA 3RRHA 3EDRB 4JI2J 3B4DA 3FCHA 2V34A 5CYQA 3UR3C 2J0QD 3CO9A 2DR7A 1JX4A 2ZNZA 3QATA 3M05A 1PC4A 5LM7E 2W7PA 1F2HA 2KDOA 4URGA 4I67A 2QL9B 2YH1A 1QSSA 2KT2A 2MKJA 4D3GA 3G8TA 2XHWA 2OJ3A 5D8HB 4X65J 2BDPA 1U4BA 3BH7B 1U6ZA 2RH3A 3ZZZA 2MKCA 2ATLA 1H7WA 1SXLA 1TUWA 2MZQA 2P2CB 1FNMA 3PCOB 6FDRA 3T5KA 2FHJD 1HPZA 4WTYA 2VOOA 1GXTA 1IXKA 2IA0A 2V2KA 1U1NA 4K4VA 2MSSA 2ZHOA 1K1QA 5CYJA 1N5VA 2EBGA 2GVZB 2LP4A 2PT0A 4FDFA 2AYBA 1YHQS 5SZTA 1HBUB 1P27B 5IV4A 2YNGA 4ED6A 2MY7A 2BBEA 2EK1A 3R5CA 4EBDA 3GR1A 4ZCLA 1WKJA 2GJIA 2IMOA 3LH2S 1ZTWA 2P9GA 4MIBA 1FK9B 4ZVHA 1T95A 3A13A 1JLAB 3N28A 4ITSA 2ZD1A 4W4MA 3QJJA 1FO1A 1W7WA 1CSJA 3J7Z5 1NHKL 2D3O1 2M0GB 1RE1B 1KQGB 1RAJA 2IYIA 1RTDB 1UEKA 4TY8B 1SH3A 1SPBP 3PO5A 3P6YC 1RAOA 3SCJE 1Y4ZB 3FBEA 1TUVA 1FFGB 3H25A 4YR2A 1B64A 2E1PA 4OL8A 2XEXA 3FFIB 4B3MF 2H4WB 8ATCB 2CQDA 2NXUA 3QT5A 3CJQA 3ZZ0A 4TY9A 1D0EA 1H3DA 4JI8F 3TVKA 3E8OA 1RBAA 1N52B 4L73A 2ZITA 1IQZA 1O6XA 1PC5A 1RCXB 4LF8J 4Y2KA 2HBQB 2ACMA 2KJWA 4DV2J 2HPUA 1R31A 5L1LA 3J80U 4J9UE 2XZWA 4R5PA 2QA4S 1OY8A 3FK4A 3KUHA 2NR0A 2K3IA 3H2UB 1IKVA 2AJQA 1WG4A 3QSYB 2GFFA 4ER8A 3NKYA 4USJC 1WG1A 4W98A 4Z37A 2H48B 4I6AA 5LMNF 3KLEA 1AFIA 1HWKA 1I3OB 2HQIA 5B0EA 3VAJA 3US5A 5IXUA 1N36F 1Q8LA 5AE2A 3MCSA 1CEZA 1RAFB 4OYPA 3LAKA 1V3RA 4P71A 5HQ8A 1ZTTA 2IJRA 4CLYA 5K8NA 4OJGA 5H9FJ 2M4MA 2PEHA 3TNVA 3X3UA 1EZZB 2W9CB 2YVSA 1NB7A 4K0KJ 3M30A 4FYYB 4HT7A 1JLFB 3MZIA 3NP5A 3ZNJ1 2IPOB 4I7FA 2VZ9A 3KNAA 1F5CA 1MROB 1NUEA 5K5MA 2B9YA 1SKSA 4I6YA 3ZC4A 3EGNA 3OTBA 1SQGA 3I56S 1RT1B 2F9JA 4DL0C 4F67A 2WSFC 5HBMB 2BE2B 1YITS 4X64F 4MKYA 3WIVA 1EQ0A 4ETZA 4FF4A 4K50A 2VG6B 1JLFA 3QJPA 3TR5A 4C0OC 3X1LB 1N32F 4HL9A 2UUCF 1N6QB 5T7LA 3R1HA 3PNIA 3FVYA 4IH6A 1LXNA 3NGUA 3U1NA 4YY3J 1FDBA 4PPZA 4NLXA 1RTJB 2QMUB 4OMFG 1FTCA 2A2DA 3P49B 2KU7A 1XMQJ 3D0IE 1CJUA 4QIEA 4TYAA 1UFWA 2VG6A 1PCAA 3QIDA 4G1IA 3PYDA 3U27A 5KFEA 1SJFA 3HF5A 4YDDB 3CCES 5L8RC 2F7VA 1RGVA 1FJGJ 1DJ0A 2BJDA 3CNQP 3DHWC 4ZCKA 2FVCA 4KFBB 4PXEA 2DY1A 5HMZA 2F8MA 4YB1P 2VG5A 3Q86A 4KRWA 2HVDA 5HLFB 1J5OB 1HBOB 4NMLA 1MLAA 2RDIA 3R97A 4ZMMA 1VC0A 2JVOA 4QWAA 1XEZA 5H9EK 1AW0A 3BKTA 3IM8A 2J9DA 2PC6A 3VTIA 3G96A 4LFCJ 3V6HA 1PBAA 2X1BA 1HA1A 1X4CA 2YKOA 2GO8A 1HMVA 3BGUA 3N79A 4QZVB 2RHSB 1S9FA 1LEOA 4C98A 1D3WA 2WVEA 1JLQA 1RQ0A 4KY3A 4RO0A 4ZJQA 2DHHA 3NRBA 4U67Q 2GS8A 1TK8A 2HSEB 1GX6A 2RRBA 1S0OA 3MEDB 4ILMA 2DKOB 2HVHA 3ZXWA 3Q2TC 1AROP 3QRRA 3T1HJ 4DV0J 4WP9A 4QWBA 3ENWA 2R2RA 3LP2B 5H9FK 4G1PA 1R0BG 3GFZA 1R0CB 4R5PB 2DHXA 4LREA 1H0HB 4OLOA 3H20A 3HULA 4CTAB 1U49A 2XMMA 2DGQA 4KE5A 2R7RA 3OTOF 1T05B 3W9IA 1HWLA 3FBCA 5A2QU 1WDTA 5DRKA 2KI2A 1LV5A 2UU9J 3CDWA 4GO7X 1KVJA 2EC0A 4NYPA 4V19X 2HK3A 2CIMA 3KK1B 2VHGA 2NREA 3IWXA 1NK4A 1L3TA 5E5NA 3A1YG 4NLQA 1ZZNA 2JLGA 4CLSA 4PUOB 5K20B 1O0PA 5HI7A 2APOA 1YRUA 1BQNA 2VFTA 1RU1A 2WOMA 5E0OA 5KT4A 1VFJA 1N4LA 1IBKJ 2GJFA 3FCVA 2FHOB 2ZHAA 1UFLA 1JLAA 1R8CA 3H5YA 2KB2A 5LOQA 1U1OA 4O44A 2YBVA 1S1WA 3MWBA 1E6VB 2ILZA 2QSWA 2CJXB 3LP0A 2BOAA 3A4TA 4U95A 4QPXA 5DQHA 4J9NA 2VKZG 2GHVC 2WBRA 2F5GA 3N0VA 3OTDA 3P96A 4KKOB 2MLXA 4ZVPB 4R8UB 1EQMA 5FLXU 4Q2MA 1QSLA 1XNQF 1FT8A 1R6YA 1F9HA 1RHMB 4KH0B 1FKOA 1C1BA 4P52A 3ZTQA 4QOTA 4DV4F 2LQ9A 1DQAA 1RYRA 3MOJB 1RT4A 2K2PA 2VBWA 5B0CA 1VMBA 1H2UX 2AZ3A 2DRAA 5L1IA 2R3VA 4CO2A 1NAQA 1VR6A 1VRTA 2VPZB 4NLRA 1FJEB 1X4DA 3LP0B 4H4OB 4FYDA 4PZVA 2VL1A 4X65F 2MB0B 1RWWB 5F9NA 3W5ZA 4CWBA 4JB8B 4RW9B 2WBMA 2GW8A 1N5YB 1UA0A 1Q79A 5ETKA 4B3RF 1HBOA 1K0VA 3OJUA 2KT5A 4Y0FA 2E5IA 3MR3A 2AP6A 2V8VA 4DCOB 1U45A 4ETXA 1MN7A 3I0SA 5MAOA 4LRCA 1OY9A 4IH7A 4BBYA 2RB7A 2ASDA 1CS4A 4N8NA 5CYMB 5GMEA 3E01A 2FJVA 5DETA 1X9WA 1N0UA 1N33F 2FTRA 5U47A 2VA2A 4L74A 4WJBA 9RUBA 4RW6A 4ED8A 1H98A 4PQAA 1U47A 1C1CB 3KG1A 1VC5A 4F02A 1WI8A 3M8WA 1QVGR 2R7VA 4OYZA 5IC4B 1GT8A 3G6VA 3OTOJ 2VC0A 1HI8A 2BX6A 4EGLA 1R8PA 3W5XA 1G4CA 4CLZA 1GH8A 5E3PA 2CPDA 1L3VA 2PMHA 4M5NA 5BYRA 3PHEA 4Q43A 1IJEB 4DR4J 1FRIA 1RU2A 2W7AA 5LT5A 2FZKB 2BVZA 5K8MA 3AOCA 4A8WA 2YNHA 4GRSA 1NZ8A 4RUCA 5IM0A 2F9DA 3H7HB 1IR1A 1DQ9A 3E3XA 3JQJA 3UFCX 3EWGA 1U0HB 4P2SA 2U1AA 3U1LA 3LWLA 5HJXA 2BRLA 2WCXA 1OIAA 1KR4A 4P9SA 3OSPA 3FCWA 3C3LA 2WTFA 2QLBB 2QN6B 3NNCA 3SZ2A 2ZBPA 1VQLS 2H5JB 1LW2A 1C0TA 1U6FA 2LMIA 3BDPA 2XWYA 1RWKB 3DRPA 4ZPVR 4YR0A 2KG1A 1HYSA 2ZZMA 4HDGA 4WU3A 2AJ2A 1HI0P 1UA1A 1SVDA 2RILA 3P8BB 2UXBJ 3MEEA 1VBXA 3LW5C 3QFHA 2HFOA 1DFDA 2OSRA 1F1BB 1F6TA 1UW9A 1QTMA 1S6QB 1G2EA 1ELOA 3N6LA 5CXTA 2RD5C 5C7PA 3MR7A 5D77A 1RT2B 4N41A 2ATCB 1OSDA 2F8HA 3BN7A 4OHVA 1J5EF 4IOAQ 1T9XA 2JZ5A 3H2VE 5KFPA 1IWGA 2V67A 4YUDA 1XWLA 4M5KA 5KFIA 4K2XA 2VC1A 3W8GA 3MMBB 4MIAA 4A47A 5KFUA 4EYIB 1IM6A 2B51A 5ETSA 1S6QA 3MPVA 4JI4J 2BUNA 1VRTB 4ED1A 1N5QA 3GFYA 2ZJPQ 2ERRA 2XNQA 1HW9A 1XJWB 2RNEA 1YBAA 4G6VB 2HHPA 1YJTA 3HPOA 5KFTA 2BQUA 1B70B 2IBKA 2NSBA 1N36J 5F8JA 7FD1A 1FDNA 2IM1A 2CJ9A 2O5DA 2D9OA 3GV7B 2R2TA 4DOZA 1DQ8A 1TR0A 2A6MA 1PAEX 2W01A 3ADAC 3O44A 3PYGA 1HYSB 4OX9F 3NNHA 2MSTA 1Q53A 2B4OA 4YDXA 4CYUA 1Q4RA 1YVFA 2OIHA 4PQUB 3RJMB 4FN5A 4KV8A 3CCMS 2KVQE 4JUZA 4LF8F 1RTZA 3HI9A 1ZA1B 3SV4A 4V19J 4HDHA 3PR5B 4USUA 1XMOF 2VH7A 1HWUA 2VFVA 3CJ8A 5I3UB 2PA8D 4HTJA 4NLVA 4IDKA 4ES3A 2F1FA 5J1EA 2BZ2A 2RRNA 4ANCA 3CCWA 1RJJA 3MOZA 2JEJA 2FIUA 3JQKA 3CCQS 5KOXA 1G3OA 1VBZA 3UI3A 3PRVA 1B7YB 5JVHQ 5LMNJ 1UZDA 4AE5A 2AX0A 3PO4A 1ZA2B 4KV8B 1WEZA 1KOHA 1M5OC 4TNOA 3GPAA 3N5BA 4ED5A 2MKSA 2YQ0A 4LFCF 1APSA 2GQCA 4F50A 3FEZA 1LWCB 1PSDA 4RNOA 1YBTA 1HQEA 1TMMA 2B6AA 3ITHB 1IKYA 1HNXJ 3AY0A 3HK2A 1EAYC 2DNYA 3GSDA 3NGSA 2HQDA 3KK3B 4K4TA 4DS5A 3CCSS 2F4VF 6FD1A 4C8ZA 1W26A 1X5PA 3ZZYA 4DCPB 2E7VA 3OXFA 4DX8H 2NCKL 1Q95G 3WC2A 2CNOB 3C6TB 1SB6A 3DRSB 1OSCA 1A6LA 3BR8A 3R5GA 4R0JA 4Y2AA 1FD2A 3T1YF 4DV5F 3MCNA 1HQEB 5I42A 3RBXA 4I6WA 4B9VA 4IFVA 3P3DA 1IWAA 4ECXA 3CDBA 3RG6A 2LKZA 4LRDA 3HHLA 4FNHA 2W2OP 2PGCA 3GJSB 2VONA 1BQXA 4TLRA 2LEBA 1ZAXA 2CJAA 3O2IA 1ACMB 4CO1A 1SL2A 1HBUA 5CZXA 4ATNA 5M2PA 3PJXA 2KXNB 4CCHA 3C15A 5AE3A 4KTQA 1HQUA 3C2PA 3NL0A 4LF1A 1DURA 3BGOP 2J9DE 1RAIB 2RUGA 1RAHB 5KFQA 4ECVA 2Y8YA 1OYEA 2CDQA 4UUXA 1SUQA 2XO6A 4B08A 3VV2B 3CF5Q 4LF2A 5KFJA 2V0NA 4ECQA 2YKNB 2RU9A 3D6HB 1WF1A 4P7TA 1VK3A 1WC3A 3LAMA 2I5JA 2G0JA 3PJWA 1T0TV 2HWHA 5KFHA 3SSQA 4O3RA 1G7CB 1FKAF 5D78A 2R8KA 1UJ5A 4NLDA 4RUBA 2JX2A 2F8EX 3A8KA 3TEGA 3WBZA 2K3KA 2MLYA 4LUBA 3W9JA 3IWNC 1X31C 2ALZA 2UZAA 3T5LA 1PILA 1GXLA 4ZIWA 3PTWA 2PEBA 2Q1LA 4HH1A 2KZMA 4DWIA 5KG3A 1Q16B 3R5JB 2CQ3A 5A6WA 3W9HA 3MUTP 2ZOGA 3MEKA 4LIWA 4K7QA 3TAMB 3DU5A 4E2FB 3VWSA 4KPYA 2VQFJ 4RX6A 2K7KA 2NSCA 4DFPA 4C7QA 3FEXB 1RKIA 3QPIA 4EO6A 2J0WA 2XS5A 3KJVA 3VR1A 4GKKF 2XC9A 4ZP7A 2OLWA 3CC2S 2CXEA 1RWUA 2OKQA 1TL3B 1IJFB 2K7JA 3BPSP 3KWMA 4OZ0A 4CI0B 4PG4A 2XCAA 2QX0A 2B9WA 1RT7A 5BYSA 3TAMA 3MUVP 2HHXA 1YK9A 5CQGA 1NKBA 4A4JA 5KFNA 1S7IA 2YNIA 3M2VA 1QAXA 2EC2A 3KLIB 2W8KA 4UY85 3J7YU 1Q7YT 2HMIB 2UU9F 1KEKA 4WFNQ 1UTAA 2XCPA 2G13A 4JI3J 1YTYA 1H38A 3TOQA 3OFEA 2LDIA 5DDRC 1S0MA 3N6MA 1OO0B 3HO1A 4HKQA 2HVIA 1SC3B 2IMWP 3KLHB 5KFMA 2L41A 2JHEA 5F3TA 2KFNA 1YJ7A 1HNZF 2W9BA 3JSMB 3MD3A 3MMCB 5KG1A 1YG0A 5JUMA 3J81Y 3HHDA 1FA0A 2QLJB 4DV0F 4X62J 1M90T 2VOPA 1AZSA 4LSLA 4YEAA 1RWVB 3N5FA 4DSIA 4O4GA 1RP5A 2Q6CA 3DOKB 4TYBA 5AXMA 4M5IA 2AZ1A 3HVAA 2OPSA 3QZ8A 5DGBA 2IRXA 3EGWB 3UCUP 1RHJB 1X8DA 4XAKA 1U1PA 4USKA 4OHYA 4X4RA 3J81j 4M94A 4XIUA 3SFGA 4A8FA 4QYZJ 2V6AA 2VBXA 1KTQA 5MLCV 2IAJA 3BSOA 2HIQA 3ZZTA 2OPQB 3HX9A 2LEPA 5HJYA 4GVBB 1NDKA 3PIOQ 2YX4A 2QL7B 1MSWD 1VK8A 3QSIA 4DSFA 4UOCA 3EDQB 4P2MA 1K1SA 1R7IA 1J2VA 1TKTA 2DH8A 2ZE2B 3NG8A 3SIPB 1UETA 2HQCA 2R8JA 1CQMA 4NLSA 3KHHA 1WSVA 1GQEA 2DK2A 1KLMA 1FRMA 2ALYB 4IYQA 4OX7A 1NJZA 1KBRA 3MUMP 3HHLC 4FKXA 4ED4A 1D9AA 2DXEA 2DCUB 3CTRA 2W2MP 1R89A 1JKHB 5A8WA 2QL5B 3PJ9A 7AT1B 6AT1B 1F3VA 4IG3B 1X0FA 2KYXA 2Y0BB 1RHUB 1TVRB 3KK3A 3G9CA 1S1VB 2E5HA 3NMRA 2Q66A 4OYOA 3WX4A 2P5VA 2DNZA 2NS1B 2OHDA 1VRUA 3KFWX 2VA3A 3TUPA 3PZPA 5BJRA 4QU6A 2WHOA 1AUDA 4J9MA 5CZVA 3W3SA 4HHHA 4RWXA 1QTNB 2B7CB 1PAUB 5T14A 3C14A 2VICA 2HYIB 4DV3F 3C6UA 3A8IA 3EMTA 3S01A 2GX8A 3IR7B 2KO1A 3T6JA 5B0DA 1H73A 4CM0A 4KJIA 5JVGQ 3IGNA 2QYCA 5KFAA 3SEOA 3GV8B 1F2GA 2BW7A 2ZWOA 3D7SB 2J0SD 2KL8A 5DGAA 2WOMB 2ADBA 4J9QA 1JLGB 2BR0A 5DDOC 4CO5A 4GC6A 1R8HA 4J9LA 1RHKB 1UEVA 2AQ4A 1SUQB 3UN5A 3JQMA 1RWNB 3T6BA 1DBDA 2VDHA 2YNHB 1X4EA 2B4VA 2FVRA 4FPRA 1WEYA 4PEOA 1JJ4A 3DLEB 1FTRA 3D67A 2VPXB 4QIVA 5LL6d 4CLFA 2OTLS 2VASA 4UF4A 4R8UA 4F2RA 1R3NA 5M2UA 1PGZA 1X60A 3CC4S 3TWZA 4WKRA 3QAEA 3DGPB 4U8YA 1BE4A 1JXEA 3AD8C 3FKBA 1KSPA 2XWXA 2BM0A 1IVZA 2VDIA 1YJWS 3KMSA 1URNA 2JEFA 5AT1B 3WDOA 1VQ5S 2JFDA 1D9FA 1Q5YA 4E98A 4H4OA 1YGYA 3M2UA 5ETRA 2ZBCA 1IBLF 2Z4PA 5CHCB 1KTVA 2BOPA 1RBLA 4ENOA 1XK8A 4GMKA 4QIGA 1RAAB 4QIWD 4HH0A 4NCBA 1Z2LA 3H8YA 3MR6A 1NK7A 5ETPA 1R27B 3Q8SB 4KGMA 4DPUA 1VC6A 1VISA 2H54B 1N5YA 2Z8QA 4KBIA 3J81U 3HP6A 4MH8A 5DZ7A 5F8NA 4GO5X 3PKYA 1CLFA 1YI2S 3RB4A 1KHWA 2C3OA 3POTB 3HT0A 2IDEA 3PM9A 4OHWA 3BO4A 2EFOA 4C3MA 4DL3A 3HVTA 4YR3A 4EBEA 1Y5NB 2EXUA 3CCUS 2GGPB 4ZJOA 1CQNA 3THPA 2IVMA 4UQTA 3F73A 1LW0A 4EEYA 2AYGA 4B9UA 1XR5A 3MGJA 4EMDA 4CDIA 5LXRA 1ITPA 3AOAA 3DLEA 5G4DA 4BC7A 1K8AT 2FLPA 2HMIA 2DGXA 4IH5A 4ES1A 4M5JA 4QW8A 4N76A 4DPXA 2GA7A 3R5AA 1X5SA 3H98A 2FGOA 2GZOA 2O3DA 3SSSA 2KXHA 3BV8A 3NGDA 4LJMA 1OJ4A 5E3RA 2BQ3A 1T8EA 2GHWA 2LCWA 5L1KA 2V69A 2BJ1A 1HNVA 3CWJA 2XZTB 2V2VA 4AXIA 3V81A 2EFGA 2OO4A 4WFZA 4ZJLA 3GJTB 2ZUGA 3MTKA 3N6NA 4NA2A 1W25A 2MTLA 3AA9A 2DXFA 1VCTA 4DV6F 5DLFA 2AGPA 1VBYA 1L3UA 3MR5A 4PYDA 1T7PA 3UW1A 1JLEB 2R7QA 5HVGA 1IBKF 1IQTA 3GYGA 1TK0A 3CJSA 4A8MP 1ICEB 2ZFHA 3TX8A 2H65B 5C5JA 2CPJA 1R43A 2PMZD 3BJYA 4IG0A 4ED0A 4X4UA 2Z2ZA 1XMBA 2HFVA 4GVBA 3P4UB 3B4MA 1TMJA 3OVBA 1FK9A 2D3UA 3FQLA 4AD6A 2ZH7A 2IJFA 3M6UA 3VZHA 2QLFB 4MK8A 1HBNB 4J37A 4PG5A 3VVTA 5E3QA 5IWAJ 4QR1A 5ETMA 5BR8J 2V4RA 1U1LA 3L09A 1FKPA 4WP3A 1RT2A 4DV5J 3MM6B 2E5LF 3EZUA 5A8RA 4L3NA 1Q5VA 4Y6IA 1WWHA 3DGPA 3ZTSA 3D68A 1D8ZA 3LGHA 2KHCA 4X66J 2RDJA 4L6V3 4DSJA 3HHLD 5EX3A 2GQQA 3NWGA 5J2MA 2RQCA 3CMES 4EI2A 3ZZPA 4DL2A 3PX0A 3UE2A 1ZS6A 1SJ4P 2BXJA 4X66F 1LWEA 1SC4B 3ENVA 4OI3A 1IM4A 4M5DB 2OI2A 1KDNA 3KDNA 4LIRA 3T3FA 3V81B 3MI7X 1ZAVA 2VBZA 1LK5A 2C3MA 2I9SA 2MQ8A 3G86A 3J7YI 2XQCA 4MTPA 3S1TA 2DBBA 3SDEB 3GIJA 2BV3A 3BGLA 1VQ8S 2UUBJ 1KRPA 1X9SA 2HNYB 4LF7F 2JH3A 2JOQA 4TU8A 4DQQA 4ELVA 1TL5A 2YPYA 3WIUA 2H51B 3C14B 3TO8A 4RW8A 1WORA 5D3GA 5EDWA 1KLNA 2AYEA 2KVIA 2LA6A 4ES2A 5CABA 2OPRB 1JK9B 2JWNA 1REGX 1S12A 5CCLA 5HLFA 4F3OA 3QRPA 2CPHA 3GYXB 3MAQA 4KHPJ 2KYZA 3I4PA 5IZHA 1HFEL 1XIQA 4ZOSA 3FEYB 4QWEA 2GIRA 2MJNA 2HFUA 3FBBA 4N47A 2XY7A 1YZ7A 5ETTA 4ECZA 4I7FB 3R1LA 4DV6J 3P5BP 4YOEA 3GIIA 1M1HA 3OR1A 3IS9B 4CQ1A 2QFJA 3KG4A 3OLAA 2OPQA 3SCIE 1ZZFA 3I32A 3V5RA 4ZPAA 5KFSA 4F25A 3QGGA 2KM8B 1WHXA 4TVAB 3SYZA 3VAMA 1MNEA 3RTVA 4XPCA 3LUYA 1AA1B 3ILOA 4F0KA 3R2DJ 1M1GA 4WYLA 4IFYA 4WE1B 3FGVA 4H54A 4J5OA 5KT6A 3DLBA 4C8MA 4PG8A 3FMBA 5GMDA 5C42A 5EWGA 4DQPA 1KONA 4UT4A 1RTHB 3GZ7A 4PWUA 3C66A 3NOGA 1VLYA 3BBCA 4RW7B 1TKXA 4LF7J 3PDNA 2AEMA 4OYXA 3AJDA 2QLWA 4ZVGA 2C3UA 1T9VA 4KGKA 2W2NP 3JTPA 4LT6A 4MFBB 1WOPA 2LFVA 1U1QA 3GFXA 4DL7A 1TAQA 1XTZA 4LR9A 1FXRA 4PWDA 4OZLA 3CD7A 4JI6F 2PI5A 5EWFA 5KG4A 2BW2A 1ZETA 4O3SA 5K14B 2EBEA 3PXGa 2HW3A 1VHFA 2QZ8A 1LFPA 2DR8A 1VRQC 2XSJB 1TKXB 3PVXA 2M2BA 3ETMA 1FRHA 4NXMJ 2LXUA 4L72B 1FESA 1J5OA 2FVPA 3CJKB 1R0AA 4FS2A 4C8KA 2RKIA 1YZ6A 3CDEA 3GG0A 3PIPQ 5F3ZA 3SQGA 2R9LA 2C2RA 4DR3F 2QGFB 1HQUB 1KKHA 3CEDA 1J27A 4DEZA 1WEXA 4OZNA 4O44B 2DRBA 3WC0A 3LANA 2HQ3A 4F3QA 4ZK7M 5KT3A 1OPZA 4TQRA 2W9BB 5E3CA 3R2CJ 4DF4A 4I68A 3KJNB 4MKVA 3IO1A 2WB1D 1RWMB 3MPWA 1CC8A 2OMOA 3UVJA 1VQNS 3OPKA 1OMSA 4F26A 2A0FB 3AQPA 3IFEA 3MAAB 5KG0A 2DHAA 4DR1J 1DARA 2XY5A 3L4BC 2ASJA 2OAUA 2CPXA 4DPYA 1N8RT 3VAGA 3K5NA 1S6OA 1FF2A 2AWZA 4U7UD 3KG0A 1A0OB 1VJWA 1HR0F 5IQ6A 4WP8A 4DXLA 4JP8A 3TA2A 3NWRA 1RACB 4K4UA 4RW9A 5T7LB 2HLTA 1RUSA 3KHGA 1B3TA 2B56A 1BD6A 2JLEA 1Q1KA 4HHJA 1FVQA 4FVMA 3CJKA 5KFKA 2JC1A 2VUGA 2KZZA 1CJTA 3OVAA 1Q86T 4HEA9 2VG7B 4DR3J 1WF0A 4RWWA 4CLLA 1UVLA 3GV5B 3SQGB 5HMWA 1NJIT 3M8QA 3GCWP 3O8WA 2UUTA 1NK0A 3JXOA 4UUWA 5KT2A 2GVDA 3DRXA 5HANA 3TQEA 3BSCA 1T11A 4USIA 3OXGA 1S1XB 1NK5A 2FJWA 1FRJA 4K8RA 2ZVIA 4DI6A 1X4AA 3RU0A 4W92B 4BCAA 2LDYA 3H5XA 3L7UA 3SXLA 4DU7A 2RJZA 2R8HA 3BSNA 4J9SA 4RNFA 3IBFB 3B8HA 3SMZA 1Q82T 1S48A 1H2TZ 3RGIA 3A8JA 2E29A 2GVDB 4ZN1A 4YQWA 5J2MB 1KHVA 4KGZB 3A3NB 2LU1A 2DGVA 4ZVUB 4MAKA 5B0GA 5IM0B 2QA4G 4C8LA 2CWXA 1S49A 1MG7A 4A48A 1EETB 4DR7F 4ED2A 4X64J 2R7SA 4L75A 2CVIA 1S10A 3CJTA 2XTJP 3EVWA 4RBUA 4AQYF 3M32A 2DNRA 2MLZA 3IG1B 4DG1A 3S8SA 4UW2A 3NCRA 1EJ7L 1DTQB 3IP0A 2HHQA 2UVWA 5FIIA 3OVSA 1K73T 2I0XA 4NA1A 2HZVA 4B3MJ 4OZ5A 1G1XA 1JQGA 4DV7J 3NNAA 4ZP8A 2LEAA 3FBFA 2HBZB 1LWXA 1RB0A 3OD2A 1JLEA 2DIUA 5AXLA 3T1YJ 2FJXA 2GNKA 4LFBJ 2KM8C 2M88A 1DZ5A 2W2PP 3K2YA 3K5LA 1JMTA 1TKTB 2CG4A 2ZE2A 3AFGA 4MKBA 3ZZOA 3PR4A 3TX0A 3CCLS 4KO0A 4A8SA 2F65A 3FRYA 3R7SB 2J8AA 3HMJG 4NRUA 2HHSA 4B9MA 2DH7A 4J7CA 1FNOA 1RHRB 2H4YB 4AYBD 1CULB 2DITA 2VPWB 2W7OA 2E7XA 3BSAA 4XDCA 3CW2C 3MM8A 2CQHA 4RW4A 4DN9A 3R7BB 5LSOA 1DY3A 1YJRA 3VCDA 4DV3J 3TP2A 1KD1T 3LF0A 3T5JA 1JJCB 3KLFB 5GMKa 1IKVB 4DV1F 4I4BA 2DHSA 4URQU 3IBWA 2YNFB 3MPYA 1S9GA 3TA1A 1N5TA 2HNDA 2YWEA 3UD5A 1CULA 2SXLA 5HSPA 3HM9A 2W4PA 2DD8S 5DS7A 2YWGA 4ZLLA 3A3PB 5F8IA 4F4YA 3NCQA 1RAEB 3G87A 5KG7A 4DQRA 2M5YA 1C0UA 2QV6A 1HHQA 2R2UA 2ZZTA 3ET6A 4J9RA 4J90A 2IM3A 1NSKL 2FGCA 5G0RA 3QFWA 2MGZB 4KQZA 1DHMA 1X4HA 4BHQA 1PO6A 2ZHBA 4P75A 3DDNA 4KO0B 5AJ3F 3I4HX 2EI5A 4IO9Q 3QGPA 3JTOA 3PEHA 4B3TJ 1RT3A 3PV8A 3RBEA 2IVYA 2ZBQA 3I0SB 3Q22A 2ASYA 4WIQA 3KOAA 3PW4A 5EHHA 1PJ5A 2CDRB 2EVZA 5IC6B 3RRGA 4NXNF 4YY3F 5A8KA 3DKDA 1ZPWX 2IM0A 4QCLA 3Q23A 3HFVA 2E7WA 3FQKA 3AODA 3QAUA 1QUVA 1U2FA 4I2QA 2A2CA 3DOLA 4DL5A 2AJ0A 2OMLA 1CG2A 3KJQB 1LK7A 2B9XA 2MYFA 5E33A 4PKDB 4C3LA 9ATCB 2ZM6F 3EPGA 1U1MA 4KC5A 1EARA 2ZBRA 4IQMA 2UVRA 1VGYA 1S9GB 2GIFA 4A46A 3C6TA 1FEEA 2UUAF 1TU0B 4YS2A 2DRDA 4KGVB 2NYHA 2YKQA 3H42A 3PEJA 4WFAQ 1N88A 3CJ4A 1FJ7A 1WC0A 1UVNA 1VQ6S 5GVQA 2VFUA 1C0UB 3J80Y 2AEJA 3KDOA 3ZZRA 5DLGA 2NZ4A 1NKEA 2DT9A 5C25A 2EPIA 1DAXA 1HI1A 2I1RA 1NPPA 5T41A 4PWDB 4NPOA 2ZH2A 5CYQB 5ETNA 3OL6A 1ZM9A 3T9NA 2OSQA 3O5TB 1GFWB 1HNWF 3LPYA 4MYUA 3GCXP 3LA0A 2DPJA 4M5MA 3GONA 3THVA 1C1BB 1HWJA 2J7WA 5GAGU 4DV7F 2FZGB 1SJ1A 4ECUA 4NLPA 3BBFA 2WB4A 2ZD1B 1HD1A 1NSPA 3V4IA 2KRRA 4BWMA 1U6BA 3A12A 4A8YA 4M8LA 3Q83A 1T94A 1MROA 4QR2A 2J6UA 3DMJB 2GV1A 4LVOP 1IKYB 4ZVSB 4YMEA 2CQIA 2OFGX 3Q0AA 4EYHB 1IR0A 1LKZA 3ICLA 3M1VB 5GAEU 1SL0A 5IT9U 2BMBA 1UVKA 4Y2CA 4OZ2A 5HVFA 1MU2A 4PRFA 2YWHA 3MM9B 2VFRA 2BKNA 1BGXT 3TUIC 4ZPTR 4DJBA 4BS2A 3DRSA 3WX8A 1GMUA 4QIFA 1A7GE 3UNGC 3VAHA 4KIAA 2K8GA 4CH1A 2IM2A 4DR1F 5H9EJ 4DR6F 5C2CA 3UVJB 4NCAA 2FHKA 2NUUG 2CPFA 2FHMA 1B99A 1U26A 4K4XA 2HHWA 5K8PA 1O51A 1SQEA 2D3ZA 2YKMB 3BQ2A 1FDAA 1WELA 3QRQA 3R6GB 4C97A 4I1TA 4B3RJ 2YH0A 3I82A 3EZ5A 2A6OA 1S6PA 4OYBA 3HKWA 4K4ZA 3DLLQ 2F3JA 5CCMA 1EB0A 2R7OA 3QIPB 2EFQA 2EFNA 1Z1ZA 3NCPA 4P2FA 1Q78A 1S6UA 4O3NA 2Z57B 5DG8A 4UZBA 2N7YA 2V5HG 2VJVA 1T03A 4K59A 4MK7A 3JS9A 3VHQA 1UMJA 2X1FA 2BACA 1L5UA 2QJ3A 3MECB 2AKWB 3P45B 1KQKA 3PX6A 1CJTB 4G3IA 4QYZK 1V5IB 1BMQB 2IIHA 4B17A 2ZBIA 4DSKA 2NQPA 1FKPB 3OFGA 3M8QB 2L9DA 5FLXY 3D6MB 1R8BA 2AHOB 2Q6BA 2CNNB 2CAJA 3MHYA 2VODA 2W8LA 2CADA 3I9V9 5HMYA 5IT4A 1HR0J 3Q8UA 2OD6A 1RWPB 2FUG9 2HFNA 2Y1RI 3DHXA 1U7LA 1I5OB 4LQ9A 4ZKAA 4PYAA 2MXYA 1LWEB 2MDAA 3IRWP 1ZM3A 2DPIA 5L9NA 2XMJA 1GXUA 1WC5A 3AH6A 3U1MA 2HWIA 2CQCA 1N48A 1DTTA 3OSNA 3GILA 1NLKL 1SBRA 4KHPF 1GTEA 3L7OA 1S76D 1MMLA 4LRFA 4EU0A 3DM2B 3D2WA 2XYPB 4DPTA 5EUHA 3KNGA 4RNMA 2YX7A 1GAOA 1P8GA 1UKUA 5IS2A 3HSZA 1OQ3A
chains in the Genus database with same CATH topology
1R8AA 1KOOA 1NNDA 4CO4A 4OI4A 5DO2A 5KG5A 1TL3A 3M32B 3IN5A 1VQMS 1OQ6A 2HGMA 1IKWA 3VQSA 3N4WA 2KH9A 2RU3A 2JC0A 2B43A 3MMAA 1IKXA 2FJDB 5BYQA 2RQKA 3OJSA 1WHWA 3OUYB 4B9TA 1HMVB 3OQ2A 4C8OA 3W2WB 1JLBB 2VKRA 2MZSA 3GE9A 3KLHA 2Q3PA 3FSIA 5B09A 4I2QB 4I64A 2IA6A 2ZNYA 2I5JB 1TK5A 2VV5A 2DNHA 2MQMA 5KFYA 1NZAA 3RB0A 2VG5B 2B5JB 2A3JA 1O8BA 3HHKA 3QMQA 1HARA 4WXWA 4NOHA 4GKJF 1URRA 4ID5A 4ZHRB 3GFHA 5KFOA 1BC6A 3M9OB 3I0RA 1VQSA 1S1UB 3OTCA 3TI0A 2AU0A 3D1OA 3KK1A 3CC7S 1TZ0A 4NZ0A 3AQOA 1NHVA 3V6JA 2Z2LA 4FBUA 1Y3KA 1ZAWA 5KT5A 3QLHB 1LWCA 3H4DA 5GAGI 4JV1A 3OR2A 3H59A 4QYRA 1JIHA 2K1RA 5KTQA 2XLIA 4ELUA 5CYMA 1SC6A 4XDDA 3E01B 1SV5A 5KT7A 4RLEA 3LOUA 4AXJA 1C4CA 3I0RB 4IRDA 1S1UA 3T5HA 3V4IB 4LF6F 2MGZA 4UQGA 1X0PA 1XERA 1QY7A 2XB2D 1EETA 1RKJA 5A6PA 2I38A 2FPHX 1QLNA 2LQBA 3ISZA 3TVZA 2IRYA 1TL1A 3PRDA 5A0YA 2V94A 4ZCIA 2ZOMA 2C22A 3D5MA 1TQLA 5J2NA 2OTJS 1S0VA 5DM6Q 4R0EA 1NEEA 2LYVA 4JV0A 2O01C 3IRXB 2A1BA 1Z4UA 3NS6A 4KFBA 2EK6A 3ISNC 4F4ZA 3IGVA 3AJ1A 5DDQC 3BM7A 2VG7A 3CDUA 5D6GA 5E3AA 3MMAB 1SH2A 2HLUA 3OR2B 2LU2A 3I5AA 3POTA 3IRXA 2Z0GA 5K9FA 4E8UA 4FS1A 5EWEA 2M7SA 5DDPC 3CD5A 3UD4P 4OX8A 2AV5A 1Q8BA 2BANA 4QJVA 3MXHP 4QWCA 2DNOA 5E41A 2GO9A 2OPPB 3KTQA 4F2SA 2XO7A 4ED7A 4IQXA 2CJBA 2YX1A 1HNIB 2HS0A 3Q8PB 3J7A1 5IQQA 2GQ2A 4A8OA 3KMQA 3MMBA 3LP1A 2B5JA 4TQSA 4U6PA 2V4QA 2MZTA 3BO2A 4WKYA 2KFZA 3ZZUA 3CULA 1Y00A 2B0GA 4IG3A 2XY6A 3V6KA 3IXQA 2LQ5A 4JBCA 4JYAF 4R25A 3KJVB 4ID5B 3GR0A 2LQJA 4ZHRA 4C2MA 3RB6A 1TKZB 2J7KA 3CT9A 3MM5B 2HFZA 5I4MA 5KFFA 1HHTP 5E2QA 4ILLA 3OW2R 3QO9B 2BJEA 4ZVFA 1F5AA 1KQSR 3PACA 1E6YB 2GMHA 4O4RA 2M3DA 3DRPB 3HVRA 3JB9k 2XMUA 4KAIA 2XGQA 4ZA1A 2PFFB 1B0PA 1VI7A 1U1KA 1S1WB 3LGNA 2KKHA 1E6VA 2O1PA 1FVSA 1CVJA 4ICLA 2AF6A 2NPIA 4NWBA 4ECRA 1XBWA 3RRKA 4NA3A 2R7UA 1FXDA 4B9LA 2R7XA 4Y2IA 3MECA 1L3KA 5ADZA 1QAJA 2MQOA 1HBMB 1HHSA 4TY8A 3LQVA 2DNKA 3PFOA 4WK1A 4C8YA 2RMLA 3I31A 3MEGB 4J9PA 3LGMA 1U1RA 1KN6A 4ZPCA 3FNNA 3VAFA 2EG1A 2WAQD 1RT6A 1V9OA 1JJHA 2ZC4A 1N56A 5HN0A 1I1GA 3NAHA 2NYIA 3V2UC 3OL9A 3H5UA 2E1CA 3QWUA 1T3OA 3FDSA 2E1AA 3K5MA 2HNZB 4NRTA 2VB6A 3KKFA 4C9DA 3M2RB 4K4YA 4ICLB 4RNNA 3RW7A 1BLUA 2HZCA 2POKA 4WYWA 4FVCA 4QR0A 1M5PC 4K0KF 4O3OA 4RBVA 2ZOFA 4Q8EA 3PX4A 4Q5VA 1VIOA 2OP5A 2IBOA 2FLNA 2V8HA 2YKNA 2MJUA 3M4XA 1RTHA 4RKUC 4W90B 3DOLB 1RK8A 1RT5B 1WTBA 2LA4A 4U7CA 3GIKA 1TKZA 1JNRB 3BEGB 4M1KA 4A8XA 3PW5A 2PA3A 2L48A 1FRLA 1VS3A 3H4BA 3MF5A 5HBMA 4DL4A 4WXOA 4WFBQ 2BQRA 3SI8A 1Z2ZA 4DF8A 3UR0A 2H5EA 2R8GA 3JSRA 1QAYA 4IFVB 2XMWA 3M6XA 2FB0A 2V9KA 2C42A 3A8EA 4B3OB 1A9NB 1GH8A 4H4KA 2ZJQQ 2HNZA 2OD4A 3HKZD 2XI3A 3D1QA 3CD6S 4CIOA 2BM1A 2BYCA 1S99A 2J76E 1NK9A 3GB0A 1M1KT 2OH2A 1RI7A 1M5HA 2DISA 3ZFVA 4CNYA 4YP3A 5KFWA 3Q8QB 2UVVA 1TFYA 3JYTB 3EGZA 2Z2MA 2VBYA 3CB4A 1N34F 2XULA 3DRRA 4C3KA 4O0IA 2B3TB 4NCGB 2N4CA 4B3SF 1WI6A 3QLHA 5D4OA 1NO8A 5AXKA 4C4WA 1S0NA 3DMJA 2BRKA 3I87A 5IT0A 1RT5A 2J9CA 4ED3A 2FD2A 3JSYA 3BQ0A 2HWTA 4DQIA 2FC8A 3DXSX 2JEGA 2VD3A 1VQ9S 3K8VA 2DGSA 2HRUA 1X4GA 4HYKA 2ZC3A 3BGFA 3MEDA 1SH0A 2EKYA 5J1PA 5K14A 3B78A 4ZPDA 3FSYA 4OI2A 4PQUA 4Y00A 4M95A 3I96A 5J2NB 1UVMA 1G6BA 2Y1JA 2YKMA 3UWTA 4DR2F 3K59A 2WSCC 3HHEA 1TAUA 4OJHA 2PD1A 5KOWA 2W4DA 2DNQA 2E44A 3HLUA 1BQMB 4X62F 1RYSA 2YY3A 1TKDA 3ULHA 2D41A 3MMJA 3PKMA 4EUVA 2CPYA 3RAXA 3DRRB 1X9MA 1GX5A 2C3YA 3M6WA 2XLJA 4NLGA 2CQBA 1C1CA 3CVKA 4Y28C 1KFDA 3IWLA 4A8QA 1ZH5A 2RT3A 1HW8A 1HNVB 1NH8A 2EW9A 1N0VC 4IRKA 2N3OA 2N82B 4RNHA 3OR1B 4B9SA 2XMKA 5I3QA 2CVEA 2DGOA 4MIWA 2CQGA 3I55S 2BABA 2IJNA 3TUZC 3M8PA 1YJVA 5J2QB 1CPZA 4ZPWR 4NLWA 4B9NA 1WG5A 2RQ4A 3D54A 3VF0B 3AB4B 5KFBA 1LW2B 4ECWA 4MFBA 5HP1A 3M9NB 2F40A 4X4VA 4X2BA 1X4FA 3DU6A 2IRUA 1Y9OA 3I5CA 5F0UA 5D4LA 2IVFB 1P6TA 2EWHA 1W2BR 1FJGF 3MM5A 3DLHA 1MMDA 2O66A 1IKWB 1ZM2A 1R0AB 3MMCA 3TAPA 2E66A 2XGPA 2YKPA 1FCAA 3DYAB 2ZH8A 5HP1B 1JLGA 2ILYA 2P9CA 2A10A 2X1GA 4Y3CA 5A0YB 1X4BA 2QE5A 3K5PA 5F9LA 4Q45A 1UW4A 1QSYA 2FY1A 3CCVS 3DNCA 3MFIA 1JLBA 2CJQA 3L3CA 4I69A 4RW6B 2LXIA 1MWYA 4ZS6A 2PI4A 2DO0A 3SCKE 3IAM9 1W2IA 2KT3A 1P1TA 2KJVA 3T19A 1REVA 5KFXA 2AJ4A 3PW2A 1SIZA 3K7RA 1RTJA 4N8OA 3SSRA 4X4OA 2MQPA 3B82A 2QT7A 3DI6B 3KLGA 2C28A 2AGOA 4AUKA 1SKWA 2CJKA 1REVB 5J2PA 1X5TA 3Q24A 1XC9A 1YJ9S 5GADU 3H5SA 4BC9A 2HS4A 2VPYB 5L9XA 3VQTA 1Y5LB 2QSFA 4FXWA 2G9OA 2N4DA 1FKOB 1Q7LB 3CCTA 1VRUB 4DV2F 3FRZA 5H1SV 4ZPBA 1B0VA 4NCGA 4NLOA 3SCLE 1JLQB 2E5JA 2JRSA 4NZ6A 4HI1A 1Y7PA 3JSMA 4IOCQ 1GTHA 2NPFA 3M8PB 4JI3F 1O5JA 4WCEQ 3S6EA 4OZJA 4CO0A 1U25A 3TYTA 2AYMA 4C11A 3HJFA 2DR9A 5KFRA 4OI0A 3PY8A 1H7XA 2W9AA 3DLKB 4DSLA 2DHGA 2WONB 2DO4A 3DI6A 3KLGB 3NBPA 2EG2A 2CKWA 2R8IA 1YQHA 5THWA 3KHRA 1DRZA 5BR8F 4DFJA 2XMTA 3W2VB 1DTQA 3NAIA 3TUJC 1FERA 2L9NA 4LFBF 2D74B 2WONA 3FFIA 3GG1A 4ELTA 1KLMB 5IT9Y 3PW0A 4D3HA 2RRAA 3K0JA 3D28A 5FDLB 2WRMA 1V3SA 2RS2A 1U48A 1WHVA 1ZM4A 2UV8G 2IYGA 2JDJA 3MTJA 4C8NA 3E51A 3OLBA 4LVNP 1SKRA 4LF9F 4JI5F 2ROEA 3AHPA 2L08A 3HT3A 3MM7B 4TKTA 4TU9A 3TVYA 5DQGA 4RU9A 1VQKS 2LECA 4JOUA 2ZH6A 2GMLA 3DXBA 4WFYA 4RW4B 3QGHA 1XR6A 5KFGA 3J7ZT 4DLGA 1P1LA 1F5BA 2CZVC 2JL9A 2P6SA 4QPTA 3THTA 5GAHU 2GGPA 1FE4A 5I3UA 3W2VA 4MYTA 1S6PB 4JI4F 2ADCA 1FE0A 5JJBA 2ABYA 5L39A 4F4WA 2CPIA 1RA6A 1S9EB 3TA0A 3KLVA 2ACYA 1YRTA 3CMAS 3BGRB 4DS4A 1UL3A 2JVRA 4N56A 3NMAA 2BE2A 4DBQA 5FDLA 2YTCA 3MAHA 5LJ3Y 3PW7A 1S97A 2CQ1A 1RTDA 2QEXS 4DFMA 4ZP9A 3OL7A 2EFPA 1KS2A 5IWAF 3FZBA 5DJBA 3G8SA 4NZ7A 3JSBA 5AXNA 4YHHF 3IG1A 2DCLA 4MK9A 4MKAA 3V4MA 4RUHA 5HBMB 2XS5A 3N9UC 3FSXA 4NYZA 1M0SA 4PPDA 3MR2A 3MEGA 5D4PA 1QAIA 1S1TA 3DRYA 3R5BA 1HPZB 2PDAA 4NXMF 2LLZA 4XK8C 3T1HF 3ENQA 2DNMA 2OPSB 5LXYA 1S7HA 1V6HA 2UUWA 3KLEB 2HNYA 2ZKUA 3CPWR 4IDKB 5J1EB 7FDRA 4LFAF 5F8GA 1TV6B 3MM6A 4KT0C 4RW8B 5D3GB 1ZPVA 2YKAA 2E9ZA 2AGQA 1JB0C 2XLKA 1SIWB 2UV8A 1S1XA 3HVTB 2QLXA 3CCZA 4KB7A 2ZJRQ 5L1JA 1M5KC 4ECTA 2IFXA 5F8HA 4MJKA 2JSXA 2J0XA 1TV6A 2FLLA 3F56A 3HVWA 2LVWA 3EXCX 3NLCA 4OLPA 1RT1A 1X7VA 2GCFA 2DGUA 2J5AA 1RISA 3KK2A 3R3TA 1RT7B 4FZVA 3MM7A 2XSFA 4J9KA 3VAKA 2V4JA 3BB5A 1GNKA 3CGIA 1N6QA 2HGLA 4P7VA 3LO3A 4OHZA 3M1VA 3W7BA 3ISND 5DM7Q 2MZRA 2Y0SD 3L95X 4IOBA 4C11B 3HHLB 5GAEI 3UCGA 4LMZA 2JFKA 4PUOA 2YQ3A 4KHMA 4BWJA 1LFWA 1UWBB 2AW0A 1X5OA 2CFXA 3VAIA 2ZH1A 2VQEF 2UVUA 4K5RA 5JXSA 1TFWA 3V6DA 2M70A 2W9CA 2HHHF 1JWWA 3DN9A 2HAIA 3CDAA 4X4PA 1MW7A 3EPIA 3CUNA 1MMNA 4OI6A 3G4SS 3ONQA 4NLTA 5M2RA 1KFSA 5L38A 5J2PB 2JEIA 4DL6A 4HT5A 3TANA 4DUZF 2CPZA 1KNZA 3CJ5A 2U2FA 4USHA 1XMQF 1TP7A 1DLOA 1F9FA 3IR6B 3U02A 5LSLA 4OZ1A 4KR0B 1ULRA 3R27A 5KFCA 4PG6A 1ROFA 4IKAA 4LF4F 4ZVEA 3O3LA 5B0FA 1K9MT 1IBMF 4CTAA 3LWMA 4G1QA 3FMWA 3HFKA 2FJBB 3QZ7A 4KHRA 2KN4A 1UWBA 3BQ1A 2HGNA 3C8YA 4MMOA 5I42B 5CD4H 4Q0BB 2M9KA 3AA8A 2HHVA 4A8KA 2HG4A 4FBTA 4RU2A 3DFEA 3K57A 1UJ4A 2R4FA 3CCJS 3G8QA 3QWPA 2P9EA 2KTQA 2A18A 3GQCA 4PXDA 3BGRA 1RTIA 3NBPB 2K1RB 3G6ES 1H2VZ 3D0HE 4H4KC 4J9OA 3TARA 3R5DA 3JAMY 4RUAA 3QYYA 4YB6A 3EX7B 4X4NA 1WD6A 3KK2B 3OHAA 5KFVA 4CNZA 1JLCB 3CD0A 5HROA 2MHNA 2FJAB 1VQ7S 1DLOB 1T02A 1Y5IB 4CH0S 4KKOA 2E9TA 4OHYA 2ROPA 3OTEA 4AL7A 2E9RX 1UEUA 4X4QA 2MMYA 2D7SA 2XBPA 3FJ2A 4FF2A 2DNGA 4LSLB 3HXMA 3RB3A 5GADI 3RW6A 3UD3P 4YB7A 2XMVA 4OV1A 3I5BA 4PXBA 1RA7A 4NLUA 3IA0A 3BR9A 1CC7A 2CYYA 5EX0A 1QVFR 5J2QA 4O23A 4NYOA 2FJEB 3DOMA 3S7RA 2Q79A 1D8YA 4IR1A 5C25B 3L7PA 3H40A 3DDKA 2XG8A 1Y0HA 4H4MB 3SFUA 1XNRF 2B4PA 4JI2F 1YRXA 4PR6A 1E6YA 3LALA 2RVJA 2VFSA 1U09A 5C24A 3NGKA 1VQOS 2QIFA 3GYNA 1FRKA 5CA5A 4BDPA 1U24A 3RAQA 5DG9A 1YIJS 5EGYA 1LQ9A 5F8LA 2FDNA 1HNXF 2I2YA 1Q81T 4U9RA 1JKHA 1H6KX 1LOUA 5A8WB 2QMWA 4TU7A 1VOMA 1AFJA 2GIQA 3DYAA 3BZQA 1TVRA 4CZCA 4KSEB 2ZH4A 2PSZA 3GMGA 4ID8A 4I56A 2FLOA 2M8HA 3HZEA 3M6VA 2QA2A 1JJ2R 1UJ6A 1C4AA 1NHUA 1L3SA 3DLGB 5E7OB 3RR8A 2ROGA 2W24A 3PRBA 2ZZNA 2M8DB 4CO3A 1QE1B 4GC7A 3OBIA 1U2RA 4F4XA 1OPIA 4FF1A 2YNFA 3N01A 2JJ4D 3RYLA 1JNZB 2O67A 4Q2LA 4JI7F 2DTJA 2ZDPA 4IUFA 4N5SA 4YFUA 2MQLA 1N5SA 2GHPA 2IHR1 1IKXB 2V8DA 2DIVA 2C3PA 1P9QC 3MEEB 4OI1A