2KK2A

Nmr solution structure of the pheromone en-a1 from euplotes nobilii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
YNPEDDYTPLTCPHTISVVWYECTENTANCGTACCDSCFELTGNTMCLLQAGAAGSGCDME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords En-A1
publication title Antarctic and Arctic populations of the ciliate Euplotes nobilii show common pheromone-mediated cell-cell signaling and cross-mating.
pubmed doi rcsb
molecule tags Signaling protein
total genus 18
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2009-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.40 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 2kk2A00
2KC6A 2KK2A 2NSVA 2JMSA 2NSWA
chains in the Genus database with same CATH superfamily
1EQNA 2AU3A 4EDKA 4E2KA 3KLSA 1DDEA 2LMKA 2KK2A 4EDTA 1ERCA 2NSVA 4EDGA 4EDRA 3KXRA 1DD9A 4EDVA 2B39A 3B39A 2NSWA 3CU7A 2ERLA 2KC6A 4EE1A 2JMSA
chains in the Genus database with same CATH topology
1EQNA 2AU3A 4EDKA 4E2KA 3KLSA 1DDEA 2LMKA 2KK2A 4EDTA 1ERCA 2NSVA 4EDGA 4EDRA 3KXRA 1DD9A 4EDVA 2B39A 3B39A 2NSWA 3CU7A 2ERLA 2KC6A 4EE1A 2JMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KC6 A;  2KK2 A;  2NSV A;  2JMS A;  2NSW A; 
#chains in the Genus database with same CATH topology
 1EQN A;  2AU3 A;  4EDK A;  4E2K A;  3KLS A;  1DDE A;  2LMK A;  2KK2 A;  4EDT A;  1ERC A;  2NSV A;  4EDG A;  4EDR A;  3KXR A;  1DD9 A;  4EDV A;  2B39 A;  3B39 A;  2NSW A;  3CU7 A;  2ERL A;  2KC6 A;  4EE1 A;  2JMS A; 
#chains in the Genus database with same CATH homology
 1EQN A;  2AU3 A;  4EDK A;  4E2K A;  3KLS A;  1DDE A;  2LMK A;  2KK2 A;  4EDT A;  1ERC A;  2NSV A;  4EDG A;  4EDR A;  3KXR A;  1DD9 A;  4EDV A;  2B39 A;  3B39 A;  2NSW A;  3CU7 A;  2ERL A;  2KC6 A;  4EE1 A;  2JMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...