2KKDA

Nmr structure of ni substitued desulfovibrio vulgaris rubredoxin
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
52
structure length
52
Chain Sequence
MKKYVCTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEFEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title An NMR structural study of nickel-substituted rubredoxin
pubmed doi rcsb
source organism Desulfovibrio vulgaris str. hildenborough
molecule tags Electron transport
total genus 2
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2009-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2kkdA00
1E8JA 1LKMA 3KYUA 2KN9A 1QCVA 1IU6A 1B71A 1S24A 1T9QA 1R0IA 1B2JA 1T9OA 4RXNA 3RZ6A 3PWFA 3SS2A 4POGA 7RXNA 5RXNA 1S30A 1YV1A 4AR3A 1CAAA 1JYBA 2PVEA 1SMUA 1YK4A 1IRNA 1DVBA 2K2DA 3PZAA 2QL0A 1LTLA 1RDGA 1R0JA 1RB9A 3RYGA 3MPSA 1T9PA 3KYYA 1IROA 1BE7A 1BFYA 1B13A 1LKPA 1DX8A 1FHHA 3RZTA 2PVXA 1NNQA 3QVDA 4TPUA 3KYXA 2HR5A 1R0HA 5AI3A 1BQ8A 1B2OA 1R0GA 1LKOA 1R0FA 4ME3A 4AR5A 2KKDA 1RYTA 2PYAA 1C09A 2VL6A 1RDVA 4YWMA 5IY0A 8RXNA 1SMMA 2MS3A 1IU5A 1QYBA 2V3BB 1CADA 4POFA 2GMGA 1RWDA 5AI2A 4AR4A 4AR6A 2LCQA 1YUZA 1VCXA 3KYVA 6RXNA 1H7VA 4YWLA 1FHMA 1ZRPA 1SMWA 2M4YA 3KYWA 2RDVA 2DSXA 1BQ9A 1BRFA 1YUXA 1S2ZA 1YK5A 3A44A 4K9FA
chains in the Genus database with same CATH superfamily
3FDJA 1LKMA 3HOUL 1K83L 1QQTA 3M3YL 1IU6A 2C6BA 3P2AA 2APOB 1PFVA 3H99A 1VZIA 3K7AL 3NFPI 3RZ6A 3PWFA 3SS2A 2JA5L 3PKJA 2O5JD 1S30A 5AN9H 2B63L 1CAAA 1JYBA 4A3KL 2NVQL 3HAXC 4AI1A 4JAEA 4A3JL 1Y1WL 1R0JA 3MPSA 3H97A 1T9PA 3PO2L 1IROA 4JADA 1BE7A 1BFYA 3WWLA 3LWPB 4BBRL 1NNQA 1PZXA 1P7PA 4A3FL 3LWVB 1BQ8A 1B2OA 4A3LL 1LKOA 1RYTA 4QIWP 2PYAA 3JR7A 2JA6L 4A3EL 1RYQA 5JVH1 3HJYB 4YWMA 3H3VM 2JA7L 2NVTL 3HOZL 8RXNA 2XJUA 4B8CD 1IU5A 5IP7L 2NVYL 2JI1A 1CADA 4A3BL 3PIP1 4TVMA 1RWDA 1WJVA 5AI2A 3S15L 3LWOB 5MGNA 1R9TL 4XGHA 1H7VA 4V196 2PPTA 3KYWA 3S14L 3LWQB 2DSXA 5C4XL 1YUXA 2R92L 2WB1P 5GADc 4K9FA 4A3DL 4G6BA 4XXBB 4C3IL 1I3QL 5EIOC 4X6AL 2C6AA 4LHNA 1B71A 1S24A 1TWAL 3S16L 3MSUA 1R0IA 1Y1VL 1T9OA 3S17L 3PO3L 1OWBA 2B5ID 3GTGL 4A3ML 2XJVA 4A3IL 1YV1A 3WWNB 3H0GL 3QQCE 5FJ8L 1SMUA 1IRNA 5MFPA 1IW7D 1DVBA 3RZOL 3PZAA 4Y52L 4JAGA 2R7ZL 2M4VA 5C44L 2WAQP 3HKZP 1TWFL 1LKPA 2CR8A 1DX8A 5M5WL 3QVDA 4TPUA 3KYXA 4ZN3B 2HR5A 5DM61 3P8BA 3GTML 1NXEA 1OWCA 2XJRA 3GTPL 1I6HL 1R0FA 4AR5A 2KKDA 3J7Y1 4C3HL 4A3CL 3PKIA 1C09A 4ZN1B 2JA8L 1SMMA 2NYDA 3S1RL 4E6YA 3GTLL 2A6ED 3B0AB 2RFKB 2XJQA 3KYVA 6RXNA 4AHXA 4YWLA 1SMWA 4Y7NL 3LNLA 3HJWB 3J7Z1 2E2HL 3A44A 2E2JL 5C3EL 5K2ME 3S1NL 1E8JA 1PFUA 3KYUA 2PMZP 3K35A 5DM71 1T9QA 4AHZA 1TWHL 3HOVL 4AI3A 4LHLA 7RXNA 5GAHc 5RXNA 2ERSA 5M3FL 2J9UB 2XJSA 4BBSL 2PVEA 1YK4A 2Z3QB 2ZIXA 4AYBP 1LTLA 3MQKB 2Y0SP 5JVG1 3S1QL 5IYBL 3KYYA 3M4OL 3I4ML 3H9BA 1FHHA 3RZTA 1PFYA 2PVXA 3HOWL 2E2IL 2BE5D 5M5YL 1TWCL 2PSMC 2CKCA 3FKIL 2H12A 2L0ZA 5MF6A 2VL6A 3GTJL 1VZHA 2AQCA 1SFOL 5H1Sc 4BY1L 4JAFA 1I50L 5M3ML 4C2M1 3RZDL 2A68D 4C3JL 2V3BB 4POFA 2GMGA 5MLC3 2LCQA 1YUZA 1VCXA 3CQZL 1FHMA 1TWGL 2RDVA 3GTQL 2JI3A 3S2HL 3S1ML 4BY7L 2JI2A 2A69D 2NVXL 2XJTA 3GTKL 2KN9A 1QCVA 3ZG6A 5IYDL 1ODHA 1B2JA 4BXXL 4RXNA 4POGA 3HOXL 5FLML 2M6PA 4AHWA 4AR3A 3GTOL 4A3GL 2R93L 2AYJA 3B08B 1VZGA 2K2DA 2QL0A 2A6HD 1RDGA 2V0FA 1RB9A 3RYGA 4A93L 3PL5A 3H9CA 2Z3RB 4U671 3IU3I 1NXGA 4GS7D 1B13A 3S2DL 1WCML 4AI0A 3PIO1 3I4NL 3LWRB 4WFN1 1R0HA 2HVYC 5MFZA 5AI3A 2AUSB 2XJPA 1R0GA 2CKAA 4ME3A 5GAEc 3HOYL 1PFWA 1RDVA 2M6OA 5IY0A 5IYCL 5C4JL 3VPBE 2EY4E 2MS3A 2VUML 1QYBA 5GAGc 4AI2A 3LPEB 2V0EA 4AR4A 2ERJA 4AR6A 5IP9L 4UY81 5M5XL 1F4LA 5EINC 1ZRPA 4AHYA 2YU9L 2M4YA 1BQ9A 1BRFA 1Z92B 1S2ZA 1YK5A
chains in the Genus database with same CATH topology
1E8JA 4G6BA 1LKMA 4XXBB 2XJTA 5EIOC 3KYUA 2KN9A 2C6AA 1QCVA 4LHNA 1IU6A 2C6BA 3ZG6A 1B71A 1S24A 3K35A 3P2AA 5DM71 1T9QA 3MSUA 1R0IA 1ODHA 1B2JA 1T9OA 4AHZA 1VZIA 4RXNA 3NFPI 3RZ6A 3PWFA 3SS2A 1OWBA 4POGA 2B5ID 2XJVA 3PKJA 2M6PA 4AI3A 4LHLA 7RXNA 5GAHc 5RXNA 2O5JD 1S30A 1YV1A 2ERSA 4AHWA 4AR3A 5AN9H 3WWNB 2J9UB 3QQCE 2XJSA 1CAAA 1JYBA 2PVEA 1SMUA 1YK4A 1IRNA 2Z3QB 1IW7D 2AYJA 1DVBA 3B08B 5MFPA 4AI1A 2ZIXA 1VZGA 2K2DA 3PZAA 4JAEA 2QL0A 4JAGA 2A6HD 1LTLA 1RDGA 2V0FA 2M4VA 1RB9A 1R0JA 3RYGA 3MPSA 5JVG1 1T9PA 2Z3RB 3KYYA 4U671 1IROA 4JADA 1BE7A 3IU3I 1NXGA 4GS7D 1B13A 1LKPA 3WWLA 1BFYA 2CR8A 1DX8A 1FHHA 4AI0A 3RZTA 3PIO1 2PVXA 1NNQA 3QVDA 4TPUA 4K9FA 3KYXA 4ZN3B 2HR5A 4WFN1 1R0HA 5DM61 5MFZA 3P8BA 5AI3A 2BE5D 2XJPA 1BQ8A 1NXEA 1B2OA 1OWCA 2XJRA 2CKAA 1R0GA 2PSMC 1LKOA 1R0FA 4ME3A 4AR5A 2KKDA 1RYTA 5GAEc 3J7Y1 2CKCA 2PYAA 2H12A 2L0ZA 3PKIA 1C09A 1RYQA 4ZN1B 2VL6A 5MF6A 5JVH1 1VZHA 1RDVA 2M6OA 4YWMA 5IY0A 5H1Sc 4JAFA 3VPBE 8RXNA 2XJUA 4B8CD 1SMMA 2A68D 2MS3A 1IU5A 1QYBA 2V3BB 2JI1A 1CADA 4AI2A 4POFA 5GAGc 2GMGA 3PIP1 4TVMA 1RWDA 1WJVA 2NYDA 3LPEB 5AI2A 5MLC3 2V0EA 4AR4A 2ERJA 4AR6A 4E6YA 4UY81 2A6ED 1YUZA 3B0AB 4XGHA 1VCXA 2XJQA 3KYVA 2LCQA 6RXNA 5MGNA 4V196 1H7VA 2PPTA 4AHXA 5EINC 4YWLA 1FHMA 1ZRPA 4AHYA 1SMWA 2M4YA 3KYWA 2RDVA 2DSXA 1BQ9A 3LNLA 5GADc 1BRFA 2JI3A 1YUXA 1Z92B 1S2ZA 3J7Z1 1YK5A 3A44A 2JI2A 2A69D 5K2ME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E8J A;  1LKM A;  3KYU A;  2KN9 A;  1QCV A;  1IU6 A;  1B71 A;  1S24 A;  1T9Q A;  1R0I A;  1B2J A;  1T9O A;  4RXN A;  3RZ6 A;  3PWF A;  3SS2 A;  4POG A;  7RXN A;  5RXN A;  1S30 A;  1YV1 A;  4AR3 A;  1CAA A;  1JYB A;  2PVE A;  1SMU A;  1YK4 A;  1IRN A;  1DVB A;  2K2D A;  3PZA A;  2QL0 A;  1LTL A;  1RDG A;  1R0J A;  1RB9 A;  3RYG A;  3MPS A;  1T9P A;  3KYY A;  1IRO A;  1BE7 A;  1BFY A;  1B13 A;  1LKP A;  1DX8 A;  1FHH A;  3RZT A;  2PVX A;  1NNQ A;  3QVD A;  4TPU A;  3KYX A;  2HR5 A;  1R0H A;  5AI3 A;  1BQ8 A;  1B2O A;  1R0G A;  1LKO A;  1R0F A;  4ME3 A;  4AR5 A;  2KKD A;  1RYT A;  2PYA A;  1C09 A;  2VL6 A;  1RDV A;  4YWM A;  5IY0 A;  8RXN A;  1SMM A;  2MS3 A;  1IU5 A;  1QYB A;  2V3B B;  1CAD A;  4POF A;  2GMG A;  1RWD A;  5AI2 A;  4AR4 A;  4AR6 A;  2LCQ A;  1YUZ A;  1VCX A;  3KYV A;  6RXN A;  1H7V A;  4YWL A;  1FHM A;  1ZRP A;  1SMW A;  2M4Y A;  3KYW A;  2RDV A;  2DSX A;  1BQ9 A;  1BRF A;  1YUX A;  1S2Z A;  1YK5 A;  3A44 A;  4K9F A; 
#chains in the Genus database with same CATH topology
 3FDJ A;  1LKM A;  3HOU L;  1K83 L;  1QQT A;  3M3Y L;  1IU6 A;  2C6B A;  3P2A A;  2APO B;  1PFV A;  3H99 A;  1VZI A;  3K7A L;  3NFP I;  3RZ6 A;  3PWF A;  3SS2 A;  2JA5 L;  3PKJ A;  2O5J D;  1S30 A;  5AN9 H;  2B63 L;  1CAA A;  1JYB A;  4A3K L;  2NVQ L;  3HAX C;  4AI1 A;  4JAE A;  4A3J L;  1Y1W L;  1R0J A;  3MPS A;  3H97 A;  1T9P A;  3PO2 L;  1IRO A;  4JAD A;  1BE7 A;  1BFY A;  3WWL A;  3LWP B;  4BBR L;  1NNQ A;  1PZX A;  1P7P A;  4A3F L;  3LWV B;  1BQ8 A;  1B2O A;  4A3L L;  1LKO A;  1RYT A;  4QIW P;  2PYA A;  3JR7 A;  2JA6 L;  4A3E L;  1RYQ A;  5JVH 1;  3HJY B;  4YWM A;  3H3V M;  2JA7 L;  2NVT L;  3HOZ L;  8RXN A;  2XJU A;  4B8C D;  1IU5 A;  5IP7 L;  2NVY L;  2JI1 A;  1CAD A;  4A3B L;  3PIP 1;  4TVM A;  1RWD A;  1WJV A;  5AI2 A;  3S15 L;  3LWO B;  5MGN A;  1R9T L;  4XGH A;  1H7V A;  4V19 6;  2PPT A;  3KYW A;  3S14 L;  3LWQ B;  2DSX A;  5C4X L;  1YUX A;  2R92 L;  2WB1 P;  5GAD c;  4K9F A;  4A3D L;  4G6B A;  4XXB B;  4C3I L;  1I3Q L;  5EIO C;  4X6A L;  2C6A A;  4LHN A;  1B71 A;  1S24 A;  1TWA L;  3S16 L;  3MSU A;  1R0I A;  1Y1V L;  1T9O A;  3S17 L;  3PO3 L;  1OWB A;  2B5I D;  3GTG L;  4A3M L;  2XJV A;  4A3I L;  1YV1 A;  3WWN B;  3H0G L;  3QQC E;  5FJ8 L;  1SMU A;  1IRN A;  5MFP A;  1IW7 D;  1DVB A;  3RZO L;  3PZA A;  4Y52 L;  4JAG A;  2R7Z L;  2M4V A;  5C44 L;  2WAQ P;  3HKZ P;  1TWF L;  1LKP A;  2CR8 A;  1DX8 A;  5M5W L;  3QVD A;  4TPU A;  3KYX A;  4ZN3 B;  2HR5 A;  5DM6 1;  3P8B A;  3GTM L;  1NXE A;  1OWC A;  2XJR A;  3GTP L;  1I6H L;  1R0F A;  4AR5 A;  2KKD A;  3J7Y 1;  4C3H L;  4A3C L;  3PKI A;  1C09 A;  4ZN1 B;  2JA8 L;  1SMM A;  2NYD A;  3S1R L;  4E6Y A;  3GTL L;  2A6E D;  3B0A B;  2RFK B;  2XJQ A;  3KYV A;  6RXN A;  4AHX A;  4YWL A;  1SMW A;  4Y7N L;  3LNL A;  3HJW B;  3J7Z 1;  2E2H L;  3A44 A;  2E2J L;  5C3E L;  5K2M E;  3S1N L;  1E8J A;  1PFU A;  3KYU A;  2PMZ P;  3K35 A;  5DM7 1;  1T9Q A;  4AHZ A;  1TWH L;  3HOV L;  4AI3 A;  4LHL A;  7RXN A;  5GAH c;  5RXN A;  2ERS A;  5M3F L;  2J9U B;  2XJS A;  4BBS L;  2PVE A;  1YK4 A;  2Z3Q B;  2ZIX A;  4AYB P;  1LTL A;  3MQK B;  2Y0S P;  5JVG 1;  3S1Q L;  5IYB L;  3KYY A;  3M4O L;  3I4M L;  3H9B A;  1FHH A;  3RZT A;  1PFY A;  2PVX A;  3HOW L;  2E2I L;  2BE5 D;  5M5Y L;  1TWC L;  2PSM C;  2CKC A;  3FKI L;  2H12 A;  2L0Z A;  5MF6 A;  2VL6 A;  3GTJ L;  1VZH A;  2AQC A;  1SFO L;  5H1S c;  4BY1 L;  4JAF A;  1I50 L;  5M3M L;  4C2M 1;  3RZD L;  2A68 D;  4C3J L;  2V3B B;  4POF A;  2GMG A;  5MLC 3;  2LCQ A;  1YUZ A;  1VCX A;  3CQZ L;  1FHM A;  1TWG L;  2RDV A;  3GTQ L;  2JI3 A;  3S2H L;  3S1M L;  4BY7 L;  2JI2 A;  2A69 D;  2NVX L;  2XJT A;  3GTK L;  2KN9 A;  1QCV A;  3ZG6 A;  5IYD L;  1ODH A;  1B2J A;  4BXX L;  4RXN A;  4POG A;  3HOX L;  5FLM L;  2M6P A;  4AHW A;  4AR3 A;  3GTO L;  4A3G L;  2R93 L;  2AYJ A;  3B08 B;  1VZG A;  2K2D A;  2QL0 A;  2A6H D;  1RDG A;  2V0F A;  1RB9 A;  3RYG A;  4A93 L;  3PL5 A;  3H9C A;  2Z3R B;  4U67 1;  3IU3 I;  1NXG A;  4GS7 D;  1B13 A;  3S2D L;  1WCM L;  4AI0 A;  3PIO 1;  3I4N L;  3LWR B;  4WFN 1;  1R0H A;  2HVY C;  5MFZ A;  5AI3 A;  2AUS B;  2XJP A;  1R0G A;  2CKA A;  4ME3 A;  5GAE c;  3HOY L;  1PFW A;  1RDV A;  2M6O A;  5IY0 A;  5IYC L;  5C4J L;  3VPB E;  2EY4 E;  2MS3 A;  2VUM L;  1QYB A;  5GAG c;  4AI2 A;  3LPE B;  2V0E A;  4AR4 A;  2ERJ A;  4AR6 A;  5IP9 L;  4UY8 1;  5M5X L;  1F4L A;  5EIN C;  1ZRP A;  4AHY A;  2YU9 L;  2M4Y A;  1BQ9 A;  1BRF A;  1Z92 B;  1S2Z A;  1YK5 A; 
#chains in the Genus database with same CATH homology
 1E8J A;  4G6B A;  1LKM A;  4XXB B;  2XJT A;  5EIO C;  3KYU A;  2KN9 A;  2C6A A;  1QCV A;  4LHN A;  1IU6 A;  2C6B A;  3ZG6 A;  1B71 A;  1S24 A;  3K35 A;  3P2A A;  5DM7 1;  1T9Q A;  3MSU A;  1R0I A;  1ODH A;  1B2J A;  1T9O A;  4AHZ A;  1VZI A;  4RXN A;  3NFP I;  3RZ6 A;  3PWF A;  3SS2 A;  1OWB A;  4POG A;  2B5I D;  2XJV A;  3PKJ A;  2M6P A;  4AI3 A;  4LHL A;  7RXN A;  5GAH c;  5RXN A;  2O5J D;  1S30 A;  1YV1 A;  2ERS A;  4AHW A;  4AR3 A;  5AN9 H;  3WWN B;  2J9U B;  3QQC E;  2XJS A;  1CAA A;  1JYB A;  2PVE A;  1SMU A;  1YK4 A;  1IRN A;  2Z3Q B;  1IW7 D;  2AYJ A;  1DVB A;  3B08 B;  5MFP A;  4AI1 A;  2ZIX A;  1VZG A;  2K2D A;  3PZA A;  4JAE A;  2QL0 A;  4JAG A;  2A6H D;  1LTL A;  1RDG A;  2V0F A;  2M4V A;  1RB9 A;  1R0J A;  3RYG A;  3MPS A;  5JVG 1;  1T9P A;  2Z3R B;  3KYY A;  4U67 1;  1IRO A;  4JAD A;  1BE7 A;  3IU3 I;  1NXG A;  4GS7 D;  1B13 A;  1LKP A;  3WWL A;  1BFY A;  2CR8 A;  1DX8 A;  1FHH A;  4AI0 A;  3RZT A;  3PIO 1;  2PVX A;  1NNQ A;  3QVD A;  4TPU A;  4K9F A;  3KYX A;  4ZN3 B;  2HR5 A;  4WFN 1;  1R0H A;  5DM6 1;  5MFZ A;  3P8B A;  5AI3 A;  2BE5 D;  2XJP A;  1BQ8 A;  1NXE A;  1B2O A;  1OWC A;  2XJR A;  2CKA A;  1R0G A;  2PSM C;  1LKO A;  1R0F A;  4ME3 A;  4AR5 A;  2KKD A;  1RYT A;  5GAE c;  3J7Y 1;  2CKC A;  2PYA A;  2H12 A;  2L0Z A;  3PKI A;  1C09 A;  1RYQ A;  4ZN1 B;  2VL6 A;  5MF6 A;  5JVH 1;  1VZH A;  1RDV A;  2M6O A;  4YWM A;  5IY0 A;  5H1S c;  4JAF A;  3VPB E;  8RXN A;  2XJU A;  4B8C D;  1SMM A;  2A68 D;  2MS3 A;  1IU5 A;  1QYB A;  2V3B B;  2JI1 A;  1CAD A;  4AI2 A;  4POF A;  5GAG c;  2GMG A;  3PIP 1;  4TVM A;  1RWD A;  1WJV A;  2NYD A;  3LPE B;  5AI2 A;  5MLC 3;  2V0E A;  4AR4 A;  2ERJ A;  4AR6 A;  4E6Y A;  4UY8 1;  2A6E D;  1YUZ A;  3B0A B;  4XGH A;  1VCX A;  2XJQ A;  3KYV A;  2LCQ A;  6RXN A;  5MGN A;  4V19 6;  1H7V A;  2PPT A;  4AHX A;  5EIN C;  4YWL A;  1FHM A;  1ZRP A;  4AHY A;  1SMW A;  2M4Y A;  3KYW A;  2RDV A;  2DSX A;  1BQ9 A;  3LNL A;  5GAD c;  1BRF A;  2JI3 A;  1YUX A;  1Z92 B;  1S2Z A;  3J7Z 1;  1YK5 A;  3A44 A;  2JI2 A;  2A69 D;  5K2M E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...