2KKHA

Structure of the zinc binding domain of the atpase hma4
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
95
structure length
95
Chain Sequence
b'ALQNKEEEKKKVKKLQKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALNEARLEANVRVNGETSFKNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative heavy metal transporter
publication title Metal binding affinities of Arabidopsis zinc and copper transporters: selectivities match the relative, but not the absolute, affinities of their amino-terminal domains
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Metal transport
total genus 12
structure length 95
sequence length 95
ec nomenclature ec 3.6.3.3: Cadmium-exporting ATPase.
pdb deposition date 2009-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kkhA01
2ZDPA 2OMOA 3HHLB 3BF4A 3MZIA 1TL5A 3KG0A 1SQEA 1R6YA 3KKFA 4OJ1A 4ZOSA 4U9RA 3CJKB 1K0VA 2K1RA 1Y9OA 1URRA 3HHLD 2ZDOA 2RU9A 2XMKA 5K9FA 3VTIA 2BJEA 2ROPA 4DN9A 1W2IA 1FVQA 2RSQA 4HL9A 1FE0A 5B0DA 1X8DA 4HI1A 1N5QA 1RJJA 2GA7A 2QLWA 3TOQA 4A46A 2PGCA 1GXUA 2HIQA 1LQ9A 1P6TA 1KQKA 3F44A 1XBWA 4OIXA 3QGPA 2ASYA 1MWZA 2PD1A 2QYCA 4Y2IA 2IYGA 2QIFA 1AFJA 1VQSA 1N5VA 4HH1A 3KG1A 3UDCA 2KT3A 5B09A 1YJVA 2BUNA 4HI2A 1QUPA 1YJTA 2OD6A 5B0EA 1YRXA 2N4DA 5T7LA 1P8GA 2AJ1A 3LGMA 4FNIA 3DCAA 3TNVA 2FHMA 1N5TA 2K7JA 1X0PA 2HLUA 3HDSA 3MCSA 3DXSX 2ACYA 5KAKA 3LO3A 3FGVA 3I9ZA 1CPZA 2LQBA 1Q8LA 3IWXA 1CC8A 4Y2KA 1WD6A 3BDEA 5A6PA 1Q8BA 2N7YA 2HFOA 3HHLA 5F0WA 5B08A 4NL5A 1FD8A 1OPZA 2VH7A 4OJGA 2W4PA 1JK9B 2W4DA 2XMUA 2FTRA 3BM7A 3CJKA 1YG0A 3BB5A 2BBEA 4HH0A 5B0GA 4A47A 1AFIA 4Q2MA 1AW0A 4DL0C 1V3ZA 2GV1A 1OQ3A 2GGPB 2CRLA 2RILA 2Q3PA 3KNGA 2ROEA 4YEAA 4A4JA 3FMBA 5B0CA 2XMTA 3IWLA 1TZ0A 2XMJA 1TUVA 2L3MA 1SB6A 2LDIA 5B0BA 2W4CA 1U7LA 1SI9A 2AW0A 1VQYA 2OKQA 2QLXA 3HFKA 5B0FA 4OJ3A 3K7RA 1Q53A 2OP5A 3T9NA 4EFAC 2K2PA 2AJ0A 2OFHX 4Y2MA 4A48A 1CC7A 1APSA 2BYCA 1FE4A 2EW9A 2HLTA 2ROGA 2KT2A 3HHLC 2K1RB 1TR0A 1N5SA 2FB0A 3WDOA 1KVIA 5IXUA 2VV5A 3TRGA 1Y3KA 1IUJA 3GZ7A 2OAUA 1TL4A 1ULRA 4DPOA 2LXFA 2KKHA 2LQ9A 4ZA1A 2GO8A 1YJRA 2HFNA 2N4CA 2XMMA 2JDJA 2XMVA 4Q2LA 1OSDA 1GXTA 1S6UA 1KVJA 1YJUA 1Y3JA 2HQIA 1FEEA 1Y0HA 2IYIA 1JWWA 1MWYA 1FESA 2BJDA 3BGUA 2OFGX 2IFXA 2GCFA 1OQ6A 2GFFA 3BR8A 3HF5A 4YDXA 4QOTA 2FIUA 3E8OA 3BN7A 5T7LB 3QMQA 3LGNA 2KYZA 2GGPA 2K7KA 2AP6A 3HX9A 4FNHA 5B0AA 2OD4A 1Q4RA 1S6OA 1X7VA 3FRYA 4OJHA 5F0UA 1FVSA 2G9OA 5A6WA 4NPOA 2RMLA 4F67A 2XMWA
chains in the Genus database with same CATH superfamily
5C7PA 4KHPF 1GMWD 3N9UC 4NYZA 4P9SA 1NK6A 5ADZA 3TJ8A 2ZE2A 3CIMA 1K0VA 5KG0A 2E7VA 5E33A 3ET6B 5ETVA 3FZ2A 4KTQA 1VLOA 4A8YA 4DX5A 2C3UA 1I51B 4O4RA 1PJ7A 1LWCA 3TZZA 1KLNA 3LGMA 5KFGA 2VA2A 1IWAA 2Z2YB 2IM1A 5DM6Q 2DGTA 4CO2A 3SZ2A 3HFVA 3PYDA 1E6VB 4YEAA 3D0IE 2KDOA 5DG7A 3FFIA 3MM6B 1FKAF 4LFCF 1D9FA 2H65B 2FVSA 3QGHA 2ZH1A 1VQ6S 1ULRA 4JV5F 2HHXA 3MMBB 3BGUA 1UEKA 2EKYA 4ICLB 4NLXA 1E6YB 4CWBA 1JLGB 3C16B 2PEHA 3CEDA 4K0KF 2EC2A 1RJJA 1OMSA 4JI5F 3EGVA 1JLCA 3JSMA 1LWEB 2GO9A 4GKJF 1IWGA 1F9EB 2BUNA 4ZVUB 5D3GB 3DLHA 4PRFA 3DU6A 4WE1A 4P10A 3PYEA 3J7A1 3GG1A 1RADB 2COLA 1LWFA 3GB0A 1F5AA 2Y0SD 3H42A 3AJ2A 3TARA 3M4XA 1G6BA 2XGQA 5CQGA 2ZH5A 2YQ0A 1RAJA 2OEKA 3EWGA 2XI2A 1UWAA 2L48A 3J81Y 1VIOA 1IM6A 3TZXA 4F3MA 4QR0A 1SJFA 3C6UB 3KK1B 4DR1F 5D4OA 4B3TF 2Q6CA 5EWFA 4QOTA 1UWBA 2CQGA 1DAXA 1X4GA 5CXTA 4LF4J 4WFZA 3UCUP 4NCAA 4I2QB 2QEXS 4PKDB 1VQ8S 4CLWA 2ZFHA 5DG9A 2BQ3A 2RQ4A 2ZDOA 4KO0B 4KJIA 3SFUA 3Q2SC 1KQKA 4RW7B 1RT1A 5A8KA 2BKNA 2FC9A 3MURP 1Y5IB 1S0NA 1UFWA 2JX2A 2ZUAA 5C25B 1XTZA 4DSJA 3M2VB 4DZDA 3M6VA 4OYAA 2CQ4A 3C19A 4F0HA 5BJRA 2QFJA 2W7OA 1U25A 3TA2A 1BMQB 1ZPVA 2CA9A 3CC7S 3CC4S 3PEHA 2Z4PA 1B0VA 3O5TB 3UFCX 1NXIA 2DGSA 2FD2A 2R8KA 5KT4A 5I42B 2CVIA 1S79A 1IBCB 1S5ZA 2ZZMA 4A8WA 4F50A 2E66A 2OPQA 2ZNYA 3OW2R 5CABA 2XY5A 4J9QA 4RW8B 2KHCA 4MKYA 3R6LB 3TJ9A 1F9HA 4ZCMA 3W61A 3ZTSA 4QPXA 2VHGA 2XNRA 2Z58B 2D3UA 3MEEA 3CMAS 3HT3A 3NWGA 2OO4A 1HR0F 3IFEA 1VK3A 2M8HA 3KHLA 2CAJA 2ACMA 1TL1B 2R7TA 2HVEA 3IGVA 2AGOA 3M2UA 3IBCB 5E7OB 4I7FB 1U0HB 3WHIA 1YKWA 4YY3F 1VRTA 1X8DA 3NEKA 3BQ1A 2VUGA 2UVUA 2PD1A 1N54B 2IYGA 2VFVA 2F63A 2CZVC 5KT7A 1URNA 1WOSA 4K4UA 1IQTA 1WUUA 1YZ6A 2R9LA 2E5IA 2GW8A 3D6MB 1NSKL 3B78A 4H4OB 4LF8J 2CRLA 3K5NA 2HQCA 2MTLA 3J7AN 3R9LA 3SV4A 3RTVA 3K7RA 2X1AA 2QN6B 4FXVA 3R5JB 2U2FA 1ZM3A 1F9FA 2QMXA 1U09A 4EO6A 4NLUA 4GKKF 2LCWA 4ERDA 2XZDB 3GIRA 2DHGA 1UVLA 2AZ1A 3N0VA 4DOZA 3DLGB 1WJ9A 4RL1A 3N01A 2YVSA 1LW0A 2B9YA 4U6PA 4HYKA 4KFBB 4PEOA 3KHGA 3NS6A 2RDJA 1WC6A 2G1DA 1RAEB 2HZAA 1ACMB 3I0SA 4R8UA 3IBWA 4OYWA 4H4MA 5KFHA 5T7LA 4QBUA 4N8OA 3DXSX 2VASA 4W90B 2YY3A 4NZ6A 2UU9F 2EXUA 2OPRA 3HHLA 1UP1A 1QDUB 3Q83A 1HI1A 3MR6A 1T05B 1B3TA 3AJ1A 1AZSB 2DH7A 3EGNA 3QGIA 2DR5A 4YB5A 3D54A 3HFKA 1RP5A 1N36F 1Y10A 2AJ0A 3M2RB 1HBNA 2FJAB 4ZVTB 4ZP9A 2M4MA 3KOAA 3H20A 1XK8A 1RT2A 3RRKA 1NHVA 2KXFA 1NUEA 3TWZA 2DKOB 4Q44A 4RW4B 1GMUA 3HJVA 3HX9A 4L75A 2VPZB 1B7FA 2KT5A 3MM7A 4Z37A 1WTBA 3KXDA 2VG6A 3J7YI 3MZIA 4B17A 4LFAF 5IC4B 2BJ8A 3KLIB 2VBWA 2C2OB 4KGXB 4M1KA 5D77A 5C42B 2VIHA 1YQHA 4FS2A 2JFKA 3I6PA 3QIDA 2F9JA 2J0WA 3MTKA 4DV0J 2J0XA 1Q1KA 2LA6A 2WOMA 4OI6A 2GMHA 3M8WA 3T41A 5A8RB 4CLTA 5C24A 2W2NP 2GZOA 2FVCA 4BBYA 3MGJA 5HANA 2GGPB 1WORA 3EDRB 4JI1J 4DUZJ 5B0BA 4WU2A 7FDRA 1Q53A 3I9V9 1LW2A 3MECA 1FRJA 3K8VA 4LFBJ 4R5PB 2IM3A 2LQ8A 2FIUA 1RWPB 2BOPA 4J9KA 3OJUA 1FRXA 1CVJA 2RF2A 3DOMA 5J2NA 4N77A 3AY0A 3MEKA 4CO5A 1BQMA 1RA6A 4NLVA 3FDSA 4C7QA 2CJYB 3OV7A 1P9YA 1ZAVA 2E1PA 4KGZB 2BM1A 2DHAA 5RUBA 4M94A 2N4DA 2J6UA 3OR1A 2CWXA 1H74A 4LF7J 3CJQA 5SUHA 2MY7A 4USWA 3DNCA 1NJIT 4OJGA 2FUG9 3RRGA 4IRDA 5KT2A 2P2CB 1YBTA 4TXSA 3NOCA 4TU7A 2F1FA 2JLFA 2ZH3A 2PE8A 4I64A 2HAFA 1AT1B 3NBPA 2ZWPA 2CYYA 4C3KA 5ETNA 2YTCA 2XS5A 5BYQA 2QA2A 3ZO7A 4DL7A 3H40A 3HZEA 1HNVA 5IT0A 4FYXB 2IC3A 1HFEL 4WZQA 2MHNA 4F67A 1GX5A 4WTYA 1YK9A 1XR7A 3MM5B 4F04B 1DTQA 4LSLB 4M5DB 2K1RA 3VGSA 1MN9A 3PFOA 1YRTA 2MEWA 3S6EA 2AYBA 4DX7A 2EK6A 1KLMB 2YKPA 5HP1B 4EK2A 2EVZA 2MSSA 4TYBA 4KBIA 1N6QA 1S6PA 1W2BR 4QWEA 1UKUA 1EX8A 2MQQA 3TYTA 1I94F 1D3WA 2W9BB 2NYHA 1X4DA 4DR5F 2IAJB 3DRSA 2QE5A 4N47A 5CCLA 4KHMA 3F56A 5E3QA 4QWAA 5A2QU 1NPPA 5H9EJ 2HZCA 1VR6A 3JAMY 3AA8A 1KEKA 1RKIA 2KJWA 2KZMA 2ZD1A 3A8IA 2R2UA 5T41A 1YVFA 4CDIA 4K2XA 1GQEA 4UOCA 1NK4A 3NG8A 1FVSA 1NK9A 1HW9A 3IBFB 2LU2A 4OYMA 3H98A 4HR2A 3LW5C 2D3O1 3HHLD 4JI6F 5F3TA 3JSBA 2Z2MA 2VKZG 1HBOA 3GYXB 1WC1A 1CJTB 4CO4A 2RIJA 3UE2A 5LOQA 4QJVA 1NSQA 4YB6A 4PXCA 3CJKA 2I0XA 5KFJA 5MAOA 3H59A 4PQAA 3U7JA 3MR5A 4X62J 2L3MA 2DTJA 1YDLA 4QIGA 4KRWA 3I5AA 4PUOB 1LEOA 2MLZA 2O1PA 3CSKA 5JVGQ 5DG8A 4DLEA 1N0VC 4OZ3A 1IQZA 1S6OA 2P9CA 4MH8A 1NM2A 4O44A 1NB2A 4HTJA 3ILLA 4Y2CA 1Y11A 2VBXA 4ETZA 3M8ZA 3HXMA 3HSZA 2B6AB 4G1PA 3M8QA 4LR8A 4AE5A 2UUAJ 3PY8A 3IM9A 3VGVA 2JEJA 1YJVA 4LBIA 3NKYA 3X3UA 3JYTB 4WP9A 5KG4A 4ANCA 2AQ4A 2X7IA 2WVDA 2MQPA 1M1KT 2XMUA 1S76D 2BKPA 2PFDA 8RUCA 4DV2F 2RILA 2GNKA 3IS9A 1Y00A 2KG1A 1S1VA 3BR9A 1KTQA 2GVZA 1QVGR 3T5JA 2AU0A 2K2PA 3OR2A 2ADCA 1KWMA 3DOKB 4OYIA 3BPDA 3CCMS 4WXOA 3JTNA 4FF3A 3DRPA 2RE1A 2N4CA 5GAGI 3W5XA 2BVZA 4TYAA 1R0AA 4GVBA 4M5JA 2K8GA 1BQNB 4ZPTR 1HI8A 5C5JA 3CDAA 5K8PA 2VQEF 3EM1A 3KJNB 1FCAA 2UXCJ 2C2KB 2EFGA 3AHPA 3KKFA 3V6KA 2V2VA 4KIAA 1ZM4A 2ZH4A 1BUXA 5F8MA 5FD1A 1QSLA 1RGVA 1DLOA 3S7RA 1ZAWA 3GYGA 5BR8F 1S9GA 1REVB 2ZM6J 1FKOB 3L3CA 5LSOA 2JH3A 2YNHA 2YKQA 2LU1A 1NB7A 5HBMA 4ZVHA 5GAEI 2VA3A 5EX3A 1TKZB 1VIXA 5H9EK 5E3RA 2XZTB 3H2UB 1TZ0A 4MK9A 3J81j 2KFZA 2R42A 4TVAB 4LF9J 3CD6S 5FIIA 4K4YA 2YNGA 1REGX 4ZN1A 3N6LA 4AQYJ 3IP0A 3ULHA 3RZAA 3TR5A 3FK4A 2J9DA 1L3UA 1U47A 5LXRA 2LFVA 4XDCA 2AGPA 4KB7A 3G6ES 2GIFA 2V67A 3PJ9A 5ETLA 4U8VA 1RTHB 4B3RF 1FD2A 1S1TA 3DRXA 3RUBL 2FLOA 4YHHF 2YWFA 3HSJA 1FWLA 4PG8A 3G71S 2VG5A 5K20B 1XMOF 3PJWA 4Y2IA 1TMJA 5HI7A 3RB0A 4IG3B 4WU3A 1HQEB 3AXMA 3NMAA 5D6GA 4LVNP 4F02A 3TJAA 2J5AA 4YB1P 2F7VA 3LUYA 1X5TA 4ELVA 1IR0A 1GEHA 2R8GA 2BJ1A 2E5LJ 5HVFA 2PI4A 1M5HA 2LMIA 4Z7CA 3BBFA 3A3PB 5U47A 3IA0A 5KFYA 3B54A 1Z2LA 2AEJA 3QLHB 3Q8PB 3BGRB 2AYMA 3IM8A 1QUVA 3U1LA 3HJFA 2WSFC 3BN7A 2ZH9A 4GC7A 3BS9A 3JSRA 5J1NA 1S1WA 5DQGA 5AJ3F 3EXCX 2XLIA 4OFZA 2OJ3A 2R7QA 4IDKB 1S1XB 1GXUA 2OGUA 3IN5A 4GKJJ 4EBDA 4C3MA 4KV8B 1EAYC 1ZOTA 5K8MA 3DHWC 3KLFA 2WB1D 3PIPQ 3UCZP 4QYZJ 3IG1A 3Q8UA 1JMTA 4Q2MA 2YWKA 1FXLA 1FJEB 1G4CA 1JKHA 4ED5A 4B9MA 4FN5A 3OUYB 4J9SA 3WBZA 1SI9A 1SV5A 3W8GA 4WCEQ 4IH5A 3RB4A 1MU2A 4JYAJ 1PBAA 5A76A 2IRXA 2O67A 4C48A 4B3TJ 2KJVA 1OSDA 3UR0A 1UFLA 4WKYA 3DM2A 1U45A 3HF5A 4I56A 4KAIA 1VBKA 1Q4RA 4DV1F 4CTAB 2D1CA 5L39A 2PFFB 1T8EA 2YKNA 3BF4A 4B9TA 4ZOSA 1CQMA 1C1BB 1RAAB 2RKIA 2DGVA 5LJ3Y 2U1AA 2FDNA 4NCGB 4DSLA 2OH2A 2G2YA 3VAHA 1HMVA 4Q0BA 4LIWA 3KLHB 3WIUA 3OTOJ 2M88A 3UD4P 2W7AA 5B08A 2XM3A 4EBEA 2XO6A 4OYOA 3BM7A 4LUBA 1B7YB 1QJHA 3DI6B 2OIHA 2FYXA 3TX8A 5J1EA 2BMBA 2ATCB 1JLBB 3MR7A 1QVFR 2LQ5A 3M32A 4M5HA 4J9NA 2YXLA 4UTGA 3A1YG 1MNEA 3HKZD 1F2GA 3SSSA 4G1QB 2AGQA 3R2CJ 5HL7Q 1VJQA 1WACA 2J6SA 3HVTA 1HR0J 3EDQB 2FLNA 3BBBA 4A8OA 1IKWB 1WF0A 4JI8F 2P9GA 2P8IA 4XAKA 4J91A 4TU8A 1FK9B 2QL9B 3O1LA 4YY3J 3KLEA 4FKXA 1X5PA 1P1LA 2MPUA 1YRUA 2ABYA 1A0OB 3V6DB 2OPSB 1OYDA 2KG0A 1WSVA 5I3QA 2MZ1A 2CPDA 4FF1A 2MQOA 1I6JA 3DKDA 2J9DE 1K44A 1U6FA 4ELTA 3BKUA 4PAAA 4NEYA 3GP9A 5C2GA 4B3SJ 2ZOFA 3OPKA 4NXMF 3GJTB 2CQIA 1RYSA 4DL0C 4OHVA 3CCVS 4QQBA 3AJDA 2ROEA 2I38A 2KFYA 4FYWB 3OL8A 1U7LA 1EETB 4P73A 3CCTA 4C6AA 4ZKAA 4BDPA 1QAIA 1MSWD 4AXJA 1HA1A 3PTWA 4UZBA 1HWKA 4X65F 2YX4A 5IQQA 3KUEA 3S8SA 3E8OA 1HWJA 3RBEA 1X5OA 1SUQA 1X7VA 5J2PB 1HIYA 4OMFG 2G9OA 3A13A 7AT1B 2IJRA 3BDPA 5F3ZA 5DLFA 1V3RA 2VFTA 4WFNQ 3MPUB 1N33F 4JI2F 3TAQA 1S97A 1HYSA 5KG5A 3TX0A 2GA7A 5E3CA 4QYZK 4IFVA 2R2SA 2MKIA 3C46A 2BJ9A 4NE9C 1AFJA 3KG1A 5B09A 3OXGA 2HGMA 3ENVA 3TNVA 2RS8A 3PHEA 4NYOA 4DBQA 2LQBA 3QYYA 5DS7A 3F41A 4NL5A 3KJFB 3CCSS 1G1XA 2AWZA 2E5HA 3PW0A 1UJ5A 2XQCA 3C3LA 4NXNF 4DSKA 1RWUA 2PC6A 3RRHA 4PWDA 1NSAA 1FKPB 1RTJB 1HNIB 2Z0GA 2VPXB 3HHLC 1RXOB 1T7PA 1CS4A 3PZPA 4UOGA 4USHA 1FNOA 5AT1B 1UCNA 1NRKA 3RJMB 1RT7A 4RX6A 2DEIA 3QAEA 3DOLA 4FXWA 1VOMA 4U67Q 4B3OA 1FJCA 2BW2A 1C0UB 1EARA 2AEFA 3BSCA 3TAPA 2JSXA 1VYAA 4DV5F 4RW9B 1KQFB 5KTQA 2RQMA 4CH1A 4IOCQ 3Q24A 3CJ4A 2WVBA 3LO3A 3VVTA 1NHUA 2OSRA 1KONA 3GJRB 5KFXA 3NY0A 2UV8G 5KFAA 3ZTRA 2Q43A 4NLWA 2FZKB 1CBKA 3R7SB 3FC9A 1RBAA 2WZ1A 2Y0BB 2MKKA 4BHQA 4B02A 3I4HX 4C0OC 1NDPA 1DTTB 1FFWB 4RR5A 3EE3A 3LPEA 4LT6A 3KTQA 3MMJA 1RWVB 2MGZB 3FJ2A 3RG6A 3VGTA 1SJ1A 4PG7A 1S6UA 4URSA 2NLWA 5FDLB 5EGYA 4MMOA 2B51A 2LEPA 3I31A 1TKXB 5F0UA 2EPIA 2BRKA 1D8YA 4NCBA 1TL5A 2WK4A 1YZ7A 3KDOA 3KG4A 3LP2B 3P96A 2HVIA 4LF6J 1JXVA 4WIIA 3UDLA 1YSJA 5HVHA 2IBOA 1SJ3P 3G96A 2UVWA 1EB0A 4OX8A 2H51B 3CUNA 2QL7B 2QLBB 1T02A 5L1LA 2A6OA 1HQUA 2UUWA 4OI4A 5D4NA 5DDOC 4GVLA 2C2DA 2BBEA 2H9ZA 1VQMS 1TELA 3PRVA 3QWUA 2OLWA 2XTJP 4DQIA 2CPXA 2QLXA 2FHKA 4ECWA 4ECXA 1NBEB 4LSNB 1TAQA 2WVFA 3BSOA 3ZZ0A 2ZE2B 3GFXA 5GADI 2K06A 2KXNB 4HVZA 2C2ZB 1R8CA 3PO5A 1R8HA 3J80Y 2OHDA 4ZA1A 4LF4F 2OTLS 1U02A 1LWCB 4NLSA 5EWGA 4QWDA 4OX6A 4QIVA 2HZVA 1RAFB 4LBHA 5F41A 4Q8EA 1WC0A 1PKUA 1Z1ZA 2MLYA 1S4FA 3QT6A 2I6WA 4UF4A 3GU0A 4FYVB 3K89A 3MEDA 3KHHA 3NCQA 2ASYA 2RB7A 3NLCA 3AQOA 2B7CB 3OTBA 4KR0B 4M5GA 1Q8LA 2VC1A 5J2QA 3RR8A 4RKUC 1SKSA 1IXKA 1U24A 1I94J 1VRQC 4RWXA 1YG0A 2OTJS 4EI2A 3T3FA 1YLXA 4DR5J 3IR5B 3AQPA 1MMLA 5AXLA 4O4GA 2KL8A 2DR7A 5AE2A 2X3DA 1CEZA 3CNQP 2E1CA 1SIWB 3G8QA 3G6VA 4ZP7A 3W5ZA 5LSLA 2HAIA 3NAIA 4ED2A 2UUBF 5HK4A 5CHCB 4FNHA 2VC0A 1S6QA 4F4AA 3W60A 3D1OA 1S0VA 1N52B 2HS3A 3FEYB 1LWFB 2P9EA 1R6YA 1WG5A 4JI7J 2QA4G 2CPJA 1NK0A 2IPOB 5CYQA 3AD8C 2I8EA 1UEUA 2HMIA 2BZ2A 5DDQC 1KD1T 5CH7B 4LF8F 1U0SA 2HW3A 2BM0A 4ZIWA 1X60A 4ED8A 5HAOA 4DU8A 3R6GB 1XN9A 3PEJA 2R8IA 1ZAXA 5KFOA 3ONQA 1G7CB 1TVRB 1NKEA 3MI7X 1K47A 4IQMA 1UWBB 3O8WA 2RS2A 1QAJA 1JQGA 3PNIA 5EN1A 3LALA 1FDDA 4F25A 2HQFA 4RNNA 2HEKA 1WHXA 2E7WA 3ETOA 2V4QA 1NDLA 2DXDA 4OLOA 4RPFA 1RT3A 1AUSL 4F4KA 2KTQA 2IVMA 4AFFA 4OHXA 2UV8A 1RT1B 4CH0S 5A8KB 4WK3A 1CSJA 1FXRA 3EX7B 1HNZJ 3QMQA 4I6AA 3D0HE 2W1BA 3DLLQ 2YH1A 3I32A 2XMWA 1FRHA 2HS0A 3QRPA 4DPWA 4KHRA 4JP8A 3J7Z5 4L72B 4DFPA 3QRRA 1QTNB 3MM6A 4ES2A 3BGLA 1C0TB 2K7JA 2DH9A 3QFHA 4F0KA 2OPQB 3EZ5A 2NUHA 1KTVA 1HKAA 2WBRA 3KK3B 4DV2J 3ZZUA 2HVHA 4C8ZA 3UVJA 2AZ3A 3MEEB 2J7KA 4ICLA 2Z2LA 2CZ9A 1C1CA 5LL6d 2EK1A 5EHHA 2W9AA 4UY8T 1LOUA 1VK8A 1JLGA 1JJ4A 2HBRB 3HI9A 3M2UB 1VRTB 2FJDB 5ETKA 2QT7A 3I5CA 2M0GB 1F5BA 1LWEA 2GC8A 4IKAA 2R7UA 1NNDA 1GXLA 4PZVA 1YBUA 4WFXA 3FCVA 4KQZA 3FSYA 4DV0F 1J5OB 2QLWA 4QYRA 4IFYA 2KRRA 4CNYA 3T9ZA 3GFHA 1VJWA 3CJ3A 5BR8J 4BS2A 3OHBA 4JI1F 4DUZF 1VI7A 3C6UA 4KH1B 2D9OA 2QZ8A 3W62A 4C2MA 1ROFA 5AXNA 2ZBQA 2HNDB 2HFUA 2XS7A 3DHXA 2IDEA 1F2HA 4LFBF 1D1UA 4DR3J 1T9WA 2AW0A 2E1AA 1H98A 5I3UA 2V9KA 2I5JB 5HMWA 3KJQB 5A0YA 1RHUB 5E2QA 2D3ZA 3MCMA 1RLCL 4DG1B 3MTJA 3HHEA 4I2QA 4MIWA 3I0SB 3ZC4A 3FSXA 4X4TA 2CG4A 3CCLS 1HPZB 2CPZA 3G4SS 4H4MB 2ASJA 4RW7A 1KFSA 1SKUB 4ZHRB 5T7LB 2E29A 3HCXA 3DLKA 2JL9A 2CZ4A 3ISND 2ATLA 2WAQD 2WONB 4B3RJ 3R5GA 2H5IB 2OPRB 3HHLB 3UW1A 3MOJB 3UD5A 4N8NA 1XC9A 4LF7F 1S7HA 1RTIA 3JQMA 3BREA 1V5IB 3W5YA 4QIEA 1V6HA 3NOGA 5F8HA 2NPFA 1Q5YA 2H48B 3J81U 5I42A 2ZKTA 2SXLA 2QV6A 2YX7A 3D6HB 1HBNB 4DV6F 1I5OB 4OZ0A 3IRXB 1RT2B 1Y4ZB 1W25A 1TKTA 1Q95G 2MB0B 3VAFA 4OZNA 2M9KA 1PJ5A 2C2RA 2CPFA 3MM7B 3RAMA 4RNOA 5J2MA 2X1BA 2R2TA 4HT7A 3Q8RB 3M8RA 1PJ6A 3MMCA 3BO3A 3C8YA 3JQKA 1CJUA 3Q2TC 2V5HG 2Q6BA 4HLBA 1DJ0A 2H5JB 1JXLA 3MPYA 4P2MA 5AJ3J 4FBUA 2WOMB 4ZVRB 4LQ3A 1VISA 2ZUGA 2OI2A 3CJ5A 3KK2B 4I68A 3P45B 5C24B 2R7VA 3TZYA 3TEGA 1AB8A 3WX4A 4H4OA 4F2SA 2JZ5A 1UPMB 4DQQA 3V5RA 1LQ9A 4K4WA 4ED1A 3K57A 4AUKA 1RUSA 3OSPA 1LW2B 4HDHA 5HVGA 2FC8A 5BXIA 2UXDF 2WW4A 1LXJA 4HH0A 3CJ2A 2E9RX 3MHYA 4K4VA 2HBZB 4KGKA 2H54B 2HHSA 3MWBA 1X9WA 3DOMB 3US5A 1SB6A 1N56A 4ZPVR 2VOPA 3RB6A 3CC2S 4KFBA 9RUBA 3Q8YA 2IRYA 2MQMA 5K8NA 4ATNA 3FEXB 5IC6B 4QWBA 1ZM9A 2RHSB 1YJRA 1BWEA 3T5LA 2FPHX 2JFDA 1NJWA 3QFWA 5GMKa 4DV1J 3OR1B 3QJPA 2DPJA 4XTTA 2E44A 2KYXA 2VF3A 3CWJA 3PR4A 4X2BA 2LYVA 4RUHA 4NLRA 4F8RA 1J27A 2G4BA 2DNLA 4HL9A 4Z7YA 4A46A 4DSIA 3BH6B 2F4VF 3PACA 5KFFA 3E3XA 1T95A 3NBPB 2FQQB 5JJBA 1UL3A 3H2VE 2AJ1A 1H73A 3M2RA 4LRBA 4WZMA 3K5PA 2FHOB 4CT8A 2ILYA 2YNIB 3E2EA 4EMDA 3ILJA 2IMWP 4DV7F 4ETXA 5GAHI 4PG4A 3MFIA 4J9UE 4U96A 3K8WA 2KVQE 4S0MA 1HNVB 1RT4B 1U8WA 1IN0A 4K59A 4WTOB 1YWXA 3NS7B 2IC3B 3AOCA 1WC3A 5M2RA 2ZVSA 4ZCKA 2EC0A 4QR2A 1HNXJ 1WHVA 4ZIVA 3DYAA 1DTQB 4ZJLA 3KLIA 1XR5A 2K1RB 1RU1A 2CQ3A 4AYBD 2V50A 2M2BA 1VQLS 4C4WA 4NOHA 4JV1A 2J0SD 3CGIA 2CJXB 3D0GE 2V8GA 1T3OA 4YDDB 4IH6A 1FRKA 2EFQA 2ZJQQ 2J0QD 1KHWA 2UUAF 4R0JA 4OHYA 4YUDA 1N6QB 1S6PB 3GJSB 1WTFA 4CLUA 2GS8A 1OYEA 5EDWA 3DRSB 3F44A 5A8WA 1RCOB 4P52A 3MPVA 1VQSA 1IBMF 2PMZD 2FHMA 3R2DJ 3MCSA 3M7VA 4HHJA 1UVMA 1KVKA 2H5EA 4FBTA 1M1GA 2POKA 3TAMA 4R5PA 3IR7B 1QSSA 3FKBA 3JS9A 2ZD1B 3KNAA 2GV1A 2HGLA 4RO0A 4ENOA 3IWLA 1RE1B 3PYFA 1H38A 4J9MA 1VQPS 4CO0A 3VQTA 2DXEA 1NJXA 2W24A 2WVEA 2LXUA 3WDOA 1KVIA 4F4ZA 4X4QA 1V3SA 1HBOB 1WELA 3H2LA 4AL5A 2H4WB 3PW2A 5IFMA 1O6XA 3DDIA 2IDLA 4B3MJ 1C4AA 1RTDA 3GWCA 4DL6A 1N33J 1H7WA 2E5GA 3CJKB 4W98A 1NK8A 1WWHA 4ZVQB 1URRA 2ZM6F 4IRCA 2ROPA 4NMXA 4WYLA 4JI3J 3RR7A 4OHWA 2M70A 1S10A 4LBPA 3ZZPA 1A6LA 1AYEA 5IT9U 2F9DA 3CO9A 5HMXA 1QTMA 1S1UA 2KZZA 2B9EA 2Z56B 3L09A 5LMNF 3CF5Q 4LF9F 5DDRC 2AKWB 2G0JA 1KR4A 4X4PA 4AQYF 3V4IA 1RCXB 2OSQA 3RBXA 4ZMMA 3PYGA 4LRFA 2VPWB 3BO4A 4O44B 1K9MT 1U2RA 3M6XA 2P6TA 1N4LA 2CQCA 1BWVA 3N6NA 2DNRA 1S7IA 4D3GA 2G0IA 2E1MC 3AXKA 1A7GE 4URGA 2BV3A 1Y3JA 1Q79A 5KT5A 2C3PA 2V0NA 4RW6B 3V2UC 1L3KA 2A2CA 1UMJA 1KLMA 4K4ZA 5HP1A 4X4UA 4ZP6A 1MMDA 3OBIA 2M3DA 2QA1A 1VS3A 2CVEA 3VTIA 4DV5J 2W9BA 2MHEA 1QD1A 3MR2A 2IAJA 5KFUA 1BHNA 2GVZB 2B4PA 3X1LB 2OD6A 1YRXA 4FNIA 1FI4A 1JLQB 4JI4F 1S0OA 3IWXA 2E5LF 3QO9A 3UPFA 3PX4A 1A9NB 4CT9A 4GVBB 1X31C 3OFGA 3SBMA 3BQ2A 2MJNA 4J7CA 4AD6A 3EICA 1KS2A 1FWKA 1VC6A 1WC4A 1XMBA 3BKTA 3K59A 1WHWA 4WYWA 2I1RA 3W3SA 1EIYB 1TV6B 1U49A 1UA1A 2VG7A 2MZJA 4ZVPB 2A2DA 4MTPA 3HZGA 2KHDA 4H4KA 4J9RA 1JWWA 4NLTA 3KLGA 4ZCIA 3VVUA 4L6V3 1CJTA 1U2CA 2VQFJ 1S9GB 1EP4A 2DGXA 2VJVA 5HBMB 4B9SA 4ED3A 3C2PA 1H3DA 1TFYA 2YQ1A 2W2MP 1X5SA 3DGPA 2QA4S 4AL7A 3LP0A 4O3NA 2XSFA 3GV7B 1F60B 2K3KA 4NZ7A 1Q16B 3AODA 1VBYA 4PUOA 3UR3C 2JC1A 4ZLNA 2YNGB 3I9ZA 3ITHB 1OY9A 3TZWA 2CNOB 1VQKS 4JYAF 3H5SA 4NMLA 4DLGA 1VQ7S 2XMTA 3GMGA 4O0IA 1RZMA 4DR4J 3NRBA 4ILRA 2OELA 1S1TB 4C98A 5L1IA 3MEGB 1C2PA 1FO1A 2RU3A 3SQOP 2EBEA 4ZLPA 4G65A 3SYZA 4DX8H 1VQ9S 2FJWA 2XS2A 2MKCA 2YPYA 2YWGA 4JB8B 4M95A 4KKOA 3MAQA 2OPPA 1JJ2R 2YKOA 2VJUA 3C6TB 1UVJA 3U02A 5KOWA 3MXHP 3OTOF 2XO7A 2AYEA 1Y5NB 3CE8A 2HBYB 3NAHA 2HNYA 3MCOA 1B0PA 1DZ5A 2XYHB 3U1NA 3K5LA 3J7YU 1SPBP 2V9WA 4U7CA 2NPIA 4NI2A 2VPYB 4AT1B 3K2YA 1RYRA 5K8OA 4X4RA 3CT9A 1RHQB 2DBBA 2QLJB 3UN2A 1RTZA 3ISNC 4ED0A 1S1WB 3T1YJ 3PW7A 1B70B 2N3OA 3U27A 4PXDA 3UDVA 1NMEB 4C0HA 3MR3A 3I87A 1S77D 4QIWD 2UUBJ 2BJDA 1KSPA 3R1HA 2B56A 2OEJA 4ZLJA 2FGOA 4ECRA 1FKOA 2CNKB 2YQ3A 2CDRB 3BGOP 4USMA 1SC1B 2N82B 2VD3A 3IG1B 1RAHB 1VC5A 2F3JA 4EYHB 2XGPA 4RU9A 1N88A 3P4UB 2D9PA 4B3SF 2DR9A 3E01B 1P1TA 1R89A 1MU2B 2QMUB 4W4MA 1YITS 3R5DA 3IC1A 3DM2B 4LMZA 1AFIA 1IBLF 3LF0A 5K14B 4O3RA 1UVIA 1RWNB 1IJEB 5EUHA 4IG0B 1VQNS 4WFBQ 1GTEA 5KFIA 4BWJA 1RA7A 4C11A 4K4SA 1UA0A 2RKIB 5D4LA 1VDHA 3NL0A 4ZLLA 1CULB 3CPWR 1F1BB 3CJRA 1H0HB 4OLPA 3H8YA 2VDHA 3BR8A 1N5YB 2IFXA 3PG9A 3VZIA 5DRKA 3FMWA 2CNNB 2WVCA 4IG3A 1HQEA 1U26A 3SSRA 2OMOA 4G6VB 3ENQA 3KG0A 3HM9A 1Q8KA 1SQEA 2MKJA 4C8LA 5KFCA 2FLLA 1BQXA 1Q8IA 2DNNA 3HHKA 5ETRA 5E3AA 1P6TA 2X51A 3OLAA 2NXNA 3H25A 2YH0A 1ZTWA 4E98A 2XYGB 3T1HJ 4NLQA 3MM8A 3CTRA 2DHSA 5FJ4A 3RU0A 3L7UA 5KG1A 5D4PA 3LH2S 2H4YB 3A8JA 2FTRA 2E9ZA 1O5JA 4TY9A 2L41A 2QRRA 3SDEB 2D3OR 2J76E 3OXFA 5HROB 2Y8YA 3EJMA 1ZZNA 2XMJA 2IJNA 2NZCA 5M2PA 4WXWA 1N32J 1RKJA 5KG2A 4YQWA 2GVDA 2KXHA 1TR0A 3KLEB 3SIPB 2A0FB 5C2CA 5HJYA 2LVWA 3FZBA 2Q1LA 2HKEA 3W9JA 2LECA 2W8LA 3LGNA 4KV8A 4YOEA 3MFHA 4A8KA 3ZNJ1 3P3DA 3DGVA 4QIFA 2BW7A 1LFPA 3F0NA 1HD0A 3D68A 3OL7A 1F0XA 2MKHA 3TI0A 1QLNA 4P7TA 1WNEA 4LIRA 1DQAA 4WP3A 5M2UA 3OUYA 1NSPA 4EO8A 2FJVA 3L4BC 4LSZB 1U4BA 2VODA 2HWHA 1MROB 2HQDA 1W26A 2V6AA 3PRBA 3GQCA 1Q7YT 2XG8A 3K5MA 4CO3A 4DSEA 3W9HA 1JLAA 3KWMA 2CPIA 4P72A 2WB4A 4CTAA 2VU5A 1QAYA 4J9VA 4IYQA 2HLTA 1NJYA 3DRRB 2DYAA 2E9TA 4OZJA 1U1PA 4NZ0A 5G0RA 3ZTQA 3N79A 1S4EA 3A8KA 2UUTA 4LF6F 4DFKA 3KLHA 4I67A 5EWEA 2HWIA 4MJKA 3W2VA 1LK5A 3SCKE 5JUMA 2ZBRA 5D78A 3LGHA 3O2IA 4OI1A 3IO1A 2R7XA 4PWDB 1T9VA 4DEZA 3A4TA 4DCPB 4RUBA 2XCAA 2V4JA 1T11A 4DV6J 1CS4B 2W2OP 2GIRA 2FY8A 2C22A 3O3LA 1RT7B 1IKWA 2RD5C 5B0FA 1HD1A 1S57A 1Q81T 2K3IA 2OUGA 2ZJRQ 3G8SA 1I1GA 1QSYA 2KT2A 3BSNA 4B3OB 1UPPA 2J9CA 5IM0B 4LVOP 2V63A 5I4MA 1FA0A 3ISZA 2H1YA 2OPSA 1HBUB 4DFJA 4AXIA 4TQSA 4DN0A 2VONA 4TKTA 3GR1A 4C8OA 4MIBA 4OJ1A 4ECQA 4WPAA 4ECUA 1SXLA 2WHOA 5GAGU 4L3NA 5D0HA 1AA1B 2HFSA 3RGIA 3IGNA 1HNWF 5H9FJ 2JJ4D 2UXDJ 3SCJE 4ZS6A 3HK2A 2B9XA 4HDGA 4OZ2A 4MKVA 4Y65A 3ADAC 1U1LA 3LTOA 2BA9A 1XNQJ 2ZH7A 3GIJA 1L3SA 1UW9A 2BQUA 2MQLA 3CJ8A 3C15A 2CPEA 3S01A 1EQMA 3P8BB 2DO0A 1ZPWX 4DV3J 1APSA 2DT9A 2AMCB 2G1HA 5J1PA 1V5VA 1XR6A 2AF6A 5GAEU 1G2EA 3FCHA 3W2WA 4B9NA 4NASA 5HQ8A 3WQPA 2QTWA 3I0RB 4JI7F 2K7KA 2HQ3A 1RT6B 1NZ8A 3FRYA 2Q79A 8AT1B 2DRBA 3CB4A 4CYUA 1JXEA 4GC6A 1HQUB 1O51A 1RABB 1MWQA 4J5OA 4ZN3A 2CIMA 2PN6A 4K50A 2PEBA 3BV8A 2F4VJ 5L38A 1WG4A 3UI3A 3AD7C 4ALZA 1MWZA 4IR1A 2AEMA 4CLZA 2CPYA 5KFNA 4CO1A 2XBPA 5DO2A 1RTJA 4C97A 2F4FA 4DV7J 2FHJA 3L95X 4EUVA 3VAKA 2N7YA 4NRTA 3EMTA 4V1Ak 1SL1A 1RLDA 4ITSA 1D9DA 4FZVA 2W4CA 4Q45A 1SH3A 5HATA 1YTYA 5LXYA 4OJ3A 1QE1B 1SIZA 4QCLA 4Q7AA 1HNZF 4MFBA 2RRNA 3GLJA 4JI0J 2W9CA 2ROGA 2W2PP 2C42A 2F8HA 4NA1A 2RH3A 2FLPA 2OAUA 5D0EA 1ZH5A 3A3OB 2XSJA 4F3OA 1S12A 2HFNA 3MEDB 3VQSA 1Q82T 4DPUA 1NEEA 2ZC4A 3LPYA 2CUYA 4PQUB 5F9NA 1OQ6A 3H5XA 1PBUA 4RW9A 1J5EJ 2QGFB 4ECSA 2CXEA 3IAM9 5KFZA 2IBKA 3T5KA 4U95A 2M52A 1FNXH 2MXYA 3CD0A 4I6WA 2JHEA 3QT7A 2N7CA 1IBMJ 5EX0A 1DTTA 3FQLA 3SMZA 4NA2A 1PGZA 2YX1A 2MGZA 1FJ7A 2Z30B 4EU0A 1HHQA 2LQJA 3N5BA 1VCTA 2B43A 4OX9F 2BE2A 3ILIA 2QSFA 5FLXY 3MM9A 3M6UA 3M9NB 3DDKA 1T03B 1PC5A 3TP2A 2RJZA 3BEGB 1TFWA 4KY3A 3TRGA 1Y3KA 4EBCA 2ZBPA 1K1QA 4P2XA 1UJ6A 3L9ZA 3UN5A 4ANEA 1ZM2A 2NQPA 1DRZA 3SQGB 2JRSA 4DR6J 3R7BB 5H9FK 1MLAA 4DXLA 3FSIA 2ZZTA 2CJAA 4A8FA 4J37A 3R3TA 1B64A 3D2WA 4K2JA 2BRLA 5KFTA 4LSNA 2ZH8A 2R7OA 4DR3F 1RT3B 1PYOB 1KOOA 5LMNJ 3Q8QB 2RAQA 1JB0C 2W4PA 5E41A 2NS1B 2HK3A 5I3PA 1M1HA 1OWXA 3PV8A 1T3NA 3H5YA 5IWAJ 1U8SA 3TEHB 4CQ1A 1RHJB 1HHSA 2ZHBA 3RB3A 3VF0B 1TQLA 2IMOA 2OP5A 4ECZA 4C8NA 3NNAA 2JLEA 3UD3P 2RRBA 1LWXA 2X1GA 2FB0A 5THWA 1N0UA 1DHMA 1EJ7L 4KH0B 4GRSA 3D4JA 4RZRA 2P5VA 1FX4A 3SEOA 2VFRA 2OD4A 2D69A 5HLFA 4FP9A 2DJWA 4W92B 1H2VZ 3FVYA 1S0MA 3HVRA 2B5JA 3D67A 4UQGA 2QMWA 5KT6A 3UVJB 2V94A 2ZKUA 1HBMB 1KNZA 1C1CB 2EFOA 4HI2A 4F7VA 3Q89A 1SCJB 4JI4J 1N5TA 4Y00A 1CPZA 3J80U 1Q8BA 5F0WA 4LREA 4ZPCA 1IBKJ 1PYTA 2CQ0A 3MUMP 3H5UA 4RBVA 4QU7A 4NLYA 3G82B 3W1YC 1SKRA 2YKMA 5B7WA 2V8PA 2L9WA 3MDFA 3CDUA 4B08A 2PMWA 3T5HA 4V19J 3DMJA 5CAAA 2DNGA 2JLGA 2KKHA 2MYFA 2XMVA 1WF2A 4IFYB 3GTYX 3ZFVA 4IRKA 2AT1B 1JNZB 5AXMA 4A8MP 1C4CA 3IXQA 2YNFB 5E5NA 2B9WA 3EVWA 1T94A 3CD5A 2BANA 3SFGA 4KC5A 3PR5B 2XB2D 2FHJD 4LQ9A 1TVRA 2AX1A 1JLFA 4H4KC 1R7IA 2BKOA 4LF1A 2AIRB 3TOQA 2QIFA 5I3UB 2LDYA 2DO4A 3HD2A 5A0YB 2V68A 5DM7Q 3HPOA 4Y0FA 1LV5A 6AT1B 2GQQA 3KJVA 4YN3B 3L7OA 4F36A 1Q86T 4DQRA 5B0GA 2EFPA 3VAIA 1S9EB 3DLKB 3OQ2A 4Y6IA 4JV2A 4MAKA 2HHTA 3KUHA 4ZDNA 4NLOA 3HD1A 3UWTA 3W9IA 3GILA 2NZ4A 5LSRA 3PIOQ 3B82A 3QWPA 2HHQA 1RTIB 2V2KA 3TO8A 1XNRJ 2KFNA 5AXKA 1IKVA 3MAHA 4HACA 2HHVA 1C0TA 5E3PA 2YWHA 4R0EA 3T6JA 2Y9HA 3B4MA 3H0PA 1RK8A 4YR3A 1NKBA 4RUCA 1TKTB 4MYUA 3TQEA 3KK3A 1JLEA 1FFGB 1Y9OA 1FX2A 4RUAA 2DNOA 3I5BA 1MG7A 5LMUJ 3QRQA 3B4DA 1GAOA 3G6XA 2RDIA 2FJBB 4XK8C 1CJVB 7FD1A 1R8AA 5J2MB 5IQ6A 1CQNA 1RDRA 4BC9A 2BX6A 4PABA 1KOHA 1VQ4S 4OZ1A 1TL3A 3HULA 3MMCB 1CJUB 3GCWP 1R0CB 1HNXF 2VH7A 1JK9B 5F8JA 2PA3A 1CG2A 5HN0A 3QIPA 2PI5A 4DR7J 5GVQA 2FVRA 3T9NA 5DQHA 1MMNA 4OL8A 2Y1IA 3NWRA 2WSCC 4QU6A 1VFJA 3GR0A 4ZVGA 1H2UX 4O3OA 3CCZA 3CO0P 4FDFA 3TVYA 2CQPA 1F3FA 1J5OA 2AX0A 1ZYQA 4BCAA 1SQFA 1L3TA 4YP3A 3J7ZT 2LA4A 1JJCB 1YJ9S 4YB7A 4C8MA 3GIIA 4IQXA 4CZCA 4OZLA 2MQNA 4JUZA 4MT1A 4UUXA 3RAQA 1BGXT 2HNDA 3G6YA 5DZ7A 2Y1LB 4DL4A 3THVA 2YPZA 2CG8A 2I5JA 3M1VB 2HLUA 4DG1A 2C3MA 2DY9A 1GH8A 4KGMA 5KAKA 4K4TA 4TLRA 4ID5A 1NZAA 4M5MA 4C8YA 4ZPBA 3MUTP 1IBLJ 3T1AA 3OFFA 1HPZA 2AJFE 4LF5F 2DIUA 2CQ2A 2VBZA 3TANA 4ZHRA 2NXJA 1N34J 1SJ4P 1N8RT 3OFHA 3A3NB 4CH7A 2WONA 2KO1A 1YIJS 5E0OA 4RJVA 4B3MF 2VV5A 1KKHA 2QFIA 1BLUA 3D3CJ 3NGUA 4Q2LA 2GX8A 4RNMA 2AV5A 3M8PA 1FESA 2KYZA 4OV1A 1VRUB 3MMAA 3M8SA 1RBOB 1TL7A 3HLUA 4JI3F 1ZS6A 4ED6A 2DNYA 2J8SA 1LKZA 4CM2A 5GADU 2A3JA 3VR1A 3IRXA 3DLEB 3WZ0A 2HFVA 3W64A 3QSIA 4A8QA 1WSRA 4HTIA 1YJ7A 5D0GA 2QYGA 3DYAB 3DCAA 4USJC 3HDSA 3ICLA 1EKRA 1SH2A 4WK1A 3HSGA 5IS2A 3CULA 2M8DB 3W7BA 4X64J 2MSTA 4RBUA 1CJKA 2BABA 3K5OA 4N5SA 3FMBA 1AUDA 4ZVEA 1FDNA 2HNZA 1RT5A 2OKQA 3V81B 1TUGB 2HK2A 1B0TA 3PW4A 2EKNA 3AOBA 3KK2A 4I2PB 3BSAA 4D3HA 4OI2A 3OL9A 1N5SA 1AROP 6FD1A 4K7QA 3NGSA 2RRAA 5A8WB 4DF4A 1IKXB 5L46A 1SL2A 2AJQA 4X66F 2V2QA 3OFEA 4O3QA 4OX7A 3N6MA 5IT9Y 1WC5A 3BYPA 3TAMB 3D1HA 1M0SA 2JEGA 2M7SA 3H90A 1X4FA 1XIQA 4DN9A 2RSQA 3LWMA 4NX9A 2WRMA 3GV8B 3TA1A 4ES1A 1F5CA 3ILOA 4I69A 4LR7A 4XDDA 2XWXA 2ACYA 2D41A 2Y3YA 1RWKB 3GFZA 4P75A 3POTA 3UCGA 2JWNA 1UW4A 3LP1B 1RHKB 2PA8D 2WCXA 1RTDB 4F2RA 2BE9B 4WP8A 2XHCA 2AJ2A 3NCRA 2ZBIA 2EW9A 2Y1JA 2VQFF 1X9MA 4OYXA 3B6BA 4O3SA 1WI6A 2CADA 2LXFA 2CJBA 4ECVA 1RAIB 4DV4J 2MZSA 1RISA 2RT3A 2NCKL 4Y2MA 2OFGX 2DCUB 4JV0A 1S59A 2HFZA 2RDDA 1UEVA 4OZ5A 4OJHA 5A6WA 3LWLA 3I96A 4XPCA 1S1UB 2YNIA 1BD6A 2FVQA 5HQMA 3G86A 3MAAA 2XZWA 2DY1A 2RU9A 4EZ6A 1YJNS 4ILLA 1RT4A 3V4IB 4DS5A 2MZTA 3D6TB 2CKWA 3OTCA 4HH1A 1RWXB 1AXQA 1YJTA 5HMZA 2J9EA 1KBRA 3VAJA 4RNFA 4YR2A 4PYAA 3D66A 1S9FA 3OVAA 3CJ0A 4OYPA 4DR4F 3D1QA 3EVMA 3KMSA 3BB5A 4J90A 1X9SA 1RSCA 4P6QA 2UVVA 5DLGA 2O01C 2ZNZA 4IOBA 4P7VA 1PG5B 4EWTA 5D8HB 1WI8A 1IM4A 4NLPA 2J7WA 1DQ8A 4NWBA 5D0RA 1IUJA 4R25A 2W25A 1MW7A 2B3TB 2EI5A 1GXTA 2EG1A 1BC6A 1PSDA 4DMZA 4FYYB 1Z2ZA 3OLBA 2BJ3A 3VALA 1UZHA 2C28A 4DUYJ 1VBZA 3FFIB 2HHHJ 4TY8A 4FPRA 4CI0B 3QO9B 1SC3B 2NSBA 3QATA 1RI7A 4U9RA 5CYMA 5F9LA 2MKSA 4MK8A 2ZJPQ 1RWMB 4TLQA 1HNWJ 4HT5A 4UUWA 3HP6A 4DFMA 4ANDA 2QJ3A 2PMHA 3QPIA 4KYZA 1T9YA 3PX0A 1NU4A 2HHPA 4J9OA 3T1YF 2VG7B 2BE7D 2HVDA 1FNMA 3R8YA 4N76A 4UT4A 4FF4A 5L8RC 1SBRA 4ZJQA 1WKLA 2M5YA 4P71A 3BN4A 3KLGB 1IKYA 1J2VA 3TW0A 3WIVA 4WFAQ 2BOAA 1GT8A 3FBCA 2C2MB 1M5KC 1IR1A 1EP4B 1JLCB 3JSMB 4YMEA 3OHAA 4DR2J 1ZBTA 4EFAC 5CA5A 1HWIA 1HI0P 1IVZA 4X84A 4DQSA 4WE1B 2CDQA 4ECYA 1FWPA 3DGPB 1UTAA 3LP0B 2F65A 3FNNA 3M30A 4PWUA 1N48A 4N41A 5ETPA 1VGYA 2NXCA 3GCXP 3C14A 1WKKA 3ETMA 5LM7E 4H54A 2FVPA 4DL5A 2DR8A 2L08A 3AB2B 5LJ5Y 2J6TA 1U1MA 2IJFA 2VKRA 4LR9A 4MK7A 4NEZA 3QBCA 3N28A 2CQDA 5L9NA 3GPAA 3VHQA 3WC2A 1T0TV 1XQIA 3OTEA 4IH7A 5F8LA 2XHWA 1TMMA 1YX2A 2B0GA 1QM9A 3JTPA 3ET6A 3GYNA 2RNEA 4DS4A 4RW6A 4ECTA 5IZHA 1TUVA 4KKOB 1VQYA 2C3OA 2OPPB 4PCQA 5GMDA 3CJTA 4PPZA 2FY1A 3ZZZA 4OQJA 2BACA 5KG3A 2AHOB 4XIUA 3QGGA 4DPOA 2X1FA 3DFEA 3BQ0A 2FGCA 2QLFB 1R27B 2HQIA 4RLEA 1PC4A 3R27A 1R6VA 4P74A 1KP6A 2HNYB 1E6VA 4M63A 1HLWA 1JLQA 3GE9A 1OY8A 4NI2B 1XMQJ 2B4VA 3UO0A 2F8EX 3ZZRA 1OPIA 3T1HF 3UQSA 1D0EA 3QNWB 3JQJA 1R43A 1R0BG 3MMBA 4UQTA 2QC3A 3JB9k 2EG2A 2J7UA 3I82A 2ZC3A 2MQ8A 1TV6A 1N32F 1E6YA 3H4BA 3C16A 4OX9J 1YBAA 1DARA 2JOQA 2QG9B 1U1QA 1SC6A 1V3ZA 2OMLA 5HJXA 2IY5B 2UUCF 5AE3A 2DVIA 5D3GA 1RWOB 3PFEA 3CDWA 3BKFA 3EVOA 2XMAA 1PILA 2ILZA 1RB0A 1KDNA 2RUGA 5ETOA 3Q86A 2AD9A 2XEXA 1RBLA 3W65A 1YHQS 2O66A 3GSDA 4DPYA 3A8EA 3ITHA 3LAKA 4OYZA 4E8UA 4MYTA 3UNYA 4QW9A 3KK1A 3DU5A 2R7RA 1RACB 3WC0A 3KFWX 4DL3A 5KG7A 2X3GA 3NXZA 4KHPJ 2DHXA 2EFNA 4KGVB 1LW0B 4C11B 2RVJA 1GTHA 1X4HA 3FGVA 3MEGA 1LXNA 5DETA 4NA3A 1GFWB 1U1RA 3HO1A 3QZ8A 4DZ6A 2OEMA 1RQ0A 4QW8A 4FPIA 4KO0A 4R8UB 1SJRA 2IVYA 3UNGC 1UZDA 1VQOS 3FBBA 1U2FA 5C25A 1GMVA 4UOFA 3VGUA 3M2VA 3C6TA 1OY6A 5GAHU 2LQ9A 3N4WA 3THTA 4U7UD 1TU0B 1XERA 2DNKA 4LFCJ 3TVKA 3G2XA 2IM0A 2B4OA 3MM8B 2R8JA 1M90T 3PVXA 2Y8WA 4LRDA 4JV5J 2D7SA 3W63A 3EXYA 3IR6B 1ZETA 4X4NA 3FBEA 4MIAA 3C66A 2NUUG 4RW8A 1HHTP 2PT0A 1HL6A 4G3IA 1WOPA 3MCNA 2GVDB 1YGYA 4ZPDA 4N56A 4K0KJ 2VG6B 3OVBA 1CC8A 4FKYA 4PYDA 1TL1A 4JI5J 1T9UA 3BPSP 3PHTA 1BE4A 1U0HA 4I7FA 3MD1A 2XULA 3EZOA 2W8KA 2Q3PA 4J9PA 1FRIA 2LDIA 5JMNA 5KFDA 2C1EB 1U1NA 1IR2A 3TQ1A 2XWYA 2GJFA 1ZA1B 3BJYA 4QZVB 2DEJA 1I3OB 2GO8A 1Q78A 4CLFA 5HO4A 2R7SA 3ZTPA 3E01A 4PR6A 2ZEJA 5LT5A 1K1SA 4ZP8A 3FBFA 4EYIB 2WTFA 3HHDA 4NPOA 1D09B 4DR1J 2ZVIA 1Y5LB 4OI0A 3MECB 4Q5VA 4PG5A 2APOA 1EKSA 3AB4B 3UDEA 2G2ZA 2FZCB 2ZWOA 1JLAB 5K14A 2ZOMA 3A12A 2RHQB 5CZVA 4JOUA 4IG0A 3DLGA 1EHWA 4WJBA 1P8GA 1XNQF 5KFPA 2RF2B 5J2NB 3Q0AA 4BC7A 5G0RB 2UXBF 1CULA 5KOXA 1VHIA 2IM2A 1BQMB 4DV3F 1TK8A 1KN6A 2I2YA 1N5YA 4USKA 1OQ3A 2HS4A 1L5UA 1ITPA 3VAMA 3G8TA 4DPTA 2LP4A 3W2VB 4K4XA 2QSWA 2G13A 3OL6A 3NS5A 2JVRA 4M5NA 2Z8QA 1H7XA 2ERRA 5KG6A 2NXUA 4FVMA 4CM0A 1T05A 1X4BA 1AZSA 2DHHA 2V4JB 1SH0A 2ZH6A 3LANA 3ZNUA 4CNZA 3H4DA 1UETA 5L1KA 2FZGB 1T9TA 3I55S 3VCDA 5A2QY 2BJEA 3SDEA 2BEFA 3HT0A 1FFSB 5HROA 4B9VA 2HIQA 3OJSA 4OIXA 4USUA 3PKYA 1RWWB 4RW4A 3PO4A 4QR1A 4PWWA 4YS2A 5D15A 1X4AA 2JNJA 3H7HB 1DQ9A 2DNQA 2HGNA 4X4SA 1U1OA 2VB6A 4JI0F 4YFUA 3RAXA 3Q8SB 5C42A 1FXDA 2HHUA 1LFWA 3KNGA 5B0CA 3HVWA 5KFRA 3QQCD 1JX4A 2OFHX 1J5EF 1HW8A 3GJQB 4M5KA 1UAWA 2IA0A 2BXJA 4DUTA 2GAGC 4P2FA 5A8RA 2HBQB 1M5OC 1YJUA 2HYIB 2XLKA 2MY8A 2DXFA 1MWYA 4K8RA 2DITA 2GGPA 3P6YC 2WBMA 1Z4UA 2KM8C 4GKKJ 4TNOA 1U48A 2VZ9A 1MROA 1D8ZA 3F73A 1K8AT 1TAUA 1FJGF 2PO4A 3MF5A 2IRUA 4OYBA 5DQIA 2KB2A 3CCUS 1FE0A 1Q5VA 1S99A 3C15B 2JEIA 4ER8A 4IR9A 3PCOB 1KQSR 3PW5A 3Q23A 1ZA2B 4ZVOB 3FUYA 3SSQA 2P6SA 3DRRA 2E1RA 3QZ7A 2A18A 3W2WB 4LF5J 5DGBA 2ASDA 3R5BA 2DGQA 1RHRB 3KHRA 4OI3A 3U1MA 3IWNC 4LJMA 3PM9A 2MDAA 4A4JA 2MMYA 2VICA 3FCWA 2QO3A 2UU9J 4CYUB 3PJXA 5AE1A 1HARA 2DNHA 3QT8A 3QT5A 2Q66A 2EEYA 3QAUA 2BYCA 2GJIA 4TQRA 1V9OA 3BZQA 1SKWA 2GHVC 1NAQA 2V4RA 4DR6F 5KT3A 3BBCA 3G9CA 4B9UA 1KVJA 4Q8FA 3T6BA 1N36J 3ENWA 2JEFA 3RYLA 2F5GA 4CLPA 2RUSA 4OHZA 3W66A 4FS1A 2BR0A 2V8DA 2CJ9A 2CQBA 2WSEC 2VFUA 3L7PA 5KFQA 4O3PA 4EGLA 3OVSA 2DNZA 3CMQA 2EFVA 4LFAJ 4GO7X 3GONA 2IA6A 4MFBB 5IWAF 2XY6A 2W9CB 3VZHA 5HMYA 3CDBA 4XPEA 2NXEA 1WD6A 1RAGB 3MM5A 2GAHC 2XSJB 3QJJA 5IM0A 1OO0B 4LSLA 3DRYA 4USTA 4M5DA 3M8QB 4X4OA 3MPWA 3MPDA 3D5MA 8ATCB 1HBUA 5IV3A 5DZ6A 3HMJG 4DQPA 4F4WA 2FJXA 1CC7A 3G87A 5IOLA 2E5JA 3M8YA 3ELHA 2ALZA 4Y2AA 3CCJS 2IVFB 3EPIA 1EQ0A 4X66J 1H2TZ 3IS9B 1ELOA 4JBCA 2F40A 5B0AA 2MJUA 1S1VB 1KFDA 2VOOA 1NJZA 1FF2A 3OR2B 2O5DA 2G0CA 2DGWA 4L73A 1Q0NA 4GO5X 2ZH2A 4DSFA 3SCLE 1X4CA 2BE2B 3FQKA 3DRPB 1Q7LB 1PCAA 3V6JA 3MM9B 1MN7A 1R0AB 3MOZA 2DRAA 1XBWA 4BWMA 3KDNA 4WKRA 1IBKF 4I6YA 4DHVA 4DI6A 2MLXA 1O0PA 3CMES 3R5CA 5BYRA 3OXLA 3TVZA 2LEAA 3DC2A 4EZ9A 2YWWA 3DN9A 3NNHA 3AD9C 2KRBA 3I0RA 3SCIE 3TUZC 1RT6A 2DPIA 1WEYA 5KFLA 5KFMA 1FDAA 1DLOB 3JSYA 2MKYA 4DCOB 2DR6A 1QY7A 2NYIA 3NNCA 3NMRA 5F8NA 1QAXA 2YNHB 2CQHA 1SJQA 4C3LA 2NR0A 3GZ7A 2A1BA 4MKBA 1EZZB 4J9LA 1ZZFA 4ZITA 4IO9Q 2LKZA 3B8HA 4F4XA 4M5IA 1FDBA 5GMEA 5CZXA 2DCLA 1HQ2A 3TUIC 1NHKL 5CD4A 2PSZA 1H6KX 3JAMU 2B7BB 5ETSA 1N5QA 2HQGA 4Y3CA 1WF1A 2WW8A 4I4BA 4C0BA 1CLFA 1FERA 3PX6A 3GIKA 4Q43A 1QE1A 2DNMA 2A10A 3P5BP 1TK5A 3HKWA 4Y2KA 2VFSA 4PXBA 2ALYB 3P5TL 3SV3A 4L76A 1WEXA 2B6AA 4PQUA 2VG5B 3NP5A 6FDRA 4XO0A 5HLFB 1XNRF 4G1IA 4F3QA 1WDTA 2B5JB 3JYTA 4HHUA 1WHYA 4NYPA 1X0FA 4C9DA 5IXUA 1B99A 1R31A 2HG4A 1VC0A 5G4DA 1FEEA 2IYIA 3PRDA 4CP5A 2GHPA 5LMUF 4NRUA 1LK7A 2DK2A 4RWWA 3M05A 3V6HA 3DOKA 3E51A 3KMQA 2HVZA 3CD7A 3M6WA 5HQLA 2RQCA 2YKMB 2HSEB 3K58A 2NSCA 3NGRA 3UDCA 1N5VA 1BQNA 1T03A 4CRJA 1X0PA 3DMJB 4DR7F 2GQ2A 2HHWA 2UP1A 3AAWB 4JI6J 4O23A 1KQGB 2ADBA 3LOUA 4FXDA 2C2NA 4PPDA 1PAEX 1YI2S 4ELUA 1R8PA 2VL1A 1XJWB 3VAGA 3Q22A 3EUNA 2BANB 3SQGA 4DPXA 1M5SA 1KHVA 1TKDA 1DBDA 2NREA 4ZJOA 3CCWA 1REVA 1X4EA 1JLFB 1PAUB 1GX6A 3KLFB 5F8GA 1JJHA 1K0TA 1W7WA 3QJLA 3GIMA 2R3VA 2YKAA 3EZUA 4ES3A 1TKZA 1JKHB 1M5VC 2DIVA 1SV5B 2HRUA 4ED4A 1GK8A 3GG0A 3RBZA 3KJVB 3O6QA 4RU2A 3AA9A 3DLBA 1SL0A 1OSCA 3ZZOA 2VDIA 5K9FA 5FLXU 4ILMA 4X4VA 4HI1A 5ETTA 1UVNA 1F6TA 3QGPA 2MZQA 1FHTA 4KSEB 4U7UK 1NK7A 2DISA 2CNLB 4CIOA 4V19X 3CIZA 2HPUA 1N34F 3M9OB 5H1SV 4Y34A 4ZCLA 3WX8A 2YKNB 3BDEA 3R1LA 1NDKA 2CPHA 1RTHA 1VQ5S 1IKVB 4A47A 2XLJA 3CCRS 4HACB 1XWLA 3AFGA 4DL2A 2CWKA 2LLZA 4IUFA 1PYSB 4QWCA 4PG6A 1HMVB 4Q0BB 2ZZNA 1NH7A 1F3VA 4GMKA 1JLEB 4A8SA 4E0DA 4U8YA 1H72C 2HWTA 1TL4A 1ICEB 2J8AA 1HBMA 4UW2A 4KPCA 3D28A 2KVIA 5KFBA 1L3VA 1RHMB 2GMJA 3HVAA 1DURA 5J1EB 3OD2A 1TL3B 5MLCV 3M9MB 4A8XA 1NKCA 4HHHA 1OS5A 1G3OA 2DGOA 1UVKA 3M32B 2ZHOA 2XMKA 3QIPB 5B0DA 3QLHA 3NCPA 1ZTTA 4CLYA 2VQEJ 3G82A 3BGRA 1XEZA 3D7SB 4X64F 3EGZA 3ENAA 2KM8B 1JIHA 2KU7A 3HVTB 1SQGA 1FEHA 2ZHAA 2PDAA 5DDPC 3PXGa 2UZAA 1NH8A 3CVKA 2XY7A 4UZCA 4ZK7M 4WWSA 2UUCJ 2IHR1 1NLKL 1KRPA 4IDKA 4DCJB 1S1XA 2YNFA 1DFDA 4IOAQ 4K5SA 2R7WA 3ZZYA 2KN4A 4OV6A 4N7TA 2CQ1A 1BY9A 5KFVA 2XMMA 4C8KA 1Y0HA 2V34A 1PIEA 3ZXWA 3HHNB 4YR0A 5HSPA 1NDCA 2KI2A 1WKJA 3K0JA 4ED7A 3AOAA 4ID5B 1S49A 1OIAA 2ZBCA 4HEA9 1T9XA 1LNQA 3S1TA 5ITHA 2PGCA 3GFYA 3PKMA 1S9EA 3TA0A 3D9BA 1FRLA 1SUQB 3JTOA 1VHFA 4YHHJ 2ZITA 5A6PA 2ASLA 4KT0C 1XMOJ 4CLKA 3I4PA 1C1BA 3M8PB 2O3DA 1HYSB 2UVRA 2W2QP 3MMAB 4IFVB 1TL7B 4NCGA 4DV4F 2Z57B 4Z2XA 2XC9A 3Q8VA 2A6MA 1NCLA 2R2RA 2AYGA 1NPKA 1TTHB 4FYDA 3OSNA 4ZPWR 2AJ4A 5K5MA 2JDJA 1TUWA 1HWUA 4DF8A 3I56S 2XCPA 2GCFA 1CJVA 1B4SA 2CJQA 2XI3A 3DI6A 4CLLA 3GV5B 3BO2A 2RMLA 3OTDA 3KLVA 3V4MA 4Y28C 1NPRA 1S48A 1JLBA 4TN2A 1CJKB 5KFSA 3UN3A 1W2IA 3AT1B 2DNPA 3LA0A 2HNZB 1RT5B 2QL5B 3RW6A 2D74B 5JXSA 4G1QA 1D9AA 1O8BA 2CFXA 2MZRA 3JXOA 1GMWA 2DRDA 2BJ7A 3DOLB 3LQVA 2HRYA 1FD8A 2W4DA 2F8MA 5CD4H 1FK9A 5KFKA 1PO6A 4BLGA 2V8VA 4L74A 3VWSA 3R97A 2DD8S 4IO1A 3V6DA 3DXBA 2B8QA 5BYSA 2EBGA 3THPA 4A48A 4O0NA 2PIIA 1WOOA 1M5PC 4DUYF 4PXEA 2HHHF 1DY3A 4WF9Q 3NGKA 2GIQA 2HURA 1NK5A 4YDXA 4MKAA 3PDNA 4RNHA 3M1VA 5DJBA 3OT9A 1EETA 5IV4A 2GHWA 1RAOA 2E7XA 3POTB 3HFZB 1OJ4A 2ZOGA 3EGWB 4USIA 3GSIA 2HIYA 2QYCA 2V69A 2R8HA 2KT3A 1QUPA 2XNQA 1FRMA 3R7NB 5J2PA 1U6BA 2W01A 2UXBJ 1SC4B 4LRCA 3CDEA 3FEZA 4AL6A 4F4YA 1RU2A 4DR2F 1OPZA 3KUGA 1VMBA 1VBXA 1JNRB 4WBFA 1AW0A 3CCQS 1R3NA 2C2EA 3P49B 3EYZA 1VRUA 3LAMA 2GQCA 2FJEB 3CCES 4X62F 1TK0A 3IRWP 4DWIA 1KC8T 3MAAB 4DDFA 4DJBA 3DLEA 3TUPA 2G2OA 1P27B 1HWLA 2IIHA 2BDPA 5L1JA 2BQRA 1YJWS 2R4FA 2Y1RI 4F26A 2Z2ZA 2V2ZA 1UJ4A 1S72S 1FKPA 4I1TA 1HNIA 5F8IA 4ID8A 5SZTA 1R8BA 1FVQA 4USVA 1IJFB 5CCMA 4M8LA 4JI8J 1NO8A 5L9XA 3SXLA 3FRZA 4UOHA 3V81A 1TP7A 5B0EA 4F0MA 3ZZTA 1FTRA 1GNKA 3IMQJ 3QSYB 4I2PA 4ZPAA 4QPTA 3NGTA 5T14A 4L3KA 1P9QC 4P2SA 3VV2B 4DX6A 2LXIA 3KYLA 2XYPB 4M5LA 2GJ2A 1SVDA 1IKXA 1C0UA 3BYRA 2LEBA 3BGFA 2VBYA 1FT8A 4TY8B 3CJSA 3IAS9 2RQKA 2YWEA 3DDNA 2W7PA 4EEYA 2B4UA 4NXMJ 3ZTOA 5CYMB 4B9LA 5ETMA 5J2QB 3O44A 2GMLA 4LF2A 1XMQF 3K17A 2YBVA 3TUJC 4WIQA 4O4GB 2I9SA 4K5RA 2DH8A 1FJGJ 4X65J 5KFWA 2ZDPA 1WEZA 5IT4A 1VLYA 2N3LA 2UXCF 4TU9A 2KH9A 2JVOA 1IKYB 5KFEA 1WG1A 4KPYA 3D6FB 5ETQA 3NGDA 3BH7B 3EPGA 1U1KA 4URQU 4DU7A 5FDLA 3LP1A 2C3YA 4ZVFA 2B8PA 1S6QB 4CCHA 2HRTA 1TKXA 2L9NA 4JI2J 4I0WA 3CW2C 4FVCA 2CJKA 2H3EB 2HFOA 4NLGA 1UFKA 9ATCB 3D3BJ 3HSDA 3DLJA 3RBDA 3LP2A 3M30B 5CYQB 1WDDA 2EWHA 2HMIB 4NLDA 2DGUA 3T19A 3R5AA 3C14B 3MD3A 4RBTA 2QX0A 3SI8A 1FE4A 4WFYA 1K73T 4NXNJ 2L9DA 5CYJA 1FTCA 1BXNA 3AH6A 4LRAA 4CLSA 5DGAA 3RW7A 5JVHQ 2GFFA 2V8HA 2JC0A 2DB1A 4FF2A 2AP6A 1U6ZA 3CXCR 3N5FA 1Y7PA 4UY85 4E2FB 3W8PA 4ZVSB 4HKQA 3MUVP 4KE5A
chains in the Genus database with same CATH topology
1VOMA 3A8EA 3ITHA 4KHPF 4NYZA 3N9UC 4QIFA 1NK6A 1LFPA 3LAKA 5ADZA 4E8UA 1HD0A 2ZE2A 3CIMA 1K0VA 5KG0A 4U67Q 4B3OA 3OL7A 1FJCA 2BW2A 1F0XA 2MKHA 5E33A 3TI0A 1QLNA 4MYTA 4P7TA 1C0UB 1WNEA 3FZ2A 4LIRA 4KTQA 3BSCA 3TAPA 4QW9A 3KK1A 3DU5A 2R7RA 3WC0A 1DQAA 3KFWX 2JSXA 4A8YA 4DL3A 5M2UA 2C3UA 5KG7A 2X3GA 4DV5F 3OUYA 4O4RA 4RW9B 1LWCA 4EO8A 2DHXA 2EFNA 2RQMA 1KQFB 5KTQA 1LW0B 1KLNA 3LGMA 2FJVA 4C11B 5KFGA 1U4BA 2RVJA 4CH1A 4IOCQ 2VA2A 2VODA 3Q24A 1GTHA 3CJ4A 2HWHA 1MROB 3LO3A 1X4HA 3FGVA 3MEGA 1LXNA 5DETA 4NA3A 2IM1A 1NHUA 5DM6Q 3PRBA 1U1RA 2OSRA 3GQCA 1KONA 3HO1A 1Q7YT 2DGTA 3QZ8A 2XG8A 4CO2A 3SZ2A 5KFXA 2UV8G 3K5MA 5KFAA 4CO3A 1RQ0A 4QW8A 2Q43A 4KO0A 4NLWA 4R8UB 1SJRA 4DSEA 2IVYA 1JLAA 1E6VB 4YEAA 2MKKA 3UNGC 3D0IE 4BHQA 2KDOA 2CPIA 3KWMA 4B02A 2WB4A 4CTAA 3I4HX 5DG7A 1VQOS 3FFIA 3MM6B 4C0OC 1FKAF 4LFCF 1DTTB 1D9FA 1QAYA 1U2FA 2FVSA 4IYQA 5C25A 2HLTA 1NJYA 3DRRB 4LT6A 2E9TA 3QGHA 4OZJA 2ZH1A 1U1PA 3KTQA 3MMJA 2MGZB 3M2VA 3C6TA 3FJ2A 1VQ6S 4NZ0A 5G0RA 5GAHU 1ULRA 1SJ1A 2LQ9A 3N4WA 3N79A 3THTA 4PG7A 1S6UA 4JV5F 2HHXA 4URSA 2NLWA 5FDLB 3MMBB 1XERA 2DNKA 5EGYA 4MMOA 2B51A 3BGUA 2LEPA 3TVKA 3I31A 2IM0A 2EKYA 1TKXB 4ICLB 2UUTA 5F0UA 2B4OA 2EPIA 3MM8B 2R8JA 1M90T 4LF6F 4DFKA 4NLXA 2BRKA 3KLHA 3PVXA 1D8YA 4I67A 5EWEA 2HWIA 1E6YB 4MJKA 4NCBA 3W2VA 2D7SA 1JLGB 1TL5A 3EXYA 2PEHA 3IR6B 1ZETA 1LK5A 4X4NA 2WK4A 4MIAA 3CEDA 3SCKE 4K0KF 3C66A 5JUMA 3KG4A 3LP2B 3P96A 2HVIA 5D78A 2NUUG 4RW8A 1HHTP 1RJJA 2PT0A 4WIIA 3O2IA 1HL6A 4OI1A 4G3IA 3IO1A 3UDLA 1YSJA 4JI5F 2R7XA 4PWDB 1JLCA 3JSMA 1LWEB 2GO9A 4DEZA 2IBOA 4GKJF 2BUNA 1SJ3P 3G96A 2UVWA 2XCAA 5D3GB 2V4JA 3DLHA 4OX8A 4ZPDA 1YGYA 4PRFA 3CUNA 3DU6A 4N56A 4WE1A 2VG6B 3OVBA 3J7A1 1CC8A 1T02A 3GG1A 5L1LA 2COLA 1HQUA 1LWFA 2GIRA 3GB0A 1F5AA 1TL1A 2UUWA 4OI4A 5D4NA 5DDOC 2C2DA 2BBEA 2H9ZA 2Y0SD 1VQMS 3AJ2A 4I7FA 3M4XA 3TARA 1G6BA 3MD1A 2C22A 2XULA 2XGQA 2W8KA 2Q3PA 4J9PA 5CQGA 2ZH5A 3O3LA 1FRIA 3QWUA 2OLWA 2LDIA 1RT7B 4DQIA 1RAJA 2CPXA 2QLXA 5KFDA 1IKWA 2XI2A 2RD5C 5B0FA 1HD1A 1Q81T 1U1NA 2FHKA 4ECWA 4ECXA 4LSNB 2L48A 2K3IA 3J81Y 1TAQA 2ZJRQ 1VIOA 3BSOA 3G8SA 3ZZ0A 2ZE2B 3GFXA 1I1GA 1QSYA 2KT2A 5GADI 3BSNA 3TQ1A 4F3MA 4B3OB 2XWYA 4QR0A 2KXNB 4HVZA 3BJYA 1SJFA 3C6UB 1R8CA 3PO5A 2J9CA 1R8HA 4QZVB 3J80Y 5IM0B 4LVOP 4ZA1A 2GO8A 1Q78A 3KK1B 4LF4F 4DR1F 5D4OA 5I4MA 2OTLS 1FA0A 5HO4A 2Q6CA 5EWFA 4B3TF 2R7SA 3ISZA 1LWCB 2OPSA 3E01A 4QOTA 4PR6A 4NLSA 5LT5A 1UWBA 2CQGA 1DAXA 1K1SA 5EWGA 4QWDA 4OX6A 4QIVA 4ZP8A 1X4GA 1HBUB 4DFJA 4EYIB 5F41A 2WTFA 3HHDA 4NPOA 4AXIA 5CXTA 4Q8EA 4TQSA 4WFZA 4DN0A 2VONA 1Y5LB 4TKTA 3GR1A 4OI0A 4C8OA 1Z1ZA 3UCUP 4MIBA 3MECB 4OJ1A 4ECQA 4NCAA 4I2QB 4Q5VA 4ECUA 2QEXS 4PG5A 4PKDB 1VQ8S 2APOA 1S4FA 2ZFHA 5DG9A 2BQ3A 1SXLA 2RQ4A 2WHOA 2ZDOA 3AB4B 4KO0B 5GAGU 4KJIA 3SFUA 1JLAB 3Q2SC 3MEDA 5K14A 2ZOMA 3KHHA 4L3NA 1KQKA 3NCQA 4RW7B 1RT1A 2ASYA 2RB7A 4JOUA 5CZVA 4IG0A 3DLGA 2FC9A 5A8KA 1Y5IB 3MURP 3NLCA 3IGNA 1HNWF 4WJBA 5H9FJ 2JJ4D 3AQOA 1S0NA 1UFWA 2JX2A 1P8GA 1XNQF 5C25B 2RF2B 3SCJE 1XTZA 5KFPA 4ZS6A 2B7CB 5J2NB 3HK2A 3OTBA 3Q0AA 2B9XA 4KR0B 4DSJA 3M2VB 3M6VA 1Q8LA 2VC1A 5G0RB 4BC7A 5J2QA 4RKUC 3RR8A 2UXBF 2CQ4A 4HDGA 5BJRA 1SKSA 2QFJA 1IXKA 5KOXA 1U24A 2IM2A 3QAEA 1U25A 2W7OA 1BQMB 3TA2A 4Y65A 4RWXA 1YG0A 4DV3F 1TK8A 1U1LA 2OTJS 1ZPVA 1KN6A 3T3FA 2I2YA 2BA9A 1N5YA 2ZH7A 3CC7S 1OQ3A 3GIJA 3IR5B 3AQPA 2HS4A 1L3SA 1L5UA 3CC4S 2BQUA 1MMLA 2MQLA 3PEHA 2Z4PA 5AXLA 4O4GA 1B0VA 3O5TB 2CPEA 3UFCX 2DR7A 2DGSA 3S01A 3VAMA 2FD2A 2R8KA 3G8TA 5AE2A 5KT4A 5I42B 1CEZA 2DO0A 2CVIA 1S79A 3W2VB 1ZPWX 4K4XA 2QSWA 2E1CA 2G13A 1SIWB 1APSA 3G8QA 2DT9A 2ZZMA 4A8WA 5J1PA 3OL6A 4F50A 3NS5A 2E66A 2OPQA 2ZNYA 2JVRA 3OW2R 2Z8QA 3G6VA 1XR6A 2XY5A 1H7XA 2AF6A 4J9QA 5GAEU 1G2EA 3FCHA 2ERRA 4RW8B 5KG6A 3W2WA 2NXUA 4FVMA 2KHCA 4ZP7A 4B9NA 5HQ8A 5LSLA 4MKYA 2HAIA 1T05A 4ZCMA 3NAIA 4ED2A 2UUBF 1X4BA 3I0RB 4JI7F 4QPXA 2K7KA 2V4JB 5CHCB 2HQ3A 1RT6B 2D3UA 1SH0A 2VC0A 3MEEA 1S6QA 4FNHA 2XNRA 3FRYA 2Q79A 3CMAS 3HT3A 2ZH6A 3NWGA 3D1OA 2OO4A 1HR0F 2DRBA 1S0VA 3CB4A 1N52B 3LANA 2HS3A 3FEYB 3IFEA 4CNZA 1JXEA 1VK3A 2M8HA 3KHLA 3H4DA 1HQUB 1LWFB 1O51A 2P9EA 1UETA 4GC6A 1TL1B 4J5OA 2CIMA 5L1KA 2R7TA 1R6YA 2PN6A 3IGVA 2AGOA 4K50A 1WG5A 3M2UA 3I55S 3VCDA 5E7OB 4I7FB 5A2QY 2QA4G 2CPJA 2BJEA 4YY3F 3SDEA 1NK0A 1VRTA 1X8DA 5CYQA 2I8EA 1UEUA 5HROA 3BQ1A 4B9VA 2HMIA 5L38A 1WG4A 2HIQA 3UI3A 2VUGA 3OJSA 2BZ2A 2UVUA 4OIXA 4ALZA 2PD1A 1MWZA 5DDQC 4IR1A 1N54B 1KD1T 2IYGA 5CH7B 2VFVA 4LF8F 3PKYA 4RW4A 3PO4A 2CZVC 4QR1A 2HW3A 2CPYA 5KT7A 5KFNA 2BM0A 4CO1A 2XBPA 4ED8A 1URNA 5DO2A 1RTJA 4C97A 4K4UA 1IQTA 2FHJA 1X4AA 3L95X 4EUVA 3VAKA 1XN9A 3PEJA 2R9LA 2N7YA 2E5IA 4NRTA 2R8IA 2GW8A 1ZAXA 1DQ9A 2DNQA 2HGNA 5KFOA 3ONQA 3B78A 1G7CB 1TVRB 1SL1A 4X4SA 1NKEA 4H4OB 1U1OA 2VB6A 3MI7X 4IQMA 4JI0F 4YFUA 3RAXA 3Q8SB 4ITSA 1UWBB 5C42A 1D9DA 1FXDA 2CRLA 2HHUA 1LFWA 3KNGA 5B0CA 3K5NA 3O8WA 3HVWA 4FZVA 2RS2A 2W4CA 1QAJA 4Q45A 3PNIA 1SH3A 5EN1A 3SV4A 3RTVA 5KFRA 5LXYA 3LALA 1FDDA 3K7RA 1QE1B 1SIZA 4OJ3A 2X1AA 4F25A 4Q7AA 4QCLA 4FXVA 4RNNA 1HNZF 1JX4A 2OFHX 4MFBA 2RRNA 1WHXA 2E7WA 3ETOA 2U2FA 2V4QA 2W9CA 1J5EF 1HW8A 2ROGA 1ZM3A 4OLOA 1F9FA 2QMXA 1UAWA 2F8HA 1U09A 2C42A 4EO6A 2IA0A 1RT3A 4NA1A 2RH3A 2BXJA 4NLUA 2FLPA 4GKKF 2LCWA 2OAUA 4F4KA 1ZH5A 4ERDA 2KTQA 2XSJA 4F3OA 5A8RA 2IVMA 3MEDB 2DHGA 2HFNA 3VQSA 4AFFA 1Q82T 1M5OC 1UVLA 4OHXA 1YJUA 1NEEA 2HYIB 2XLKA 2ZC4A 3N0VA 2MY8A 2UV8A 4DOZA 1RT1B 4CH0S 3LPYA 5A8KB 3DLGB 1MWYA 4WK3A 4PQUB 5F9NA 1CSJA 1OQ6A 3H5XA 2DITA 3N01A 1FXRA 3EX7B 4RW9A 3QMQA 2YVSA 4I6AA 2GGPA 3P6YC 1LW0A 2WBMA 3D0HE 2B9YA 1Z4UA 4ECSA 3DLLQ 4U6PA 2YH1A 2KM8C 4TNOA 4HYKA 3I32A 1U48A 3IAM9 2XMWA 2VZ9A 4KFBB 5KFZA 1MROA 1D8ZA 2IBKA 3F73A 1K8AT 1TAUA 3T5KA 3KHGA 1FRHA 2HS0A 1FJGF 2PO4A 3NS6A 2RDJA 2G1DA 2M52A 1FNXH 3MF5A 2IRUA 4KHRA 2MXYA 5DQIA 3CD0A 2KB2A 3CCUS 4I6WA 2JHEA 1FE0A 3I0SA 3J7Z5 4L72B 4R8UA 1S99A 3IBWA 4DFPA 4H4MA 2N7CA 2JEIA 4IR9A 5KFHA 1KQSR 3PW5A 5EX0A 3MM6A 4ES2A 3Q23A 1DTTA 3BGLA 1C0TB 3FQLA 5T7LA 3SMZA 4QBUA 4NA2A 2K7JA 4N8OA 2DH9A 3DXSX 3SSQA 2P6SA 2VASA 3DRRA 4W90B 2E1RA 2OPQB 2YY3A 3EZ5A 3QZ7A 1PGZA 2NUHA 2YX1A 4NZ6A 2MGZA 2UU9F 1FJ7A 2OPRA 3HHLA 1UP1A 2A18A 3W2WB 1KTVA 2WBRA 4EU0A 1HI1A 3KK3B 5DGBA 3ZZUA 3MR6A 2LQJA 2ASDA 3N5BA 2HVHA 1T05B 2B43A 3R5BA 4OX9F 3AJ1A 2BE2A 2DGQA 3KHRA 2DH7A 3EGNA 2QSFA 4OI3A 3U1MA 4LJMA 3IWNC 3PM9A 2MDAA 3MEEB 3QGIA 5FLXY 4C8ZA 4A4JA 3MM9A 2MMYA 2J7KA 3M6UA 2DR5A 3M9NB 4ICLA 3DDKA 4YB5A 2QO3A 2Z2LA 3PJXA 3D54A 5AE1A 3HFKA 1T03B 1HARA 1PC5A 2DNHA 1RP5A 1C1CA 3TP2A 1N36F 2RJZA 5LL6d 2EK1A 2AJ0A 3M2RB 5EHHA 3QAUA 2W9AA 4UY8T 3BEGB 2Q66A 1LOUA 1VK8A 1JLGA 1HBNA 2BYCA 2GJIA 4TQRA 1JJ4A 1V9OA 3BZQA 2FJAB 3HI9A 3M2UB 1TFWA 1SKWA 4FYDA 2GHVC 1NAQA 2V4RA 4ZP9A 3TRGA 1Y3KA 4DR6F 1VRTB 2M4MA 5KT3A 3KOAA 3H20A 4EBCA 1K1QA 2FJDB 1XK8A 3G9CA 1RT2A 3RRKA 4B9UA 1KVJA 4Q8FA 3T6BA 1UJ6A 1NHVA 2QT7A 2KXFA 3I5CA 3ENWA 2JEFA 2M0GB 4Q44A 1F5BA 4RW4B 1LWEA 2GC8A 3HX9A 1ZM2A 3RYLA 2VPZB 1B7FA 2NQPA 2KT5A 3MM7A 4IKAA 4Z37A 2R7UA 1NNDA 1DRZA 1WTBA 1GXLA 3SQGB 2JRSA 4WFXA 2VG6A 4KQZA