2KKHA

Structure of the zinc binding domain of the atpase hma4
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
95
structure length
95
Chain Sequence
ALQNKEEEKKKVKKLQKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALNEARLEANVRVNGETSFKNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative heavy metal transporter
publication title Metal binding affinities of Arabidopsis zinc and copper transporters: selectivities match the relative, but not the absolute, affinities of their amino-terminal domains
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Metal transport
total genus 12
structure length 95
sequence length 95
ec nomenclature ec 3.6.3.3: Cadmium-exporting ATPase.
pdb deposition date 2009-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kkhA01
1FEEA 2W4CA 2ROGA 2VV5A 3I9ZA 3KNGA 2LQ9A 1CC8A 1LQ9A 3KG1A 2QYCA 3BDEA 1YJVA 5T7LA 3HFKA 1KVJA 1YJTA 2GGPA 4HI2A 1SI9A 3BR8A 3T9NA 2QLXA 4A4JA 1GXTA 1V3ZA 2IFXA 1FVSA 3DCAA 1GXUA 1Q8BA 1Q8LA 1AFIA 3GZ7A 2PGCA 1R6YA 1W2IA 1P8GA 1XBWA 2KKHA 3BN7A 3HHLD 4FNHA 3IWLA 5A6WA 4DPOA 5B0BA 2L3MA 3HX9A 4OJHA 2OD6A 3HHLC 2EW9A 3BM7A 3IWXA 5B09A 2GFFA 2K7JA 1KQKA 1FE4A 1VQSA 2XMVA 4YDXA 2N4DA 4NPOA 2OAUA 2HLTA 3FMBA 2GGPB 5F0WA 3FGVA 2FTRA 1S6UA 1OPZA 1CC7A 1Y9OA 3HF5A 1MWZA 1X0PA 2AP6A 3MCSA 2AJ1A 3LO3A 2BUNA 1TZ0A 4Q2MA 1FE0A 1X7VA 4F67A 2RILA 2LDIA 2RSQA 2IYIA 4OJ3A 4ZA1A 2GV1A 2KT3A 2VH7A 2N4CA 1AFJA 4ZOSA 1TR0A 2K1RA 1ULRA 1X8DA 1YJUA 3MZIA 1U7LA 2OD4A 2OFGX 1AW0A 1SB6A 2OKQA 2HIQA 2GO8A 5K9FA 1SQEA 3UDCA 5B0DA 2QIFA 2XMMA 3K7RA 1MWYA 1URRA 3QGPA 1N5QA 2ROPA 2KT2A 2KYZA 2W4DA 1N5TA 4A46A 3TOQA 2ZDPA 5B0FA 4HH0A 3BB5A 4YEAA 1OQ3A 1Y3KA 2BYCA 3QMQA 1Y3JA 2CRLA 2BJDA 1TL5A 1APSA 2ASYA 2K1RB 1WD6A 2GA7A 2GCFA 2AJ0A 1VQYA 2N7YA 2OFHX 2PD1A 3E8OA 4U9RA 2AW0A 4A47A 5KAKA 1KVIA 2FB0A 1JWWA 1JK9B 3KG0A 1K0VA 1Q53A 4NL5A 2LXFA 4DL0C 4EFAC 2JDJA 2Q3PA 1YG0A 2LQBA 3LGNA 2K2PA 3VTIA 2G9OA 1N5SA 3KKFA 3HHLA 4Q2LA 2QLWA 1FD8A 3DXSX 1P6TA 1YJRA 2K7KA 2ZDOA 3HDSA 4OJGA 1S6OA 1CPZA 1IUJA 5B0EA 2XMWA 2HFNA 1OSDA 4HI1A 4FNIA 2OMOA 4Y2MA 2OP5A 4Y2IA 5B0CA 5A6PA 2ROEA 3LGMA 5B08A 3CJKA 4OJ1A 4DN9A 4QOTA 3TRGA 2BJEA 1YRXA 2FIUA 3FRYA 2FHMA 4HL9A 1QUPA 2ACYA 2HQIA 2W4PA 1OQ6A 4OIXA 5F0UA 1FESA 5IXUA 4A48A 3HHLB 5B0GA 1TUVA 4Y2KA 2BBEA 3BGUA 3WDOA 2HFOA 1TL4A 2XMKA 1N5VA 3BF4A 4HH1A 2IYGA 3TNVA 2RU9A 1Y0HA 1RJJA 2XMJA 5T7LB 2XMUA 2HLUA 3CJKB 2RMLA 3F44A 1FVQA 1Q4RA 5B0AA 2XMTA
chains in the Genus database with same CATH superfamily
4ELVA 4OV1A 4YMEA 1UWAA 2RDIA 4HI2A 1KVJA 3VF0B 4DV6J 4P6QA 3GYNA 1B4SA 2DGXA 4QPXA 5J2PB 1IKWA 1XNQF 4OYIA 2NLWA 3VQSA 2EBGA 1C0UA 5DQHA 4C8ZA 3LW5C 2F8MA 4LF8J 2XLKA 2W2QP 5I42A 3S01A 1FFGB 1K47A 3PNIA 4MKYA 1QE1B 1N5QA 3H20A 4R25A 2BYCA 2DGWA 5KT7A 1FRJA 2X1BA 2XG8A 3M8PB 4KYZA 4TU7A 3CSKA 1KWMA 4PG5A 2BE9B 1HBOB 2MKKA 2L08A 4OI4A 3W65A 1XQIA 2MZ1A 5T7LB 2VB6A 2AEMA 1S9EB 3UN3A 3G82A 1FKOB 5KOXA 3H90A 5BYSA 2KM8B 2QL9B 2YBVA 1ROFA 4L75A 2HEKA 3DLJA 3WZ0A 1X9MA 3KYLA 4KHMA 4GRSA 3OJUA 3ENQA 4C0HA 2DB1A 1KHVA 1BWVA 1CJTB 1VRTA 1WTFA 5KFQA 2A0FB 2R9LA 2A1BA 4LR7A 2BANB 2R2UA 1WC6A 4RX6A 2E9ZA 3WHIA 3NNHA 1JKHB 2YNFA 1LWEA 1NKCA 3RBDA 2LKZA 4HH0A 1NDPA 2G1HA 2K3IA 4NI2A 3NGSA 5KFSA 1Q7YT 1WKJA 1S7HA 4JI3J 3FFIA 2LP4A 2Q79A 1FD8A 5FJ4A 2XMAA 4WFBQ 2HS4A 3D3CJ 2ADBA 2BA9A 4Y2IA 4DS4A 1T05B 2HNYA 2ZNZA 2CJKA 2FHMA 2HHTA 3UCGA 1Y5IB 3OLBA 1VQ4S 3VR1A 3A3NB 2XSJA 4NZ7A 1G2EA 5C2CA 1M1KT 2NSBA 2VA2A 2IAJB 4B3OA 2CQBA 1PGZA 3J7YI 5F3TA 1AZSB 3NWRA 2H5EA 4DFPA 3M1VB 1FE4A 1N4LA 4I1TA 4RNFA 2HLTA 2GX8A 1XIQA 5K8OA 3RUBL 2CPFA 5DM6Q 4NASA 4UF4A 1M90T 5C5JA 4YB1P 4K7QA 1B7FA 1BD6A 4X4NA 2RDJA 3A8IA 3CNQP 2B4PA 1FFSB 2LQBA 1N6QB 1LFWA 3F41A 3GILA 4AUKA 3SCIE 2Y1LB 4G1IA 2FHOB 3EGZA 5D78A 2ZZMA 2AYEA 4YN3B 4AL6A 1SC1B 3B78A 1TUVA 4YDDB 3HLUA 1BQXA 2IYGA 3W8GA 3CC2S 5EUHA 4DBQA 2WSFC 3BPSP 3DXBA 3W62A 2EFGA 1FRKA 3TVKA 4LRDA 2GGPA 1S0NA 1M1HA 4GC6A 1NKEA 1PG5B 2MKYA 2G0IA 2HAFA 4LF9F 2YWEA 3AQPA 1S48A 4MIWA 2BE2A 1HNIA 3MPDA 3O5TB 4RW4A 5A0YA 4F26A 5C2GA 3NKYA 2XLIA 2IRYA 2IVYA 4ZPWR 4K4TA 3ZTSA 2EC2A 3C6TB 1SB6A 1H0HB 3E01B 4NLXA 3V6DB 4K4VA 1U24A 3IBCB 2GVDA 5KFAA 1G7CB 4LFCF 3R27A 1MSWD 3V81B 2GA7A 2XYPB 1Y11A 2HVZA 2HG4A 3VGUA 4DR6F 1WC0A 4CH0S 3EZOA 3H2VE 3QQCD 3ZXWA 2C3UA 3FSXA 1S6PB 1CJUA 3UNYA 2AJFE 1GXLA 4NRTA 3DGVA 4NCGB 2WBRA 3I6PA 2ZOGA 5HQMA 2FJBB 4Y0FA 2GJ2A 3CT9A 1X4DA 3K57A 2YWWA 3CGIA 2H4WB 4Q45A 3KG1A 4I68A 5D0GA 4G1QA 1HI0P 2LECA 1E6VA 5DJBA 4ZCIA 2J9CA 1UWBB 2VPWB 3IC1A 1RBAA 2KJWA 3MFIA 3W5YA 2AP6A 4Q0BB 1S1WB 3LO3A 2ASJA 1Z4UA 2GO9A 4HEA9 1WJ9A 2HGLA 2JC0A 2DO4A 2Y0SD 4RW6A 4OHWA 4DQSA 1RTHA 2CFXA 5KFFA 3HT3A 2B9EA 3KNAA 1U02A 3R9LA 4ES2A 3D6HB 2V2QA 1XMQF 3BGLA 1RT3B 3CCVS 3NGRA 2DIUA 4OLOA 1ZM9A 2W9BA 1RWVB 4UUXA 4B9NA 2G9OA 2PA3A 2K7KA 1LXNA 2RKIB 3I82A 5F8NA 1OSDA 4MK8A 4CTAA 2I6WA 1NU4A 1IQZA 5L1LA 3DLEB 1YRXA 4P72A 4CM2A 4KPYA 1OQ6A 2MQQA 2BZ2A 1R7IA 1SKWA 4GVLA 4PYDA 3TAQA 2VFRA 3D6TB 3MR5A 1FDAA 2P9EA 1JIHA 4NLSA 4Y28C 3C19A 5GMDA 5JJBA 3PO5A 3C8YA 2FJEB 2DXFA 1PJ5A 2E9RX 4A4JA 2H1YA 4FYXB 4RW9B 3QLHA 2QJ3A 2VQEF 1I51B 3H59A 3MTJA 4P74A 4DPUA 2HRYA 3VALA 4N5SA 1T03B 4IQMA 1HLWA 1GMUA 2EG1A 4KGZB 2ILZA 2EKNA 3LQVA 3GIIA 2VH7A 1N33F 3PX4A 4MYTA 1YWXA 2CQ0A 2ERRA 4OYMA 4HKQA 4WU2A 1X5TA 3M8SA 4IDKB 4ECWA 2CQGA 4MAKA 4P2SA 3R6GB 5CYQB 1TUWA 4I2QB 3QT6A 1YJRA 3KJVB 1UJ4A 2YH1A 4X4OA 1WF1A 2AMCB 2VG6A 2PFFB 1K1SA 3FK4A 3QT8A 1NJWA 1LK5A 4I69A 4DEZA 1EX8A 1Y00A 1NLKL 4DR4F 4DN0A 4F8RA 3GE9A 2EFVA 2C42A 1YJVA 3S7RA 3MEEB 3LANA 1X31C 2UXBJ 2GMLA 1VQLS 1UP1A 4KV8A 4IH6A 5HBMB 3H42A 2AX1A 1S5ZA 3C16A 3A4TA 4JV5F 1ZS6A 1RCXB 4WXWA 3GV5B 1AT1B 1FXLA 3H4DA 1ULRA 2KH9A 2IM3A 3HT0A 4BDPA 4U7UK 1IKXA 2FZCB 2WVFA 3TR5A 4L76A 1KVIA 1Q7LB 5D77A 5IQQA 4NL5A 3OFFA 3RBZA 1SL2A 3MMCB 2CPIA 4NMLA 3MM5B 3TP2A 4M5DA 3T5LA 3BQ0A 2IBKA 1CS4B 4ICLA 2MKJA 2NCKL 4ECTA 3W5ZA 2X3DA 3FMWA 3I9ZA 3IMQJ 5G0RA 2RRNA 4OI0A 1NZAA 3KLEA 4PXEA 2ZNYA 4WXOA 1WEYA 4CO5A 1PILA 4OI1A 3TUPA 2GVZB 3PY8A 3L09A 1NEEA 5FLXU 2ZUAA 5E3PA 2MKHA 1CBKA 1D9AA 4DV7F 2JOQA 1WEZA 3DHWC 1T3NA 5CYMA 1U7LA 3OSPA 4OZ2A 2J7UA 5KFMA 1N5TA 4C9DA 3NEKA 2RF2A 4DPYA 3HMJG 3U27A 2ASYA 1F60B 5JXSA 3UCZP 3QJJA 4DQQA 1RAFB 1CEZA 4NX9A 3IRXB 2J7KA 3V6HA 3M9NB 4HI1A 2HWIA 2RRAA 4C4WA 2H5JB 3TUJC 4JI8J 2AWZA 3EVOA 3CEDA 2R7XA 2CUYA 4NYOA 1J5EF 4IG3A 1U25A 1B99A 4OYAA 1R8CA 3T5HA 5EX0A 2NYHA 3OD2A 4I64A 4KGXB 3TO8A 2I5JA 3PKMA 3EZ5A 4JI6J 2IVMA 1VMBA 1R6VA 3OTDA 3I0RB 2B4UA 4FBTA 1IKWB 2CVEA 1VRUA 1U49A 2XLJA 1N88A 2V8DA 4YOEA 4TN2A 3NOGA 1SC3B 3T5JA 4FF4A 1S10A 3QBCA 4IO1A 4OL8A 1B70B 3UCUP 1SJ3P 2UUBF 3QPIA 1ZM4A 1IR2A 1HQEA 3AXKA 3OL8A 3RW7A 3OHAA 2UVVA 2YY3A 2AF6A 3R2DJ 2O66A 1SCJB 1MG7A 2WHOA 1Q53A 1D1UA 1RTDA 4X65F 1YIJS 3I32A 1GT8A 3H2UB 1A0OB 3BEGB 3GJRB 2HBQB 5DZ6A 1RT4A 5E3CA 4X62J 3NL0A 4QIFA 3JTNA 1LW2A 2CDRB 4LIWA 3DM2A 1FJ7A 1M0SA 4KC5A 4Q43A 4LF2A 1N0VC 2LFVA 1ZM3A 2EK6A 2ZH1A 3PFEA 1M5PC 2CKWA 5D0EA 4ED6A 1IWAA 3W66A 3MM9A 3A1YG 1BWEA 1ZYQA 1VRTB 4MT1A 3TZZA 5FLXY 5CZVA 1HHSA 4WK1A 2B0GA 1MMDA 1RTJA 3QIPB 4P75A 3D1QA 3PW2A 2YNFB 1GAOA 1T95A 1SBRA 3K7RA 3C15B 2RB7A 2ZDPA 3R7NB 2C2NA 2YTCA 1OQ3A 3W2WA 3EE3A 3ITHA 4DR2F 4KR0B 4G6VB 5F8HA 3FFIB 2BW7A 3CMAS 2D74B 4I67A 2K2PA 1DQ8A 5C25B 4DL4A 1S59A 2HNYB 4J9QA 2WK4A 1ELOA 4OHZA 1NUEA 3ZZOA 4DR7J 1X4BA 4ZVFA 4XTTA 3MD1A 4W90B 1RJJA 4DV5F 1VI7A 2ABYA 3FBBA 1RA6A 4B3OB 2DGTA 4M5LA 4RR5A 2AZ1A 4DSIA 1IN0A 2DY9A 5KOWA 1RWNB 3M8ZA 4PPZA 4NA2A 4U8YA 5AXNA 4GKJF 1QTNB 4MKBA 4CLYA 2OAUA 2HVEA 1M1GA 3HP6A 2AJ1A 3MR3A 4F4KA 4C98A 1TL1A 3PV8A 2KT3A 4OX7A 4A8OA 5IT0A 1K1QA 1X9SA 4O4RA 4ED7A 1ZA1B 1IR1A 5KTQA 4PQUA 2KT2A 4O0IA 3D3BJ 1IR0A 4LF6F 2E9TA 4KAIA 2PI5A 1C1BB 2ALYB 5FIIA 4A47A 3GONA 2C22A 3DMJA 3HVTA 1D09B 4MTPA 1TVRB 2VG5A 2MLZA 4X4QA 2BKOA 2CJYB 4LQ9A 2QLBB 3Q24A 4FYYB 1KTQA 1TL3B 3J81j 4LSLA 4K5SA 5HVHA 4DL6A 3CDWA 2ACMA 1RKJA 2Y1JA 1NM2A 3P5TL 4F0KA 4M5KA 3N9UC 3KLHB 2BR0A 3KK2A 5ETQA 5AXMA 3D6FB 1UAWA 1XNRF 1JLQA 4WIIA 4LSNA 4PWDA 2OMLA 1TKXA 2ZWOA 2J9EA 2DISA 3TJ9A 4KFBB 5F3ZA 3B8HA 4LFAJ 9RUBA 1YJ7A 6FDRA 1UVKA 5ETOA 1NAQA 3JSBA 1R27B 3M6WA 4H4KA 1AW0A 1PJ6A 2GVDB 3HI9A 4ZLNA 2CQCA 4S0MA 4IFYA 4FS2A 4WBFA 1QY7A 4DV4J 4DR3F 1HBNB 5KFKA 4ECUA 1B7YB 4LRCA 1G3OA 4JYAJ 2G1DA 2XWYA 2WZ1A 3MMBB 2DNOA 2JDJA 2ZWPA 1CJUB 1P6TA 3D67A 5HP1A 4WJBA 5D6GA 1RT6B 1P9YA 1GTEA 1YI2S 1WHVA 4CLUA 4NLUA 4C0OC 5IM0B 4ILMA 4A8YA 2KG1A 2XZDB 1T11A 4F25A 2PMWA 3CD7A 1R8PA 4PPDA 2LXUA 3K17A 1WF0A 1WUUA 1WHXA 2RQMA 2K8GA 3CULA 3HF5A 1I5OB 4U8VA 1RGVA 1HIYA 1X7VA 4K8RA 4N77A 4USWA 3I4PA 2OEJA 2QMUB 1VQ9S 3IA0A 2UUCF 2HK3A 1U0HA 4ES1A 5L38A 2F5GA 2H51B 2U2FA 4Y34A 4QYRA 1HL6A 2LDYA 3W9JA 2VHGA 1RLCL 3CJ2A 1GMWA 2KXHA 2UUAF 2R2TA 1KS2A 3WIUA 3PACA 1D9FA 3HULA 3DOKB 3CIZA 2W25A 1SH2A 2EFNA 1RHQB 3TAMB 1JJHA 2ZH7A 3OBIA 2JEJA 2DBBA 1XERA 3BH6B 4NYPA 3HHKA 1YVFA 3QLHB 2ZBRA 1L3VA 3FUYA 1HR0F 2OO4A 4Z2XA 4EEYA 2JEFA 2XS2A 2QTWA 3HX9A 3H8YA 4KQZA 5A8KB 5J2MB 2V8PA 3OPKA 4YY3F 2MGZA 4ZKAA 1Y5LB 2PN6A 4WCEQ 1TKDA 2HQDA 3Q8RB 2SXLA 1C1CB 2NXNA 1F1BB 1N34J 1JLBB 3CCES 1DJ0A 2R4FA 3IM9A 1X4HA 1VISA 2XS7A 3QIDA 3KLIA 5FDLA 3W2VA 2ZH9A 1Q8IA 1W26A 3ILJA 1FK9B 2C1EB 1Y3JA 2BJDA 2AW0A 2ZHOA 3J81Y 1H2TZ 2VG6B 1ZPWX 3E51A 1Z2ZA 2ROEA 5DG8A 4K2JA 4ALZA 4ECQA 5E2QA 4ECXA 1RBOB 1PYOB 1RTIA 3U7JA 3PYGA 4KH0B 3RYLA 2HS0A 1HI8A 1EP4A 1YJNS 5HLFB 1MN9A 2QL7B 4TY9A 3M6VA 4Y00A 3UD4P 3CD6S 1QTMA 3MECA 3JAMY 4B9VA 1NCLA 4CIOA 3NCQA 3OSNA 1HNXJ 1SC6A 2GFFA 1VLOA 4K2XA 4LF4F 3OR2A 3J80U 2POKA 4PWUA 2JRSA 3AXMA 3JYTA 3J7AN 2J6TA 2J6SA 3BKUA 3D0HE 1IKXB 2LA4A 1S77D 4B9LA 2ZJQQ 2X7IA 5T41A 1MWYA 3BGOP 1CJVA 2HQ3A 3R3TA 4DV2F 4RO0A 3P96A 4ZLJA 1KBRA 1SPBP 3Q8SB 5EDWA 2LEPA 3LP1B 3VV2B 1S79A 1H2VZ 1VIOA 4J90A 2HQFA 5KFJA 1S9FA 3OL6A 2LXFA 4K4SA 2W2PP 4IOAQ 4LIRA 1JXEA 4ZK7M 1WORA 4V1Ak 3CCSS 4ICLB 2WVDA 5E7OB 3BBBA 2DNRA 4DG1B 3HKZD 1JXVA 1REVA 5HN0A 2GJFA 3C6UB 4DXLA 3IAS9 4FNHA 4DR1F 4ZCKA 2GNKA 5IZHA 4CH7A 3KHGA 4QIEA 4JI5J 1RWUA 3BGFA 1VBXA 1XTZA 3ZZTA 1E6YA 2PMHA 1FCAA 1FXDA 2RF2B 5AJ3J 1LEOA 3WBZA 5K14A 3UFCX 1RAJA 1WG4A 3TOQA 5DDOC 1RT5B 1Q81T 2MZTA 2R7QA 3GR0A 5KFYA 2D3ZA 3SQOP 4OMFG 4KHPF 1QUPA 2P5VA 1PIEA 4E8UA 2FLNA 5HL7Q 2B4VA 3DU5A 2I5JB 4LFCJ 5MAOA 2KZMA 5LSOA 3NWGA 2XMUA 2Q6CA 1PYSB 2LQ9A 1VRUB 2YX7A 2W9AA 2DITA 3BZQA 4HHUA 3T9NA 2PGCA 4F2SA 3OW2R 2O01C 3UVJA 4JI0J 1X4FA 1EKRA 1NDCA 3J80Y 1HI1A 3HSZA 1Y9OA 2L9DA 5K8NA 1KQGB 5A2QU 3CXCR 1X0FA 2OFGX 4IG0A 3EUNA 3K89A 1UZHA 1DTTB 1LWXA 1I3OB 1U2CA 3CCJS 2ZZTA 2LEAA 1IVZA 5BR8J 2J9DE 4TXSA 1IM4A 4NOHA 3HHLA 1N8RT 3C3LA 4QJVA 1IBLF 1RT4B 1S1XB 3LTOA 5GAHU 2B6AB 2QZ8A 5F0UA 3BGRB 1RHUB 3KLGB 2DR8A 1KN6A 1NDLA 1YLXA 4WP3A 5CXTA 2V8HA 2FJVA 2W4CA 1N48A 2B8PA 1HW8A 2I38A 3BREA 2ZOMA 2NZCA 4BCAA 5GAHI 4Q7AA 4CRJA 2IJNA 1JJCB 3MCOA 3OTOF 4M8LA 1RTJB 1HW9A 4HDHA 3DGPA 1TZ0A 4KKOA 1NSQA 3SIPB 1NBEB 2YWGA 2HBRB 4OX9J 2XO6A 3VAIA 4WP8A 2RS2A 2OEMA 2L41A 1HHQA 2DNNA 1EKSA 4JBCA 3KLVA 3DDIA 5B0FA 2E66A 1SXLA 2VQEJ 4LVOP 4O3OA 1JK9B 4EFAC 1IKVA 2FYXA 4KGKA 1SKSA 3OT9A 4KBIA 2H54B 3IRWP 3GB0A 5LXRA 3PEHA 1N33J 3FRYA 1N0UA 4WTYA 4N76A 2JX2A 2DEJA 5A8WB 3K8VA 3KG4A 2XMKA 4UY8T 3K8WA 3H5SA 3DRYA 4HHHA 1WOPA 2M8HA 3EVMA 3P4UB 2PA8D 2YXLA 2FJXA 3G8SA 4XDCA 5K8MA 3CCLS 1T8EA 5HMYA 1GXTA 1GQEA 3M2VB 2KI2A 3NP5A 3JSMA 3NAHA 2JEGA 3PFOA 4C11B 1ZBTA 2E7XA 2VQFF 2WOMA 3LP0A 3PX0A 2DR7A 2LLZA 1TL1B 5E3AA 4DR4J 1U8WA 1WKKA 2VG7B 4ZP7A 1CJKA 2IYIA 3QGHA 5D3GB 1YX2A 1NB2A 4PQUB 4XAKA 2OI2A 4X4PA 3M4XA 3LALA 3IS9B 4OHXA 2FVQA 4NRUA 3B4DA 2MJUA 3GG1A 2ZJRQ 1APSA 1MU2A 4KRWA 1ZZNA 3HVTB 4U67Q 1TKTA 3RTVA 4B9MA 2VONA 2RH3A 1N5SA 3ELHA 2R7TA 1WC3A 4X4SA 2HHHF 2QRRA 2PI4A 3N01A 4GKKF 2ZH8A 3EGNA 2Z56B 5IC6B 2HLUA 4YHHJ 2DHGA 4QR2A 2KTQA 5LJ5Y 2PSZA 3GCXP 4O4GB 1TKXB 1SJQA 1KC8T 3G6ES 4DQIA 3RBXA 5I4MA 5E41A 5CZXA 5K20B 2IC3B 3FQKA 4RW7B 3MR2A 1ZTWA 2IM1A 4CP5A 3RRHA 2QFJA 4V19J 5IT9U 5HJYA 4DUTA 3M8PA 4ED2A 4QYZK 4R5PA 1NSPA 2E44A 3LOUA 5MLCV 4KGVB 2JLGA 4C8NA 1WDDA 1HBOA 2AKWB 2DEIA 2WRMA 2CPZA 2HZAA 2Z0GA 2V63A 5KT4A 3OL7A 1MNEA 1LNQA 2ASLA 4JP8A 3ISND 2E1RA 5B0GA 2BBEA 4F0MA 1XMOF 4HH1A 4R0JA 4B3RF 2J0SD 5DQGA 2J8SA 1U48A 4A8SA 2JC1A 4J9UE 1HPZB 2W7PA 3MWBA 3M6XA 5KFZA 3MR7A 5KT6A 1CJTA 4F7VA 2J9DA 5JVGQ 1U47A 4USUA 4EZ6A 1WG1A 3KJNB 1X4AA 2MQMA 2BANA 3OV7A 3LWMA 4DHVA 2QC3A 2NPFA 4J9KA 3Q8PB 4DUYF 1HNVA 1HBUA 3M8RA 1ZA2B 1S72S 1U0HB 5SZTA 2ZH5A 1OY8A 3D54A 3TA1A 3D66A 3RB6A 2JFKA 3C2PA 2Q66A 1T05A 4DPWA 2CNNB 2YKAA 3BPDA 4FN5A 4EO6A 2ZC3A 3QAEA 2A6MA 1RDRA 4TYAA 1K8AT 1ZETA 5KT2A 2UUBJ 2YQ1A 3CDEA 5IOLA 3KLFA 2FUG9 2JH3A 1QSYA 1S4FA 1AZSA 2YPYA 3NOCA 4DSFA 3M1VA 2F9JA 4NXNF 2IA0A 1H38A 4X65J 3KXDA 1QM9A 3O2IA 1KR4A 1WOSA 2VD3A 5L1KA 4QIGA 4B3MF 4AQYF 2MGZB 3FMBA 2JHEA 1N52B 4QR1A 4MMOA 2NSCA 5FD1A 1KRPA 3KLIB 5U47A 2OH2A 1NH7A 1RP5A 1RAHB 2QT7A 4J5OA 1N6QA 1BMQB 1RE1B 2RT3A 3FBEA 2C2RA 1YKWA 4P10A 4YEAA 4PKDB 1G1XA 4MIBA 4RJVA 1RWXB 3TUZC 4TKTA 1R8AA 1KVKA 1N5YB 2QLFB 2Q3PA 1BQNB 3HJVA 4OZJA 3NS7B 5A8RB 5ETVA 1UMJA 1TKZB 5J2QB 2BJEA 2DRBA 3MGJA 1D8ZA 1X60A 3HHDA 1SL1A 2C3MA 3JQKA 4WPAA 1H6KX 3CCRS 1VHIA 5C24A 3GCWP 1EP4B 4IH7A 1UFLA 1JLFA 1R3NA 2V2ZA 4CCHA 1KSPA 4DU8A 2XYHB 1TK5A 1T9VA 3GZ7A 4F4WA 3M2UB 3SMZA 4AXIA 1VC6A 4O3RA 1YRUA 2HFVA 2ALZA 2Y8WA 5KFEA 2XWXA 1ZAWA 1R0BG 3C6TA 2HRUA 3V6DA 3MCSA 2D3O1 2MYFA 1I6JA 4DV5J 4J9SA 3NXZA 1VJQA 3LUYA 1YHQS 2V2VA 3V81A 3N6LA 4WZMA 3ZZ0A 2KJVA 4IH5A 7AT1B 3UDEA 3FCWA 1SKRA 1T9UA 3E8OA 4X64J 4MYUA 1U1NA 5F8JA 2KFZA 4KHRA 3UNGC 4JUZA 3KHLA 5ITHA 3HDSA 2J0QD 5L1JA 3ZTQA 5DQIA 1FRXA 3ZZUA 3OUYA 3PYDA 4ZP9A 3V2UC 4UY85 1KLMB 3U02A 3CD5A 5BYQA 2YNGB 1GFWB 2IDLA 1SI9A 4RUBA 4FYVB 4OYOA 1S1WA 1P8GA 2LU2A 4WFXA 1NJYA 4ANEA 2RD5C 5HO4A 4RNMA 2CYYA 1NK7A 1HD0A 4WP9A 1R8HA 3SCLE 4ZIWA 1VLYA 4NE9C 1Q79A 2HHUA 1RT3A 1F2GA 3Q8UA 1QVGR 1XEZA 3CJ5A 2RKIA 1XNRJ 3HKWA 1ITPA 1DHMA 3DLEA 1HA1A 2DNQA 4NMXA 3DI6A 4NLPA 4MKAA 2NREA 2L48A 2EFQA 3TA2A 4ENOA 4LT6A 3PDNA 1FWKA 3KTQA 2EC0A 5KFUA 1QVFR 2HFOA 2LMIA 3NG8A 1RQ0A 4F04B 4DR3J 2FHJA 4RW9A 4BHQA 3MUVP 1WTBA 3R7SB 3HSDA 2VV5A 3G96A 3OL9A 3GYXB 3MMAB 3ET6A 4USJC 3G6XA 1T03A 1Y4ZB 4ZVGA 4QIVA 2O67A 3U1LA 4QWBA 2AV5A 1HHTP 4CH1A 1GNKA 1Q95G 4NPOA 5DS7A 3LF0A 4YUDA 4FYDA 3CW2C 2DPIA 3KFWX 4KO0A 2PEBA 3T9ZA 2XGQA 4IDKA 1IQTA 2DNKA 1A6LA 3PW4A 5HI7A 1Z1ZA 5CYQA 4K4WA 5ETTA 5GVQA 2AGQA 4I2QA 2GIFA 4I56A 4WE1B 4AL5A 3KJVA 4DL5A 3B4MA 1IJEB 2DNZA 2GMJA 2N7CA 4UZCA 2G0JA 4DSLA 4M94A 3FQLA 2VASA 4QZVB 4J9LA 2QLWA 3THVA 5RUBA 3PO4A 2H48B 4WIQA 1JLAA 2BRLA 5F8LA 4WTOB 2P2CB 4DFJA 3MEGB 2KL8A 2DHSA 1N36F 2CNLB 3MEEA 5DDQC 2MMYA 1Y0HA 4DV6F 4DWIA 2K06A 2MEWA 1S99A 3ETOA 4N7TA 4USIA 1BXNA 2E5GA 4K0KJ 3GFXA 1KP6A 4TQRA 1Q8BA 3VQTA 1R6YA 3HHLD 5B0BA 3HPOA 3LA0A 2CXEA 4F3MA 3DGPB 3PW5A 4RBTA 1J27A 1VRQC 2APOA 2RUSA 4PYAA 4IOBA 1AFJA 2F65A 2OD4A 3HD1A 2HIQA 2RNEA 2O1PA 4CWBA 3KK1B 1HR0J 4A46A 2X3GA 4DCJB 3CCMS 3IG1A 4H4MA 3MMCA 4DSJA 1IKVB 2CNOB 2J76E 3IO1A 4NZ6A 2IIHA 3OTBA 3VTIA 4LF5F 4USVA 2PC6A 2WVBA 1CS4A 2E1CA 1C2PA 3L95X 1FI4A 5DO2A 5HQLA 1M5HA 3J7ZT 4ECSA 1TL4A 4I7FA 2EG2A 3RR8A 4L74A 4K5RA 1HNWF 2OGUA 4RUAA 2GVZA 3SV3A 2V9WA 3JSMB 4M1KA 3TI0A 3DLGA 2AYBA 1XBWA 2MKSA 3BN7A 2G13A 3JQJA 3PHTA 2HGNA 3PYFA 3TZXA 2OELA 4B9SA 2LVWA 4JI1F 2ZKTA 4U96A 1ICEB 4LBIA 2EBEA 3FRZA 1W2BR 1S57A 2DRAA 2VL1A 2W7OA 1RZMA 3MEKA 4X84A 5CD4H 1U0SA 2IPOB 4LF4J 4Z37A 3FJ2A 1K0VA 2WSEC 1WC1A 2DR6A 2V8GA 4PR6A 5IFMA 3OFHA 1OY9A 3BQ2A 2E7WA 3A8JA 3AA9A 3B82A 4OJ1A 3T3FA 2R7UA 4MK9A 3I0RA 4DV2J 1CQMA 5KG6A 5KFWA 2VDIA 4DV1J 4H4OB 1O6XA 4LMZA 3S8SA 3KJFB 4OYPA 1RAAB 4OZ0A 4FVMA 2VBZA 1UFKA 3ONQA 5L46A 4QYZJ 2VJVA 3MD3A 3VCDA 5KFDA 5KFTA 1SJ1A 4BWMA 3OHBA 3D7SB 4IQXA 2RILA 2GC8A 2RJZA 2R7WA 2HNDB 4R5PB 5LOQA 5D0RA 3RRKA 1LWFA 1NK0A 2ZE2A 1K9MT 2HNZB 1PSDA 4AXJA 4CLTA 2N7YA 4DR1J 5M2UA 2BM0A 2P8IA 4D3GA 1FERA 3ISZA 3HSJA 1P27B 2R7RA 1H3DA 4TLQA 3CDAA 2X1FA 4C8KA 3TVYA 4Y2MA 3LGMA 3CB4A 4U95A 4ZN3A 2FIUA 5CABA 2J0XA 4ZVOB 4DR5F 3VVTA 2ZH2A 5KFRA 3EJMA 4UOHA 2W9CA 2BV3A 3D5MA 3CJKB 3QAUA 3CMES 4JI4F 4RU9A 4EBCA 4ZVQB 2Y9HA 1REGX 3C66A 4ZPBA 3QIPA 2OLWA 4GO7X 2F8EX 3HHNB 1GMVA 4ZPCA 2HKEA 3AD7C 3H2LA 2VODA 2CNKB 1M5SA 1HNVB 1F6TA 3C15A 1LWCB 2ZBCA 1HBUB 4MH8A 2C3PA 3MM6B 4X2BA 2ATLA 3ZC4A 3SDEB 4OV6A 1NHVA 3NY0A 1JJ2R 1YBUA 5C25A 1K73T 1VS3A 2K1RB 2HHVA 1U45A 3R5BA 1ACMB 3PYEA 2BKPA 2HWHA 5DLGA 2WTFA 3D0IE 3F56A 4AFFA 2BXJA 2I1RA 3AOCA 2V2KA 5T14A 3KLFB 1VK3A 1FFWB 4AYBD 4DQRA 3TNVA 3MCMA 4DCOB 5B0AA 3KHHA 1FEEA 3AD8C 3ZO7A 4RLEA 1WEXA 3AB4B 1UJ6A 2ZOFA 1R43A 3DNCA 1FTRA 1IBLJ 3RW6A 1KDNA 2JL9A 1PC5A 2KFYA 4DPXA 2YKMA 2RRBA 3N4WA 4EBDA 3CJQA 4CNZA 4Q44A 3FNNA 2IA6A 1WSRA 4QWDA 2ZUGA 4DF8A 2NQPA 1C1BA 2N4CA 1X8DA 4DL7A 2RS8A 3NCPA 3DLKB 5THWA 3N6MA 5CD4A 1EQMA 1NSAA 1TVRA 1S1TB 4M5IA 2JFDA 3KHRA 3OTOJ 1UFWA 4F50A 3BN4A 2C2OB 4FKYA 4PXBA 1TL3A 3K5LA 2QL5B 3K58A 1S1VA 2LQ5A 3UQSA 4A8QA 2QLJB 2ACYA 4RNHA 5C24B 2W2NP 1VQ6S 1WC5A 2G0CA 2EKYA 3KLHA 2PE8A 4URGA 1OIAA 1JLFB 1KOHA 2MPUA 1PAEX 3QRQA 4DMZA 2HMIB 1RHMB 4DS5A 2VZ9A 3VAHA 4CNYA 4KFBA 1JLGA 2ATCB 1VIXA 1W2IA 1IBKF 1S97A 4OJHA 4QW9A 3UWTA 1FJCA 2NXJA 3FGVA 4OHYA 2FJDB 3SSSA 5LT5A 2KU7A 1U8SA 3NLCA 1HBNA 2RE1A 4PG4A 2KZZA 4A8XA 3K0JA 2YKOA 4DLEA 4J91A 3J7A1 2F4VJ 2FVPA 3MMBA 1U1RA 4ZVPB 1RT6A 3R5DA 1OMSA 3SFGA 1WACA 2LQJA 3R5AA 5JUMA 2YX1A 1OS5A 3QWUA 5IM0A 4QIWD 3I4HX 1CPZA 2HFNA 3OUYB 4HDGA 1IKYB 1NK8A 1L3SA 2YPZA 2Z8QA 3J7Z5 3RR7A 3TZYA 3M9OB 1HFEL 2CQ2A 5M2PA 2AJ4A 3CJ0A 4M95A 1CC8A 3GSDA 4GMKA 3BDEA 4Y6IA 3R2CJ 2ZVIA 4CO2A 1RISA 1WF2A 2YWKA 1TAQA 5I3QA 2HHSA 3W60A 4AL7A 3R5GA 2MQNA 4ZP8A 1DARA 2OUGA 3I56S 1DTQA 2ZBQA 4YFUA 3GJQB 4RBVA 4MKVA 3M05A 4O3NA 1KQSR 3TJ8A 3MM7A 1HWKA 4IR1A 2C2ZB 3AFGA 1Y3KA 2CQDA 2HVIA 2GCFA 3DI6B 5KAKA 2AD9A 3DOKA 2UXDF 3SSQA 3CO0P 2CDQA 5IQ6A 3MFHA 5D0HA 1P9QC 1Q82T 5CCMA 4CLZA 2GMHA 2AZ3A 2ZFHA 3TAMA 2UU9F 4BBYA 4P7TA 3K5NA 3R97A 4NA3A 3W9HA 4DX6A 2DHAA 2MSSA 3QNWB 2CWXA 2DVIA 2RMLA 2DR9A 4YR3A 2IM0A 5A8KA 2R42A 3ET6B 4CM0A 1NHUA 5J2MA 4WZQA 3G8QA 2D3OR 2E5LJ 4KTQA 4NA1A 1UKUA 1U1OA 2BACA 5C42A 3KDNA 4OZ3A 1Z2LA 1C1CA 2K3KA 4KO0B 1JLBA 1RHJB 3G86A 3MCNA 2BE7D 2VOOA 1LW0B 1HQUA 3BH7B 1FK9A 3QFWA 3QT5A 1Y10A 3G6YA 3A12A 2FHJD 2MSTA 5J1PA 3IXQA 2B56A 1YBAA 4KE5A 3LPYA 1T9TA 1IXKA 2G2YA 4F4XA 1HBMB 1I1GA 3Q22A 2GIQA 5KFGA 3W8PA 4JI8F 2CJBA 1JLAB 4PG8A 3QZ8A 1RK8A 3V6JA 4ITSA 3T5KA 5LL6d 1R31A 2JVRA 1FDBA 3KWMA 3BKFA 4DUYJ 2IMOA 2MHNA 1J5OB 2VOPA 5HLFA 1RYSA 5L9NA 3RAMA 1JLCB 4JI6F 2AHOB 5HMWA 1VJWA 5AE2A 3I96A 2O5DA 2V50A 3D1HA 4DV0F 4DSEA 3W3SA 3QFHA 5IV3A 4O3QA 1UEVA 1V3RA 3PM9A 2L3MA 3UW1A 1NK6A 4UW2A 4RNOA 4G65A 2HFUA 2XULA 1RKIA 4ECVA 1S1UB 1VOMA 1RLDA 2GV1A 3LP1A 4F4YA 1P1TA 3I87A 5SUHA 2OPSB 2F9DA 4MIAA 3IG1B 4H4MB 2W01A 4PQAA 5AE1A 1EQ0A 2KYZA 2BKNA 5HATA 2JWNA 2B5JA 3KOAA 1B0VA 1FKPB 4AQYJ 1TL5A 5H9FK 2BJ1A 2JEIA 3G4SS 3KJQB 1Q78A 4IUFA 3C14B 4W92B 3UE2A 1AA1B 1S0VA 2JJ4D 2KXFA 3QRRA 3ZTOA 3P8BB 4I7FB 2AIRB 4DG1A 5IXUA 3M30B 4Y2KA 3WDOA 2BM1A 3C6UA 4ERDA 3ZNUA 1U1KA 1JNZB 4YR2A 1VYAA 5C7PA 4ZJLA 4EWTA 5KFNA 4LJMA 3PVXA 2W2MP 3DLGB 3D9BA 4W98A 4DL2A 5E33A 3CMQA 4F02A 4NXMJ 1Q1KA 1L3KA 2UP1A 3L9ZA 4K50A 5G4DA 4OYBA 1H2UX 2VU5A 3BYPA 5HMZA 3BBCA 1RT5A 6FD1A 3BDPA 3GR1A 4EYHB 2GQCA 1FHTA 3LAKA 4XO0A 1R0AB 3KDOA 5IWAF 4EI2A 2RQ4A 4LRBA 5EWFA 1YITS 4DI6A 3G87A 1RXOB 5E3QA 1Q86T 2KRRA 1XK8A 3BQ1A 5EN1A 4WF9Q 4XIUA 1NKBA 3T41A 5LMNJ 1HQ2A 2BMBA 1EHWA 3RB4A 4OJGA 5EHHA 1H72C 2B3TB 5L9XA 1YBTA 2Y0BB 3EGVA 2EXUA 3W64A 1N32F 3BS9A 2HAIA 5EWGA 1UETA 2EPIA 1MLAA 2XCAA 3U1NA 4LR8A 2BQUA 3MOZA 2CPXA 1FDNA 1QJHA 4OX8A 4PUOB 1V3ZA 4ZVTB 1KFDA 2XS5A 2U1AA 3IWNC 1JNRB 2XB2D 3ILLA 4F4AA 2FLLA 5CHCB 1UVJA 4ETZA 3SYZA 4ED0A 4LBHA 1T9XA 1DTTA 2ZH4A 3CJSA 4OJ3A 4JI7J 1S6QA 4J9OA 3S1TA 1LWFB 1S76D 2I9SA 2ZE2B 1FWLA 3JSYA 2RIJA 1S1XA 2B6AA 1RHKB 4USMA 2GIRA 2NXUA 3BGRA 4ILRA 3KLGA 2BEFA 2OPPB 4OYWA 4QR0A 2DHXA 3E2EA 3CCUS 2VPZB 7FD1A 2W9CB 4LRAA 2KT5A 2P9GA 1U2FA 2CWKA 2DPJA 1SH0A 2Y1RI 4XPCA 5ETPA 4DUZJ 1NZ8A 2N82B 2KN4A 2B8QA 2YX4A 1B0PA 3ZTRA 1FVSA 1RHRB 1Q8LA 3CF5Q 3HM9A 1C0TA 3R1LA 4LFAF 3T1YJ 1KQFB 3RAXA 3ENVA 3D0GE 1R0CB 2FC9A 2RU3A 1L3UA 2FVSA 3TYTA 3TW0A 2FVRA 5KG3A 2RSQA 3IR6B 2Q6BA 4MFBB 4RNNA 4A8FA 4MJKA 2W1BA 5LSLA 4PG6A 4C7QA 1RT1A 4M5GA 1GEHA 3CJRA 1C4AA 1LK7A 3S6EA 3WX8A 3PR4A 4QPTA 1K44A 1MROB 1YG0A 2MZQA 3NS5A 5A8WA 1FF2A 3CCQS 2XMWA 3IAM9 2NR0A 3DKDA 2GHVC 4TY8B 3UN5A 5LXYA 2OPRB 2H3EB 4L3KA 2VKRA 4WFZA 2HQIA 3H5UA 3DRRB 5ETLA 5HQ8A 3GU0A 3GMGA 2FGOA 2EI5A 3M2VA 2M3DA 2XI3A 3CUNA 1VBKA 4C11A 4I0WA 2ROGA 2VIHA 1NPRA 4P52A 2DT9A 2QN6B 2VG7A 4IO9Q 4CYUA 2YQ0A 1MMLA 1IWGA 2YKMB 3G8TA 5D3GA 4YDXA 3QSYB 1S0OA 4K4UA 5F0WA 4X4TA 2LXIA 2Z58B 3AQOA 1N36J 4ZHRB 1UZDA 1CG2A 3IS9A 3UO0A 4L73A 1NMEB 3IR5B 3MZIA 2BOPA 4XDDA 2CQPA 3TAPA 3MPUB 5B0DA 2XMMA 1DBDA 2CJAA 3GIJA 2HS3A 1KNZA 2BDPA 4QBUA 3PJ9A 3MI7X 4FZVA 4ZLPA 3T1HJ 3KKFA 4RKUC 2RQCA 1ZZFA 1I94J 1S1VB 3NGTA 1SL0A 4ID8A 2YVSA 4P2MA 4USKA 3A3OB 3IFEA 4QWEA 3FC9A 2VFUA 4BC9A 3BF4A 2EEYA 4X4UA 3IP0A 4O4GA 3R1HA 4IRDA 1SQFA 3IGVA 3WC0A 1SJRA 4JI2J 1DLOB 2EK1A 3N79A 1JLGB 4ZVUB 5HK4A 1F0XA 3DRPA 3VWSA 2VICA 1WI8A 3AD9C 1K0TA 4LF5J 1RAEB 2IC3A 1YRTA 4RW7A 3DRSB 2QEXS 4RW8B 1HNZF 2E1PA 1N34F 1OPZA 2ZEJA 3SCJE 2XCPA 3LWLA 2GS8A 3M2RA 3FCHA 1HNWJ 1DY3A 2X1GA 1YDLA 4K59A 2CAJA 1T3OA 4WWSA 5DRKA 2GQQA 3FSYA 2COLA 1RADB 5KFLA 4OZNA 4IFVB 2VFTA 4ID5B 3KG0A 1TMMA 3AA8A 8RUCA 1RYRA 1FA0A 4JI1J 2CPYA 3A8KA 2JNJA 3KUEA 1Q5VA 2D69A 3PHEA 2ZITA 1OYEA 1HPZA 3L4BC 1FESA 4HVZA 2CZVC 2KHCA 4C6AA 4QWCA 1FVQA 2HIYA 3US5A 2AU0A 3O6QA 1S49A 5KFOA 1HNXF 1QAJA 3J7YU 4YQWA 3Q8VA 4KH1B 4J9MA 1VC5A 3P3DA 2NPIA 2OEKA 3BM7A 4LFBF 3H7HB 1DTQB 1UVLA 3HXMA 2QA4G 1XNQJ 4RWWA 1G4CA 3UDVA 5K8PA 3TANA 1ZAXA 3MM7B 3EXCX 5B7WA 1SQEA 1UEUA 2HSEB 4ATNA 4FF2A 2M9KA 3GV7B 3HCXA 5BXIA 5JVHQ 2DD8S 2LQ8A 1QLNA 2DCUB 5J2NA 3EWGA 2V9KA 5KFIA 5CCLA 2WW4A 5IS2A 2R7VA 4DV3F 4FDFA 1TV6A 5KFBA 2XNQA 1TL7B 4HL9A 4CLSA 4C8MA 2PFDA 1VQKS 1SJFA 1EETA 3NCRA 1UA0A 1BGXT 1TQLA 5C42B 3HVRA 4YB5A 4B3SF 2VFVA 4C8LA 2DGSA 4E2FB 1V6HA 4JB8B 2KKHA 3IWLA 1XR6A 1PC4A 4JI5F 2XY6A 3M8QA 2DNYA 5H9EK 4C3KA 1HQUB 5KFHA 4DR5J 2WCXA 1PKUA 3TEGA 2OTLS 1FJEB 5AJ3F 4CDIA 2VPYB 3KK3A 4FPRA 2F63A 2GQ2A 4JI4J 2B43A 4HTIA 1Q5YA 3BSCA 2R8IA 2C3OA 4CO0A 3DHXA 1N5YA 1FWPA 4V19X 2XI2A 1BQNA 4ZPDA 4URQU 3VAMA 5I3PA 1VR6A 2QA1A 3HO1A 3H0PA 5A8RA 1TKZA 5J2QA 3N6NA 1JLEB 3ICLA 2DIVA 4N41A 2ZBIA 2E5IA 3ZFVA 4YS2A 2FY1A 5ETNA 3MUMP 1AROP 3ILOA 1MMNA 4QOTA 4F3OA 1FEHA 1U1MA 5KFXA 2OHDA 4LVNP 3AJ2A 2CA9A 1EARA 3THPA 3M2UA 3BBFA 5DDPC 3F44A 1F5CA 2B9YA 4PXDA 2XMTA 1MW7A 3KNGA 4JI0F 2DKOB 4PEOA 3IN5A 3PW7A 4K4YA 4DOZA 4F4ZA 4R8UA 2D9OA 2YNHA 1KQKA 1SQGA 2C2KB 5H9FJ 3MURP 2UXCF 3AOBA 5CH7B 4KJIA 4CI0B 4O44A 2D7SA 3DDNA 2RQKA 1YJWS 1MWQA 1RWWB 4ZITA 1BQMB 2RDDA 2B5JB 1IBMF 4EMDA 3QGPA 1H98A 3POTB 1ZOTA 3DU6A 1W7WA 3QO9B 5BR8F 1DQ9A 4J9PA 2PEHA 5F8GA 3TQEA 3A13A 3TA0A 2J7WA 1RT7B 4RPFA 1SKUB 3EMTA 2IM2A 4FP9A 2F7VA 4UOFA 1RSCA 1KLMA 2HHWA 3OTCA 1U1LA 2YNGA 4C3MA 4F2RA 2DHHA 4ZJQA 3GJSB 4TNOA 2XMJA 2XYGB 5AXKA 4C0BA 1X4CA 1S4EA 2CG8A 2VUGA 2MHEA 5F41A 1AFIA 2RHQB 2XHWA 2F1FA 4FVCA 5F8MA 4PABA 3BSNA 1RUSA 1X0PA 4OX9F 4LF9J 2ZHBA 5KG1A 3F73A 2MTLA 2V69A 2XGPA 1RT2B 1UPPA 1R89A 1XR7A 5ADZA 4OZ1A 1PCAA 3VVUA 3RAQA 1EZZB 5I3UB 1IBKJ 4WKYA 2PD1A 1LXJA 3BO3A 3X1LB 3MEDB 3OFEA 1RWMB 5D8HB 1LFPA 2KVQE 3W1YC 3EX7B 2ZD1B 2VJUA 1TELA 2QV6A 3OQ2A 1BC6A 2B7BB 1T94A 4DR6J 2CIMA 4A8KA 2ADCA 1W25A 4KT0C 1O51A 2WBMA 2DXEA 4U7UD 2AYMA 4OI6A 2CPJA 3MMAA 2XHCA 2ZM6F 5DGAA 1R8BA 2B4OA 5GMEA 2DNMA 1XR5A 2MZRA 1UEKA 1P1LA 4B9TA 1LQ9A 4RZRA 3QT7A 2AJQA 3KUHA 1YK9A 3HHEA 2AT1B 4M5JA 2EFOA 4GVBA 3SXLA 1RABB 3NBPB 1VQOS 1NH8A 2FDNA 2EW9A 3LP2B 2AEJA 1F3VA 3AAWB 2VC1A 1S9GA 3UD5A 4WE1A 1S6QB 3B6BA 5DGBA 3BSOA 2HK2A 2VFSA 1NRKA 2ILYA 2HGMA 4JV0A 2V6AA 2I2YA 3SQGA 1URNA 1VQPS 4OQJA 3QGGA 2OFHX 4Z7YA 3MEGA 1XMQJ 2FJAB 2FC8A 3KUGA 4GO5X 2OP5A 2UV8A 5A6PA 4ZJOA 4O23A 1X4EA 2DH8A 3AOAA 3AT1B 3DLLQ 2A18A 1C4CA 3QGIA 2M70A 4YHHF 4LRFA 2KB2A 5JMNA 4L3NA 2C28A 4Q5VA 2FLOA 3SFUA 3NGDA 2A2CA 2NUUG 2H4YB 3M32B 4UZBA 2BJ9A 4KGMA 2UXDJ 1C0TB 4W4MA 1SH3A 2BW2A 2QLXA 4JV2A 2KO1A 3C46A 2D1CA 3FEYB 1HMVA 2UU9J 4EGLA 2DY1A 4ZN1A 3MPYA 4DDFA 3QRPA 3N5FA 5ETKA 3W63A 4ES3A 2C2DA 3AH6A 3W61A 2AJ2A 4M5NA 3KK1A 3CIMA 4UQTA 1OY6A 4ZVEA 4FXVA 3HJFA 1RT1B 4FXWA 4P9SA 1OPIA 3TVZA 1B64A 3CCWA 4ZMMA 2Q43A 2FLPA 1T9WA 2R8JA 2YNIA 4HACB 5HVFA 3JS9A 3Q23A 3X3UA 4ED4A 3BR9A 2N3OA 1IUJA 3DC2A 1NO8A 1NSKL 4B3TF 4PWWA 2IJFA 1YZ6A 4Y2CA 4DCPB 1VQNS 3FZ2A 5EGYA 3UR3C 4QQBA 3VZIA 4OFZA 5CQGA 2QYCA 2DO0A 4CYUB 5A2QY 3V4IA 1BUXA 3OR1A 4BS2A 3P45B 3MDFA 2DR5A 2CQ4A 5KG5A 5GAGU 2VPXB 5DG7A 3DLBA 1SUQA 4NWBA 2CQIA 1S6UA 2B51A 5F9LA 4EYIB 1OYDA 1IJFB 4JV5J 4DV0J 4ZOSA 2WVEA 4L6V3 1VFJA 2M0GB 1OJ4A 1C0UB 1JQGA 1TTHB 3HVAA 3DRXA 1FRHA 5GAGI 2KRBA 3QMQA 2RUGA 5I42B 4B02A 1YQHA 5KG0A 1TP7A 2QE5A 4DX8H 3PRBA 4P2FA 4FNIA 1RAOA 4H4OA 3AB2B 1UL3A 3BGUA 1FJGF 3FCVA 2E1AA 4AE5A 3OXLA 3DRPB 1KONA 4KSEB 4URSA 3H40A 2WVCA 2XEXA 3PXGa 4F3QA 3F0NA 2HQGA 3KMQA 3GV8B 2V4QA 4IOCQ 3G82B 2XO7A 1F5BA 2A3JA 2HNDA 1YSJA 2V5HG 1FO1A 5DM7Q 2IRXA 1T9YA 4NLRA 4ED5A 3M2RB 4WFYA 3VAKA 4BWJA 3MAAA 4CQ1A 4ZVHA 2HNZA 2E1MC 4M63A 1QDUB 4DV7J 2LA6A 4ED1A 4ED3A 1WHYA 2GZOA 2LEBA 4OZLA 3Q86A 2YKNA 1TUGB 5J1NA 1BLUA 1LWEB 3GTYX 4NLWA 2V34A 1JX4A 1AYEA 4NI2B 3CJKA 2E7VA 3TRGA 3R7BB 5D4OA 1WSVA 3QATA 5IWAJ 3MHYA 3OXFA 4EO8A 3ISNC 4KIAA 4BC7A 4UT4A 2J8AA 4H4KC 2M8DB 4OYXA 3OFGA 1J5EJ 4CLLA 3MPWA 3M9MB 2YKQA 5J1EA 5CAAA 4AD6A 2Z2YB 2F40A 4ZLLA 1VC0A 3LPEA 1LWCA 3G71S 2W8KA 4PRFA 2XSJB 4WYWA 3MM6A 3FSIA 2GJIA 3SDEA 1N32J 1ZM2A 4ZPVR 3DOLA 2XZWA 2HBZB 4HHJA 2K1RA 1PBUA 2G2OA 2FQQB 2IVFB 4X64F 3P5BP 2FPHX 3UD3P 5J2NB 2FGCA 3T1AA 3K5MA 5E3RA 4WFAQ 4C48A 2JVOA 1TV6B 4TU8A 1FXRA 1NK9A 2DGVA 4WFNQ 2XBPA 1F9FA 3CC7S 2HHPA 1EETB 2HHQA 1TU0B 2XZTB 2R8HA 4NLDA 5H9EJ 1L5UA 3GIKA 1D8YA 3I5AA 4JV1A 1GMWD 2VF3A 2MQ8A 1OWXA 2V94A 1JMTA 2KVIA 3SZ2A 2VBXA 2DRDA 4ECZA 3ZNJ1 1FT8A 5M2RA 1CLFA 3M8QB 4J9RA 5IT9Y 2X51A 5A6WA 4C3LA 2FVCA 2OD6A 1TK0A 2MXYA 4DX7A 3HFZB 1U1PA 4FXDA 2GGPB 3KK3B 2UVUA 3DLKA 2GHPA 2WB4A 2BUNA 3H4BA 3TUIC 4TU9A 2HWTA 2VC0A 3NGUA 2BE2B 1S1TA 1HNIB 2UUTA 3M8YA 5K9FA 3TWZA 4YB7A 3DYAA 4RW4B 5A0YB 3QJPA 1KHWA 2A2DA 1GX5A 4A8WA 2KG0A 1UCNA 5E0OA 4PZVA 2AJ0A 2FB0A 5E5NA 1DQAA 3OJSA 3NNCA 5HROA 3HFVA 5LMUF 4DR2J 3HSGA 1M5OC 2MJNA 3MM8A 4FBUA 3I0SA 2FD2A 1NJIT 2HMIA 5GMKa 5KFCA 1CQNA 4DLGA 3J81U 3I9V9 4CT9A 8AT1B 2MQPA 1TAUA 1RA7A 3TQ1A 1BY9A 3R5CA 1FDDA 3V4MA 2ZH6A 3BR8A 2CPEA 4R8UB 4WYLA 3G9CA 2YNHB 2CJXB 2J6UA 5DDRC 3OTEA 2P6TA 4I2PA 1SC4B 2CVIA 4G1QB 4I6AA 2WONA 3R6LB 4O44B 1RACB 2QO3A 4YR0A 4GKJJ 1FE0A 3PG9A 1E6VB 1H7XA 1H74A 1FRLA 2H9ZA 1FD2A 3JAMU 1HYSA 5BYRA 2R8KA 4DZDA 3RU0A 1NDKA 1LKZA 5GAEU 4ELTA 1AUSL 1LV5A 1HKAA 2F4FA 3EDQB 2NXCA 3NMRA 3VAJA 2DNGA 3OLAA 3ZZRA 2V4JA 1S12A 4PCQA 4U9RA 1B3TA 4RW6B 4F36A 1VDHA 1IKYA 1RTHB 3JTPA 3D2WA 2VA3A 2HYIB 4LF6J 4P73A 5GAEI 2V8VA 4DQPA 1QD1A 3CJ8A 3TEHB 5KG4A 3PJWA 2W9BB 3E3XA 4USHA 1AXQA 3NRBA 3ZZZA 1V5VA 4RU2A 4Z7CA 4CTAB 3D1OA 4K0KF 4LR9A 4JOUA 3PZPA 1H7WA 4Q8FA 1GTHA 3NGKA 3HFKA 2FZKB 3MTKA 4XPEA 3M6UA 2R3VA 3M8WA 3QWPA 4IRKA 4ZCLA 2UVRA 2NS1B 3B54A 2QG9B 3GIRA 1A9NB 4NZ0A 2B7CB 4K4XA 1V9OA 2LYVA 2KFNA 2Y8YA 1QSLA 2IJRA 1NPKA 3T6BA 3VAFA 1VBZA 3UR0A 5ETRA 4X66F 1U2RA 1HNZJ 2HHXA 3G6VA 2MQLA 4B17A 2C3YA 1BHNA 2V0NA 1WI6A 2GAHC 4R0EA 3QYYA 5EX3A 1F5AA 3SV4A 2R2RA 1F9EB 3GYGA 4O3SA 3BJYA 1XN9A 2DCLA 3ETMA 3W9IA 2DK2A 1PYTA 1QAYA 4TYBA 3LH2S 4GVBB 3H25A 3MUTP 4CT8A 3FDSA 3T19A 3CDUA 1CULA 3SCKE 4ER8A 1LW0A 3BKTA 3AJDA 1HD1A 1S9GB 4C2MA 2N4DA 3TZWA 1CC7A 5CYJA 3MAQA 1MWZA 1RTZA 2CADA 1SIWB 4NLYA 4YB6A 4KV8B 1D0EA 3GQCA 2CJQA 1HBMA 4OX6A 3C16B 5KG2A 3SQGB 2C2EA 4LF7F 3R5JB 5ETMA 1NJXA 5HJXA 1RAGB 3BB5A 2UUCJ 2DNLA 3N5BA 3PIPQ 4LFBJ 3CC4S 1J5OA 2RHSB 4CLFA 4Q2LA 1MN7A 1SV5A 2R7OA 3D68A 1JLCA 3ZZYA 1WDTA 2YWHA 1D9DA 3JXOA 1EB0A 3RJMB 4DV1F 4IKAA 2UUAJ 4LF8F 2HFSA 2OPQA 2M88A 5IC4B 4ZP6A 1HARA 4DF4A 2X1AA 2VKZG 1HMVB 3D4JA 1PBAA 2OJ3A 4M5DB 4DV3J 2BJ8A 2JZ5A 2HPUA 1KLNA 3Q2TC 1FNMA 1L3TA 1S1UA 4A8MP 3HHLC 4CLWA 4ECRA 3THTA 5A76A 5G0RB 2OPSA 3RGIA 3KLEB 1UA1A 2GW8A 4K4ZA 4N56A 1EJ7L 2DGUA 4Q8EA 1FKPA 3PKYA 4YY3J 2I8EA 3UDCA 3Q0AA 4B3SJ 3C14A 1URRA 2ROPA 2W8LA 2QGFB 4FPIA 2YNIB 5CYMB 2A10A 3W5XA 2DH9A 1JWWA 1M5KC 3PJXA 2LU1A 3M30A 2W24A 1QAXA 3AY0A 3EM1A 3EPIA 2CPHA 3JB9k 4TLRA 3HD2A 3Q89A 2IDEA 5DLFA 3OXGA 2NUHA 2PMZD 3V4IB 1QUVA 2HURA 4EK2A 3UPFA 1VCTA 5D4NA 3OR1B 4IG3B 1VQ8S 1KD1T 1SJ4P 3FBFA 3V5RA 1SUQB 3TX0A 5B09A 4PG7A 5KG7A 3WC2A 1X9WA 1XWLA 3FEXB 1EAYC 4JI3F 5ETSA 4O3PA 1R0AA 3FKBA 4Q2MA 2FZGB 3LAMA 3VHQA 4J7CA 1GH8A 3GP9A 1O8BA 2IMWP 2MDAA 4DZ6A 1GX6A 4E0DA 4C97A 3O3LA 1O5JA 5EWEA 2KYXA 1U1QA 4UOCA 2UXCJ 4ZCMA 1ZAVA 3V6KA 1HQEB 1U26A 2W2OP 1S6OA 1HWIA 4NCAA 2E5JA 1HWJA 1RTDB 4RBUA 1IBMJ 3JTOA 4HLBA 4PUOA 4J9VA 5LM7E 4ED8A 5L1IA 1X5OA 4CZCA 1U6BA 3Q2SC 4OYZA 3L7UA 2UUWA 2DTJA 5KFPA 1RU1A 2XQCA 4ZVRB 3H5XA 1UVNA 1LW2B 4TQSA 1NPPA 2V68A 3DM2B 4WKRA 2ZVSA 5L39A 4ZPAA 3DDKA 4KPCA 3OVBA 3GSIA 3MAAB 3WIVA 1VQ7S 3AODA 1X4GA 5HMXA 4XK8C 3MM9B 3QZ7A 3SI8A 4NLVA 4FKXA 5HAOA 1WKLA 3FBCA 4ZS6A 4IR9A 2QSWA 2YKNB 4ANDA 1VHFA 1CSJA 2OPPA 1ZH5A 2E29A 3RRGA 3EZUA 5F9NA 1S0MA 5D15A 4DPTA 1D3WA 1NHKL 3W2WB 4O0NA 3ITHB 3MR6A 4H54A 4PAAA 3NAIA 2UZAA 1FTCA 1DZ5A 3PW0A 4QU7A 5AXLA 4KHPJ 4PXCA 5J1EB 2IY5B 3MMJA 4RUCA 4DFKA 3CCZA 1QAIA 3Q8QB 2GAGC 3ULHA 4MK7A 2KHDA 3TX8A 1X5PA 2QFIA 2YKPA 2XTJP 4MFBA 2FTRA 3DOLB 3GFHA 3MXHP 2ZM6J 1FNOA 3I5BA 2F4VF 1RAIB 4C8YA 1JB0C 1U09A 2MZJA 2KM8C 2XM3A 5DG9A 2OKQA 3CTRA 5IT4A 2ZJPQ 3MPVA 1ZTTA 1MROA 2EWHA 2HZCA 1WHWA 1J2VA 4G3IA 3DOMA 2D41A 3GLJA 2MLYA 1KTVA 4TY8A 3FEZA 2OPRA 4YP3A 3JSRA 2O3DA 2QMXA 4FS1A 3DRRA 2AYGA 4USTA 4N47A 2WSCC 3GIMA 4ZIVA 4RWXA 2ZZNA 3DMJB 2CQ1A 3N28A 2VG5B 2QYGA 1T0TV 2QSFA 4EZ9A 3K5PA 4ZHRA 4LSLB 2MY8A 2ZH3A 2H65B 3CD0A 3P49B 1NNDA 2QA2A 3D28A 5J2PA 1WG5A 1FX4A 3N0VA 3FZBA 3KK2B 2QMWA 1KOOA 3I31A 3T6JA 1JLQB 4LSNB 2QA4S 3DYAB 4PWDB 1DRZA 5GADU 4U6PA 1QSSA 5DZ7A 1V3SA 2Z57B 3O8WA 3CVKA 4OHVA 4KY3A 1VQ5S 3PR5B 3IBFB 1QE1A 5HROB 4WU3A 2CG4A 4HT7A 3ENWA 4DL0C 3ADAC 4IFYB 3MM8B 9ATCB 2HQCA 3L7OA 5GADI 3I0SB 4Y65A 1PO6A 2AGPA 5B0CA 2PT0A 1IBCB 1DLOA 3VZHA 3NMAA 4QW8A 4P2XA 1B0TA 5D4PA 3JQMA 3DRSA 5HP1B 4B9UA 2E5LF 3ILIA 2KDOA 1XMBA 2BQRA 1T7PA 2YWFA 4RW8A 4CO3A 2IRUA 1RWOB 3EDRB 1YGYA 5T7LA 3PCOB 1S9EA 1AB8A 1BE4A 1F2HA 2NZ4A 1FKOA 4I2PB 2HBYB 2WB1D 2Q1LA 1DFDA 5BJRA 4UQGA 4HYKA 2WONB 3CCTA 3RBEA 2CJ9A 1Q16B 4B3TJ 2M4MA 1SIZA 3UN2A 2RVJA 2B9WA 5HANA 1HYSB 2VQFJ 2BRKA 2JLEA 4ZA1A 3MAHA 1KKHA 1TR0A 4AT1B 1KFSA 2JLFA 4IFVA 4ZVSB 4ID5A 1HWUA 3VGTA 1UVIA 2V4RA 2V4JB 1F9HA 3QJLA 1JKHA 3IGNA 2HFZA 4I6YA 2NXEA 3PX6A 4LUBA 2MY7A 4UOGA 1IM6A 1VQMS 2Y1IA 2CPDA 2BABA 3IR7B 1UPMB 2UXBF 3UI3A 2MKIA 3DLHA 4ETXA 3DFEA 2HHHJ 3HZGA 3TJAA 4E98A 3CO9A 4ILLA 4GKKJ 3U1MA 4GC7A 2M5YA 2B9XA 1GK8A 3K5OA 2IAJA 1S7IA 1UW9A 3IWXA 2CQHA 2ZHAA 4C8OA 2IHR1 1FRMA 3G2XA 1FJGJ 2I0XA 4HTJA 1YJUA 4FF1A 1NJZA 4CLPA 2R2SA 1N56A 1O0PA 3ZZPA 2XC9A 2W4DA 5HSPA 4QCLA 2ZKUA 1OSCA 1X5SA 3CJTA 1WD6A 1N54B 2HVHA 1DAXA 1RI7A 1TL7A 3GFYA 5FDLB 3W2VB 3LGNA 2M2BA 3MF5A 2ZDOA 3PEJA 1YZ7A 5H1SV 1VGYA 2XNRA 2OMOA 3D6MB 5B08A 2VDHA 3RG6A 4UUWA 3RB3A 1N5VA 2ZC4A 2PDAA 2FHKA 4LBPA 2XSFA 1CVJA 1XMOJ 4NXMF 1WNEA 1CULB 2YH0A 4B3RJ 2RAQA 4CO4A 2BX6A 2IFXA 1LOUA 4P7VA 2AGOA 1RTIB 3L7PA 2Z30B 1U6ZA 2BJ3A 2XMVA 1NB7A 2QX0A 7FDRA 4DFMA 3MECB 2CQ3A 2EFPA 3OR2B 1Q0NA 4I6WA 4DJBA 3H98A 2HRTA 4N8NA 2GO8A 1JLEA 4J37A 3JYTB 2P9CA 3K2YA 4TVAB 4U7CA 1DURA 3E01A 5LMNF 4FYWB 3CPWR 1XC9A 1SV5B 1VBYA 4ECYA 4HR2A 1CJVB 4LSZB 3DXSX 4I4BA 1A7GE 1U4BA 1M5VC 4NEZA 5AT1B 3BV8A 4NLTA 1VK8A 1S6PA 3GG0A 2Z2ZA 4QU6A 2OPQB 3FVYA 3Q8YA 4A48A 5AE3A 4NCGA 2MQOA 5DETA 2RU9A 3SSRA 3IBWA 2MKCA 4EU0A 1WOOA 2HW3A 3NNAA 4ELUA 4NXNJ 1WWHA 2Z2LA 2E5HA 1REVB 1FX2A 3PTWA 1BQMA 4JI7F 2AQ4A 3LGHA 3PRDA 1UWBA 8ATCB 3VGVA 1UJ5A 3POTA 4B3MJ 2Y3YA 3Q83A 2J0WA 3EYZA 1Q8KA 3QO9A 1NXIA 4Q0BA 4P71A 2JSXA 1JJ4A 2VBWA 2DNHA 2YQ3A 4X62F 1RT7A 2FJWA 1E6YB 2CRLA 4LF1A 4NYZA 5K14B 2HVDA 4OLPA 3HVWA 4ZPTR 1XJWB 3GFZA 3CJ3A 1Y5NB 3GJTB 3GPAA 2L9WA 2W4PA 2OIHA 4DUZF 2WAQD 3WX4A 4DL3A 2AEFA 2BJ7A 2H5IB 2MB0B 3OVAA 4ZDNA 4NCBA 3T1YF 2P6SA 2N3LA 5LMUJ 2PIIA 4M5MA 3DCAA 3A3PB 5CA5A 2MZSA 1RT2A 3MOJB 1Y7PA 3BYRA 1SVDA 3EVWA 3SBMA 1TFYA 2Z4PA 4B08A 3IM8A 1PJ7A 3BO4A 3UDLA 3NS6A 1UW4A 1V5IB 2G2ZA 4CLKA 4RUHA 4X4RA 4M5HA 3L3CA 2WW8A 2DYAA 3UVJB 4F67A 5I3UA 1EIYB 2LDIA 2OSRA 1RWPB 2J5AA 2QIFA 3MEDA 4DR7F 2BOAA 1UTAA 3K59A 4Y3CA 2ZD1A 3O1LA 2C2MB 3QSIA 4IG0B 3KMSA 4EUVA 1FNXH 2PO4A 2M7SA 4NEYA 4KB7A 4QWAA 4FF3A 2KXNB 3BO2A 1WELA 3EXYA 1T02A 5IV4A 3I55S 4WK3A 3HHLB 4L72B 1RWKB 1G6BA 2DJWA 2CZ4A 1KEKA 3NBPA 2GHWA 3LP2A 2DNPA 2Z2MA 1YJTA 2MLXA 1OO0B 2AX0A 3I5CA 4LQ3A 5LSRA 1JXLA 3H5YA 2ASDA 1AUDA 1UVMA 2R8GA 4HT5A 4X4VA 1VQSA 4RL1A 3O44A 2G4BA 4OI2A 2HZVA 4J9NA 3DN9A 5HBMA 3RZAA 3CDBA 1F3FA 4NLQA 4OZ5A 1PAUB 2NYIA 1TFWA 2LCWA 3ZTPA 3M7VA 2DH7A 4KKOB 2DXDA 4DSKA 1NK5A 3BSAA 3T1HF 1I94F 4IRCA 4D3HA 3VGSA 1VQYA 6AT1B 3OVSA 5D4LA 5F8IA 1RCOB 5B0EA 1RU2A 4DX5A 5HVGA 2D3UA 2W7AA 4DN9A 3M32A 1U6FA 3P6YC 3EPGA 4JI2F 2OTJS 3MM5A 2OSQA 2R7SA 2UV8G 1TK8A 4NLGA 2M52A 4X66J 4NLOA 3PIOQ 3SEOA 1Q4RA 3GWCA 3R8YA 5L8RC 2CZ9A 1TMJA 2BVZA 4CO1A 4EBEA 3CE8A 1GXUA 1WC4A 4DV4F 3VAGA 4DPOA 1ZPVA 2L9NA 3EICA 2IBOA 3ENAA 2K7JA 3TARA 1RB0A 4JYAF 4N8OA 2XY7A 3PRVA 2A6OA 2DGOA 4UTGA 3CWJA 3W7BA 1FKAF 5KT3A 4Y2AA 2WOMB 3LP0B 2XY5A 3RB0A 1HWLA 4HACA 4G1PA 3DOMB 3AJ1A 2DGQA 3HK2A 1YJ9S 3A8EA 1H73A 1CJKB 2VBYA 5K5MA 2F8HA 4F0HA 5KT5A 3CJ4A 1FRIA 3EGWB 3AHPA 4LREA 2UVWA 4OI3A 4DU7A 1YTYA 4BLGA 1MU2B 3IRXA 2F3JA 2D9PA 2EVZA 2FY8A 2ZBPA 1TKTB 4OIXA 5KFVA 4LF7J 3HZEA 1RBLA 3WQPA 4IYQA 2V67A 2BQ3A 1NK4A 5LJ3Y 4ANCA
chains in the Genus database with same CATH topology
4ECZA 4ELVA 4OV1A 2LQ9A 4YMEA 1NHUA 1VRUB 5J2MA 4WZQA 3G8QA 2RDIA 4HI2A 2YX7A 2D3OR 3VF0B 1FT8A 2W9AA 4NA1A 4KTQA 1KVJA 2DITA 3BZQA 5M2RA 3T9NA 1CLFA 3M8QB 1UKUA 4P6QA 4J9RA 1U1OA 2BACA 5IT9Y 2PGCA 4F2SA 3OW2R 2X51A 5C42A 5A6WA 3GYNA 2DGXA 2O01C 4QPXA 5J2PB 4C3LA 1Z2LA 2FVCA 2OD6A 1C1CA 1X4FA 1IKWA 1XNQF 2K3KA 1TK0A 4KO0B 2NLWA 1JLBA 2MXYA 3VQSA 3J80Y 1HI1A 2EBGA 1U1PA 4FXDA 2GGPB 1C0UA 3KK3B 5DQHA 2UVUA 4C8ZA 1Y9OA 3DLKA 2L9DA 2F8MA 3LW5C 2GHPA 3G86A 2WB4A 5K8NA 2BUNA 2VOOA 1KQGB 3H4BA 1LW0B 3TUIC 1HQUA 4TU9A 2XLKA 1FK9A 2HWTA 2VC0A 3CXCR 2BE2B 3G6YA 1S1TA 2FHJD 1X0FA 1HNIB 5I42A 2MSTA 3S01A 5J1PA 2OFGX 2UUTA 3IXQA 2B56A 5K9FA 4IG0A 4YB7A 3DYAA 4RW4B 5A0YB 3PNIA 1YBAA 3EUNA 4KE5A 4MKYA 1QE1B 1N5QA 3LPYA 3H20A 3QJPA 1DTTB 1KHWA 2A2DA 1IXKA 1GX5A 4R25A 4F4XA 2BYCA 2DGWA 4A8WA 1HBMB 5KT7A 2KG0A 1I1GA 1FRJA 5E0OA 2GIQA 3Q22A 2X1BA 5KFGA 2AJ0A 3CCJS 2XG8A 2FB0A 3M8PB 2LEAA 5E5NA 1DQAA 3OJSA 4JI8F 3NNCA 4TU7A 2CJBA 5HROA 1JLAB 2J9DE 4TXSA 1IM4A 4NOHA 4PG8A 3CSKA 3HHLA 5LMUF 1N8RT 3QZ8A 1RK8A 3V6JA 4ITSA 3C3LA 3T5KA 5LL6d 1R31A 2JVRA 4PG5A 1FDBA 3KWMA 1M5OC 2MJNA 3MM8A 4QJVA 1IBLF 1RT4B 4FBUA 1S1XB 3I0SA 2IMOA 5GAHU 2MHNA 2FD2A 2B6AB 2QZ8A 1NJIT 1J5OB 2HMIA 2VOPA 5GMKa 1HBOB 5KFCA 5F0UA 2MKKA 1CQNA 3BGRB 2KZZA 5HLFA 2DR8A 3KLGB 1RYSA 5L9NA 1KN6A 2L08A 4DLGA 3RAMA 1JLCB 4OI4A 4JI6F 3I9V9 4CT9A 5CXTA 2V8HA 5HMWA 2MQPA 1VJWA 1TAUA 2MZ1A 2FJVA 5AE2A 5T7LB 2VB6A 3I96A 1S9EB 1RA7A 2O5DA 3TQ1A 1BY9A 3D1HA 3R5CA 1FDDA 1FKOB 2W4CA 5KOXA 4DV0F 1N48A 4DSEA 5BYSA 3V4MA 1HW8A 2I38A 3BREA 2ZH6A 2KM8B 3W3SA 2ZOMA 3BR8A 2CPEA 4BCAA 4R8UB 5GAHI 1ROFA 4WYLA 3G9CA 4O3QA 2YNHB 1UEVA 1V3RA 3DLJA 3PM9A 3WZ0A 1X9MA 2J6UA 3KYLA 2L3MA 5DDRC 4Q7AA 4KHMA 3OTEA 2P6TA 2IJNA 3OJUA 3ENQA 4I2PA 3UW1A 2DB1A 4C0HA 1NK6A 4UW2A 4RNOA 4M8LA 3OTOF 1RTJB 1KHVA 1HW9A 2CVIA 4G1QB 4I6AA 2WONA 4O44B 2XULA 4HDHA 1VRTA 1WTFA 5KFQA 1RKIA 2QO3A 2R9LA 3DGPA 4YR0A 4ECVA 1TZ0A 1FE0A 4KKOA 1E6VB 1S1UB 1VOMA 2A1BA 1H7XA 1FRLA 2GV1A 2H9ZA 2YWGA 3LP1A 1FD2A 4F4YA 1HYSA 2BANB 1P1TA 3I87A 5SUHA 5BYRA 2OPSB 2R2UA 2R8KA 2F9DA 4MIAA 3IG1B 3RU0A 3VAIA 1LKZA 4H4MB 4RX6A 2RS2A 2E9ZA 5GAEU 2L41A 4ELTA 3NNHA 1JKHB 2YNFA 4PQAA 1LV5A 2DNNA 5AE1A 1LWEA 4JBCA 3KLVA 1NKCA 2KYZA 3RBDA 5B0FA 2JWNA 2LKZA 4HH0A 3NMRA 2B5JA 3VAJA 2DNGA 3KOAA 1B0VA 2E66A 3OLAA 3ZZRA 1FKPB 1SXLA 2K3IA 2V4JA 1TL5A 4PCQA 2JEIA 4U9RA 4LVOP 3G4SS 4RW6B 4O3OA 1IKYA 1RTHB 5KFSA 1JK9B 3JTPA 3D2WA 1Q7YT 2VA3A 4EFAC 1IKVA 1Q78A 1S7HA 4IUFA 2HYIB 4W92B 3FFIA 2Q79A 1FD8A 3UE2A 4KGKA 1SKSA 1S0VA 5FJ4A 2JJ4D 4KBIA 5GAEI 2KXFA 2V8VA 3IRWP 4DQPA 4WFBQ 2HS4A 2ADBA 2BA9A 4Y2IA 3GB0A 5LXRA 4DS4A 5KG4A 1T05B 2HNYA 2ZNZA 3PEHA 2CJKA 4I7FB 3FRYA 2FHMA 3PJWA 2W9BB 1N0UA 4WTYA 3UCGA 4DG1A 4N76A 2HHTA 2JX2A 5A8WB 3E3XA 5IXUA 3M30B 4USHA 1AXQA 3NRBA 1Y5IB 3ZZZA 4Y2KA 3WDOA 3K8VA 3OLBA 2BM1A 3KG4A 3C6UA 4RU2A 2XMKA 1VQ4S 4UY8T 3K8WA 3H5SA 3DRYA 4ERDA 4CTAB 3D1OA 3VR1A 1U1KA 1JNZB 4YR2A 4K0KF 2M8HA 2XSJA 4EWTA 5KFNA 4NZ7A 4LJMA 2PA8D 4JOUA 3PZPA 1H7WA 3PVXA 4Q8FA 3DLGB 2FJXA 1GTHA 3NGKA 1G2EA 3G8SA 4XDCA 3HFKA 5K8MA 3CCLS 1M1KT 4DL2A 2NSBA 2VA2A 5E33A 1T8EA 2IAJB 5HMYA 1GXTA 1GQEA 4B3OA 3MTKA 4XPEA 2CQBA 1PGZA 3M2VB 4F02A 2KI2A 5F3TA 3J7YI 3NP5A 3JSMA 3NAHA 2JEGA 1Q1KA 3PFOA 4C11B 3M6UA 1L3KA 1ZBTA 2UP1A 4K50A 2H5EA 2E7XA 5G4DA 3M1VB 4DFPA 3QWPA 1FE4A 2VQFF 1N4LA 4IRKA 4ZCLA 4I1TA 1H2UX 4RNFA 2HLTA 2WOMA 3LP0A 2GX8A 3PX0A 2UVRA 2DR7A 2NS1B 2LLZA 1TL1B 5K8OA 5E3AA 5HMZA 4NZ0A 1A9NB 2B7CB 4K4XA 2VG7B 1V9OA 1RT5A 6FD1A 4ZP7A 2CPFA 2IYIA 3GR1A 3QGHA 2LYVA 5D3GB 3BDPA 5DM6Q 4EYHB 2GQCA 1FHTA 2KFNA 4PQUB 4XAKA 3LAKA 4XO0A 1QSLA 1R0AB 4X4PA 3M4XA 1M90T 5IWAF 3LALA 3IS9B 4OHXA 3T6BA 2RQ4A 2FVQA 4NRUA 3VAFA 3B4DA 5C5JA 1VBZA 5EWFA 2MJUA 1YITS 3GG1A 3UR0A 2ZJRQ 5E3QA 4YB1P 1Q86T 2KRRA 4X66F 1APSA 1MU2A 1XK8A 3BQ1A 1B7FA 1U2RA 4KRWA 1BD6A 4X4NA 2HHXA 5EN1A 4WF9Q 2RDJA 4XIUA 1ZZNA 2B4PA 3HVTB 4U67Q 1TKTA 3G6VA 3RTVA 4B9MA 2LQBA 1N6QB 2VONA 1NKBA 2RH3A 1N5SA 2MQLA 4B17A 3RB4A 2R7TA 4OJGA 1LFWA 2C3YA 3F41A 3GILA 2V0NA 5EHHA 1WI6A 4R0EA 4AUKA 4X4SA 2HHHF 3SCIE 2B3TB 4G1IA 2FHOB 2QRRA 3QYYA 5L9XA 5EX3A 3EGZA 5D78A 2ZZMA 2AYEA 4AL6A 3N01A 2PI4A 1F5AA 4GKKF 3SV4A 1N32F 2R2RA 3B78A 2ZH8A 1TUVA 3BS9A 2HAIA 4YDDB 4O3SA 5EWGA 3EGNA 3BJYA 3HLUA 1BQXA 2IYGA 1UETA 2EPIA 1XN9A 2DCLA 2XCAA 3U1NA 3CC2S 5EUHA 4DBQA 2DK2A 2WSFC 2HLUA 2BQUA 1QAYA 3MOZA 2CPXA 1FDNA 3LH2S 3DXBA 4TYBA 2EFGA 1FRKA 1QJHA 3TVKA 3H25A 4OX8A 2DHGA 4QR2A 3MUTP 2GGPA 1S0NA 4PUOB 4CT8A 4GC6A 3FDSA 2KTQA 3T19A 5LJ5Y 3CDUA 1NKEA 2PSZA 1V3ZA 4O4GB 1KFDA 1TKXB 1SJQA 3SCKE 1LW0A 2XS5A 2U1AA 4LF9F 2YWEA 3IWNC 3AQPA 1JNRB 2XB2D 1S48A 1KC8T 1HD1A 3G6ES 4DQIA 2FLLA 4MIWA 2BE2A 1S9GB 4C2MA 1HNIA 2N4DA 5CHCB 1UVJA 4ETZA 5I4MA 3SYZA 5E41A 4ED0A 5CZXA 2IC3B 3FQKA 1CC7A 3O5TB 4RW4A 1MWZA 4RW7B 5A0YA 5CYJA 3MAQA 4F26A 3MR2A 1SIWB 3NKYA 4NLYA 4YB6A 1ZTWA 1DTTA 2IM1A 2ZH4A 2XLIA 4KV8B 2IRYA 1D0EA 2IVYA 3GQCA 3RRHA 4OJ3A 2QFJA 2CJQA 4V19J 1HBMA 4ZPWR 4K4TA 4OX6A 3C6TB 1S6QA 1SB6A 5KG2A 1H0HB 3M8PA 3SQGB 4J9OA 3S1TA 2C2EA 1LWFB 4LF7F 3E01B 4NLXA 3V6DB 1S76D 2I9SA 4ED2A 2ZE2B 1NJXA 4R5PA 4K4VA 1U24A 5KFAA 1G7CB 3JSYA 3BB5A 4LFCF 2RIJA 2E44A 3LOUA 5MLCV 3R27A 2DNLA 3N5BA 3PIPQ 3V81B 1S1XA 2GA7A 1MSWD 2HVZA 3CC4S 2HG4A 2JLGA 2B6AA 1J5OA 4C8NA 4DR6F 2GIRA 2NXUA 1HBOA 4CH0S 2WRMA 3H2VE 3BGRA 4Q2LA 4ILRA 2CPZA 2Z0GA 3KLGA 1SV5A 2C3UA 2R7OA 2OPPB 3FSXA 1JLCA 3ZZYA 1S6PB 4QR0A 5KT4A 2YWHA 1D9DA 2DHXA 2AJFE 4C8LA 1GXLA 4NRTA 3OL7A 1MNEA 4NCGB 2WBRA 3I6PA 2ZOGA 3E2EA 3CCUS 2VPZB 2ASLA 2FJBB 7FD1A 2W9CB 4DV1F 3ISND 4Y0FA 2KT5A 2E1RA 4IKAA 2GJ2A 5B0GA 2BBEA 4LF8F 2P9GA 1XMOF 1U2FA 4HH1A 3CT9A 2OPQA 4R0JA 1X4DA 2M88A 3K57A 2DPJA 4B3RF 1SH0A 2J0SD 5DQGA 2Y1RI 4XPCA 1U48A 4ZP6A 4A8SA 2JC1A 1HARA 3CGIA 2N82B 1HPZB 2KN4A 2W7PA 4Q45A 4DF4A 2X1AA 3KG1A 4I68A 2YX4A 3MWBA 1B0PA 3M6XA 2VKZG 1HMVB 4G1QA 5KFZA 5KT6A 2OJ3A 4M5DB 2J9DA 1FVSA 1Q8LA 1HI0P 2JZ5A 3CF5Q 3HM9A 2HPUA 5JVGQ 1KLNA 1C0TA 3R1LA 1U47A 3Q2TC 2LECA 1FNMA 4LFAF 1E6VA 5DJBA 1L3TA 1S1UA 4EZ6A 4ZCIA 4A8MP 1WG1A 3HHLC 1X4AA 1KQFB 4ECRA 3RAXA 3THTA 2J9CA 1UWBB 2VPWB 5G0RB 2MQMA 3ENVA 2BANA 3IC1A 3OV7A 3D0GE 2OPSA 3LWMA 2KJWA 3MFIA 2FC9A 4DHVA 3KLEB 2RU3A 2AP6A 4Q0BB 2NPFA 1S1WB 3LO3A 2GW8A 4J9KA 1UA1A 1L3UA 2FVSA 4K4ZA 2ASJA 1Z4UA 4N56A 3TYTA 3TW0A 2GO9A 2FVRA 4HEA9 5KG3A 3Q8PB 4DUYF 2RSQA 2DGUA 4Q8EA 1HNVA 3IR6B 1FKPA 1HBUA 3M8RA 2HGLA 2JC0A 3PKYA 1S72S 2DO4A 2Y0SD 2Q6BA 4OHWA 4RW6A 2I8EA 4MFBB 1RTHA 5SZTA 4RNNA 2ZH5A 2CFXA 4DQSA 3UDCA 4A8FA 3D54A 3Q0AA 3TA1A 5KFFA 3HT3A 1URRA 4MJKA 2ROPA 2W8LA 3KNAA 5LSLA 4PG6A 4C7QA 3RB6A 2YNIB 1RT1A 5CYMB 4ES2A 2A10A 1XMQF 1C4AA 1LK7A 2DH9A 2JFKA 3BGLA 3C2PA 2Q66A 1RT3B 3CCVS 3S6EA 1T05A 2DIUA 1JWWA 3PR4A 4OLOA 1M5KC 1ZM9A 4QPTA 2W9BA 2YKAA 3PJXA 1MROB 1YG0A 2MZQA 4FN5A 3NS5A 5A8WA 4UUXA 4B9NA 2G9OA 2LU1A 3M30A 4EO6A 1FF2A 2PA3A 2K7KA 2ZC3A 2W24A 3CCQS 1QAXA 1LXNA 2RKIB 3QAEA 3AY0A 3I82A 2XMWA 5F8NA 1OSDA 4MK8A 3EPIA 1RDRA 4CTAA 3IAM9 2NR0A 4TYAA 2GHVC 4TY8B 5LXYA 1K8AT 1NU4A 1IQZA 1ZETA 2OPRB 3DLEB <