2KKQA

Solution nmr structure of the ig-like c2-type 2 domain of human myotilin. northeast structural genomics target hr3158.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
116
structure length
116
Chain Sequence
MGHHHHHHSHEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPNQTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myotilin
publication title Solution NMR Structure of the Ig-like C2-type 2 Domain of Human Myotilin. Northeast Structural Genomics Target HR3158.
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 18
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2kkqA00
5I0ZA 2E7LC 1ZEAL 2BCKB 1GPOL 1B2WH 5CP7A 3CLEL 1T7WA 1NEZB 1BBJB 1SJHA 1T1ZA 4K55A 5DK2A 1QKZH 2EE3A 3GHBH 4JHWH 5DZLA 3MRIA 3OKOA 4XHQA 3NACL 4ZNEE 1NBVH 2IH3B 2B5IC 3HNTH 3SDDD 4WHTB 3MNWA 4L4TA 5F7EL 1FNAA 4LP4A 5FKAA 5DUPH 5E1HB 5ADPL 3OKKB 4PGDB 1BD2A 5DHVB 4P59L 2B5IB 3TC9A 1J88A 2P5EA 4QRRB 3D3VE 4EIGB 2X4QB 3KLHC 3QUMH 5DEZA 2XY2A 4L8DB 4N90D 4FMKA 5HY9A 4DWHA 3VE0A 1YY8A 4WI7A 3NN8B 4RMVA 4LEOB 4I4WA 5C0JB 4LCYB 3EYFB 3CZFB 2D7NA 2JIXB 4MD0B 3HAEA 4LCIL 3RWFA 3BQUA 5DC9B 1IGML 5JXEA 5I76B 3QUYA 2C3HA 4LLVB 1MQKH 4XXDA 4U7MA 2FJFA 3JV6A 2JCCF 1NUDA 3MFGB 4XCNA 5E5UB 2QHRH 3JWOL 2JCCA 1S78D 1U93A 4JAMB 1HQRA 2BC4B 2A9ML 1HKLH 1NGQH 2HT3C 3BP4B 2DM3A 1W72A 4ZSOB 3MRNA 5IB3B 4H8WC 1KPVA 5DUML 3RWJA 5HYJA 4YIQB 2C1OA 5IVOA 2DMCA 2J6EA 1Z9LA 1AQDB 4U6TA 5CEZH 2FX9H 3QEQE 4DN3L 5BVPL 5HYEA 4P23A 4WNQB 2CO6B 3KPLA 2R9HC 3ULSA 5IP4A 4IMKC 1FJ1A 1PG7W 3CLFL 2HJKB 3GMRA 4QF1A 4MAYA 1L6XA 5C0DA 3RVTD 4JRXA 4POZC 1C08A 2W9LA 5C0BD 3NCJL 1GGIL 4OF6A 1RD6A 3D39D 5GJSH 1DTUA 1MF2L 2K7PA 2I24N 4GSDL 4XTRC 3G5ZA 3BI9X 3PV6B 2E3VA 4LLYB 1UENA 3HS0A 2ATPA 2NX5B 4BZ1H 5AZEH 4OAWA 1HXYB 1Z5LA 4G8FA 4LVHC 3GMLA 4LOUD 1UWGH 4XPHL 4OIBA 4HWZA 3QNZA 4NT6A 1X5YA 1VKXB 5D2NA 1KLGB 3T4YA 3SGEH 2P49B 3AAZB 5KBNC 3MV7B 3U83A 1NCNA 3VA2C 3QUKB 4M5YH 4Y7MA 4G8EA 3EBAA 3ALXA 3SJVB 5DJ6A 1DUYA 1ORSB 1HINH 1CICC 3LZFL 5C08E 4ODVH 2A6JA 3U79A 2XWBB 4U1IA 3O2DH 3NFPB 3GBNH 1DJSA 3WE6B 5IFJB 3AGVA 4U1NA 5FM5O 3Q5OA 2YSSB 3EOTL 4HUKB 5F3BB 1A6TA 4JG1H 4RA3A 3KYMB 3WNMA 1FDLL 3ULUC 1CFSA 2MPAH 1SM3L 5CZXD 1Z9MA 4F3FA 3EO1A 5J12C 4JHBA 3X13A 5IKCB 1DSFL 2NZIA 2QADD 3DOSA 1MVUB 4CMMA 3MRHA 2EDLA 4PG2C 4Z7VF 2Q8BH 2XACC 4R2GB 4JM4H 3FL7A 5E8OB 5J12B 3HMXH 5EBMA 3O8XD 3UXFA 1HH6A 4YHOL 4UU9A 4Y19A 1FV1A 3RKDD 3MFFB 1A9EA 1CTNA 3ULVD 4XP9L 2V5TA 2BMKB 3SDYH 3VWJA 2EZ0D 5GGTL 2FH8A 2RFXA 4PJGB 3D0VA 3VGHA 4CADB 5AZ2H 3QIBD 4PJ5A 3ZSTA 2XZQL 1HILA 1HSBB 3CFKB 1RJZA 4UQ3A 3AU1B 1RUQH 4FQIL 2RCSL 1EJOL 5IBUG 1OM3H 2BERA 4NFDA 1VFMA 4RGOL 2DWDA 1R3JB 1MFDH 1UH2A 3S98A 1IQWL 2HT2C 4HS8H 3NAAL 5GGUA 1U8PA 3MV9D 4XP1H 5CSZB 3HNSL 3EHBC 1IFHL 1JPTL 1NCUA 3KXFD 1T21A 4Q6YA 3SDCC 4JVPA 4Y16B 3DUUA 4XBGA 2L7JA 3KPMB 5DMGD 4J4PD 4NUJB 4CW1B 2DQUH 2GTWA 1X4ZA 3VGAC 4Q9QH 3HAEH 4PJHF 3KDMB 2NY5L 3DO7A 4PJHA 1AY1H 4NO5B 1IC5L 3KWWB 1JWUA 3VH8A 3LKQA 2O5YH 3KPQA 3VGAB 4HKXA 4ZUSB 5E95B 3I50L 4LCWE 5DJ0A 4OZGE 3QDHA 2JK5B 3NVQA 3QJHA 4Y4FA 4B5EA 1DEEB 4JFEA 5IBUB 1MCIA 5IUSA 1W72H 1X5GA 5BS0E 3ILQD 4BKLA 4HXAH 1FZOB 1H3VA 1M6OB 3D18B 4WW1B 5DT1H 4KVNL 3E6FA 2O5ZH 4JFHD 4YFDB 2FX8L 2BNRA 2JE8A 3HI5L 3P4LA 1BPVA 4N0CC 2J6EH 2V17H 1CVSC 4WFED 5D2LE 1AR2A 4P2RB 3LKOA 2EXYC 1N6QH 4KQ3L 5HGAB 5F1NA 1M1SA 3RAJL 5GRZA 1IM3A 3O9WA 4DQOH 3FB6B 1OARL 2D03H 1A1NB 2BJML 4LPCA 4MJID 2UWEE 4AL8L 3T4AA 4CU6A 5FA4B 5IQ9A 3R8BB 4KJYA 5C0GB 4X99A 1ZGLM 1A9BA 3AY4A 3OAYH 5LAXB 2A9NH 5EOTA 1WWAX 4JGJA 1ZHNB 4GXVL 1LWRA 1QSFA 1NC4D 5BZDB 5EC1A 4TPRH 4XNUH 2C4FU 2Z0BA 1T4KB 3VFRA 4AG4H 1R5VB 4ZQKA 4N0UA 1AXSA 3H9SE 1JF1B 4MAUL 4QHUB 2H2PC 3SCMA 3TJEH 1LEIA 3HG1A 2CUIA 1NAKL 4WENB 3WSQH 5JOEA 2F54A 2XG4A 5BQ7A 4RAUA 5TH2B 5E70A 3RIAK 5E1AB 1QBLL 4OF7A 1OAUH 4PJ7B 4MZ2A 1OSPL 1MCOH 4KY1L 5E00A 4WFHE 5CINH 1YPZB 3SEPA 2HN7A 1HIML 5EU7C 3EJYD 3OKMA 4QXTB 3QH3A 4C56B 3WS6A 1QLRA 3UROR 1T83A 1Q9WA 2AJZB 4GRLC 5K59F 3CFCH 2E27H 3OHXB 1LD9B 2WBJD 1IC7H 2GUOA 1ZVSA 2NW3A 4M3KB 1TVBB 4WI2A 4WHYH 1D9KC 1KTDB 3F6IA 5CJOL 5JW4N 1BFVH 4GRLB 5IW6B 4Z78B 3WEXA 1U41A 4JB9H 2LVEA 1MAJA 1TVDA 2CRZA 5I1CL 4Z9KB 3WV0A 2FDBP 4TNVK 2DQEL 3K4ZA 2P7TB 4TOYL 4MNGE 5C0FB 3GSNB 3C2AL 2B4CL 3QIWC 3VXOA 4KGLA 2WIIA 1JGVH 1KB9K 1IGIH 4NQDB 3WS3A 3LD8C 5EOCL 1YDPA 3MRDA 3GRWA 4NRYA 1NBYB 4L4VD 3GJEB 5E5MA 2BVQA 4WUUD 1FO0H 5LGHH 3WIHH 3LD8B 2ENSA 1CFQA 1T0NB 3LV3A 4I0KA 1S7TB 1CFNB 3S35L 4M7JL 2LU4A 2CKNA 1T1YB 1L6ZA 1QFUL 4MX7B 2BRQA 3KYNB 4IRSA 4PRIE 5D1XB 3MLZH 3IJYA 2VDOL 1A7PH 4KKCD 2YD5A 1CGSH 4BQ6A 2IANA 1A6VH 3DXAB 5I16A 3O3AA 2EE6A 4MJ5B 3KPNA 1PSKH 4HUXA 2X4OB 3QXUA 3TBTA 4WEBH 2P48B 3ORJA 4FTVA 5HHPB 4CMHC 3RP1A 5CLWA 3RX7A 1DFBH 1T22B 4KJQC 5JPMB 2ICEA 4L29A 1WBZA 3BRGC 2DS4A 1QLFA 1YQVH 3FB5A 2GSGB 4JY5L 2IPTL 3FQWB 2KH2B 1B0RA 2HFFB 1NFDB 4BELD 1RQ5A 4NFCA 1B6DA 4OCXH 4HZAA 4JFFB 1RVFH 1U58B 5HHOB 4OLUL 4KJWD 2MCPL 3RL2B 1QR1B 5C7XL 1NLBL 4K3DL 2R39A 4PG9A 3QUMB 4AENA 4S0SD 1BM3L 1OTTD 4QO1A 3RHWK 2HT4C 4HXBL 1E4WH 4M8VA 5FA3A 5KAQG 1GZPA 3VXNA 5MEOA 2EEDA 2VWEE 3V52L 4H25B 2B1HH 2VABA 3DROA 5HI3D 3ES6B 4FXKB 1B6UA 4KTDL 1OP9A 3FT4B 3HMWH 1DR9A 5D8JL 4PRDB 3D2UD 4JFYB 3LEXB 3MRFA 4HT1L 1RZ7H 4OLVH 4DKEL 3SKMB 1ETZA 5DTFB 2XQYK 4HJGB 4YDJA 1KIRB 2A6DB 4LFHD 4Y1AA 1ODAA 3SO3C 5J57B 4GAJH 1G9NH 1GIGH 4R8WH 1FG9C 2J8UF 1D5BA 3H7LA 1CL7H 4M43L 2Q6WA 2P45B 2J8UA 1CR9H 3WN5B 3SDXE 3SO3B 3IDIA 5DF0A 5TPWH 1J1PL 5DURD 3K1KC 4LASH 1RFDH 1K9TA 3L5XH 4HWBL 1FFNA 4G3YL 2VQ1B 5IBTH 4X80H 3NTCH 5CUSH 1T6VN 3MBED 3MUY1 3T0VA 3BP6B 3UC0H 4OLWH 2D9QB 1FNFA 5IK3B 2AJ3A 3I6GB 5IB1B 1L7TL 1EHNA 3K4AA 3QFJA 3DX6A 1SY6A 3GJFK 1LE9B 3HLAB 4M6NL 1U8JB 5E8NB 4DOHB 1NGPH 2F15A 4FG6C 5F6HI 3MV8E 5HHXL 3BN3B 5E2TL 4UDTB 3GK8H 3P0VL 2E7HA 3X14A 3BAEH 3PWPA 5MHSD 3S37L 1A7OL 2VH5L 5D9SB 5JOFA 3B83A 3NIFF 1V3KA 4BH8B 5C09E 1QRNE 1BJ8A 2ESVD 4PD4J 5DWUH 4YDVA 1Q9LA 1XR8A 2W9EL 3MRCB 3WFHB 4XVTL 2R1YB 2J4WL 3GUTB 3L3DA 3FCTB 2ZUYA 4WV1A 3NPSC 4F9LA 2DM7A 3GM0A 3DUHA 3P73B 1TZGL 4S1RH 2BVOB 1JYXA 3KPPB 3ZYJA 2NY4D 3S5LA 1OY3B 1MJ8H 3LSOA 3GMPB 3W5MA 2CGRL 3NPSB 4TSAH 5TFSH 3QO0B 3C8KB 1HOCB 4LSTL 3ILPA 2CDFA 3W11C 5I9QC 3AS1A 4KI5C 4RGNC 5TGBB 3SQOH 4HUVA 4UNUA 1Q72L 5BMFL 5INCA 2DQIH 5IHUL 5DLMH 3GRWH 2DMBA 4QTIL 2OSLA 3FMGH 1N0LA 4Y5YA 3P40A 5I9QB 3HUJF 4RGNB 4X9HA 3RL1B 3NCBB 4I0PC 1MY7A 3HUJA 4KC3B 4MD5B 4LVNC 1TJHH 5GS0H 5ERWB 5C2BL 2B0SL 3OKLB 4P2CG 3RZCA 1U8KB 4XVUD 4XX1G 3FQUB 4K9EH 4H0HB 5HD8D 4LVNB 4MB4A 3UTQB 3ZE0E 1EEYA 4YPGB 5E2UL 4LEXH 2XA3A 4ZXBC 3QT2A 3D25B 3UTPE 4UT7H 2VLKA 1QPXA 1HHIB 1F4YH 3HAEG 2HKFH 3GKWH 5IV2B 1N6VA 4OLXL 3AS3A 3LH2H 5B39B 4DAGL 5CP7B 4RSVA 3WHE1 2BSED 1T1ZB 3I3EA 5DK2B 2DTML 4FQHB 4HKZB 3C5ZD 2HTKC 1MCPH 4GRWE 4P5KB 5C07D 5ADOH 3MRIB 5HBBA 1U8HA 3F58L 2DQHL 2AJUL 2OLDA 1YMMA 3FRUB 2R69H 1EVUA 4GMTH 1EGJL 4DZBA 2XFXA 5L0QB 2ZWLT 2ORBL 2RJMA 4QHNA 5T3ZH 1GC1L 5GIRA 3MX0A 5ABDE 2SEBB 4N1HB 1SEQH 3MBXL 3BKMH 4NQCE 5LBSH 1TCRA 4LQFH 1RJCA 5E8DH 4X7EC 2GHWB 4G7YL 4QRUA 3GMOA 1ZA3B 4UTAH 4WWID 3QFDB 4Y89A 3VE0B 3LB6C 2JB6B 4F7EA 4F15C 1RY7B 1AO7E 1X4XA 2EYTA 3F8UB 4GT7A 3HAEB 5HYSA 3UJIH 1GGTA 3GSQB 1JF5A 3A6BL 3BQUB 3FT2B 3PHQA 4F15B 3QUYB 1YEKL 4HCRH 1EMTL 4XXDB 1OPGL 2FJFB 3JV6B 4IDJL 1FZKB 1TJIH 3P4NB 2XRAH 1FBIL 3DYPA 3C60D 4G8GE 4OD2A 4ODSL 4P4RA 1E6OH 1RUPL 3CDGA 4ELME 3TT1H 5A2IH 2AJSL 3DIFA 4HBCH 3JTSA 3MRNB 2DBLH 4NFBA 3FO2B 5TF1L 4N9OB 1F11A 2VIRB 1U92B 3QWRD 4U1KA 1KPVB 4DVRH 4GJTB 1HSAA 2C1OB 3GO1H 3MRBB 2D7MA 4LMQE 2DJSA 2QSCH 1OB1B 4KQ4H 5BV7H 5DYOA 4JPKL 2LTQC 1U6AH 2XTLA 3KPLB 4HGMA 1K2DA 3ULSB 1FJ1B 4XVSH 2VLRE 4KMLB 4QF1B 4Y5VC 2YK1H 4MAYB 5C0DB 5D1ZA 5ESVA 4JRXB 4ZO9A 5IGXL 4OI8A 5GJTL 4ODXA 2BNQE 2LTQB 1YNKL 2W65B 3DI3B 2VZTA 2R4RH 1JHLL 4NM8L 5DR5L 3QHTC 1K4DB 4Y5VB 4EI5C 4WO4C 1RK0B 3G5ZB 4WHYG 3SOBH 5IJVB 3PIQB 5AWNH 2HVJB 1SVZA 3HS0B 3PWJA 4GQPH 4I77H 4JQXC 3JWDH 5BCAA 4R3SA 1NCAH 1Z5LB 1SJVA 4G8FB 3GMLB 4QXUL 3QNZB 2P8PA 4NT6B 4UV7L 3BKYL 1E4JA 1O7VA 2BHZA 2XTJE 3T4YB 1FGVL 4N0FB 1FNHA 1BIIA 3V7MA 1PJ9A 1ZT4B 1CS6A 3K8KA 2GEEA 5F1IA 2P47B 1DUYB 2DD8L 3VGEA 4IRJD 5DHYB 5DJDA 2A6JB 1ZLWK 1MIMH 4XCCH 3Q6GH 4MCZB 4U1IB 5KZCD 5L2JB 5BRZD 3VW3L 4PRHA 4KUCD 3VXUA 3SE4C 3CFEA 3ZKXC 3LCYA 5KS9F 2V5YA 1CFSB 5KS9A 2Y9RT 4M6MH 5HHNA 1JPGA 4F3FB 3TT3H 2FJHA 3PQYA 3NZ8B 1R3IH 3I75A 2EH8H 5EIVA 3X13B 3ZKXB 5LWYL 3KR3L 1JGDB 3GFUA 1F4WH 3MV11 3BFOA 1A6ZA 2ZCLL 3QEHA 1AR1C 3HZMB 2E6JA 3IDYC 2D4DA 1W0WA 4GAYA 4X5WA 1FVDA 1XR9B 1X7QB 1OTUC 1UKSA 5E6ID 3OJMB 4NO2A 4ZPVB 1QBBA 4UU9B 5IW1B 3IDYB 1A9EB 4G9DA 4X6FA 2VL4A 4JKMA 4OLYH 1KOAA 3SDDA 5KVGH 3CAFA 4P49A 4Z0BH 4CJ0A 1ZWIB 2CO7B 5T3XL 2H41A 3RVXC 2IADA 1RJZB 4UQ3B 1ZXQA 2E8ZA 1PX3A 2FBJH 1BP3B 1WAAF 2NYYC 5BO1L 2D4FA 1FO0B 1WAAA 5FB8B 4BZ2L 1T89A 2JF1A 4ZFGH 4M1CC 5KSBB 2DWDB 1A6WH 1AIFB 3N85L 3W0WE 2QSVA 5GGUB 1U8PB 3T77A 1WBXA 4JFDE 4YXKL 1TETH 3BZFA 3V95A 3G6JF 3BIKA 5B21A 1GGBL 3G6JA 3B5TA 1CDGA 1T21B 3STBA 5J56B 1OAYL 4G8IA 3KXFE 2EDDA 1FNGB 3DUUB 4XBGB 2R0LH 3FN0L 4OGZA 1OT1A 4R7DA 2B1AL 5E24E 4PJHB 4HUUB 4GKOA 3AM8A 1EAJA 3KPQB 3WDJA 1YECL 3M45A 4PD4K 4W6WB 4HKXB 5F96L 1IL1A 3QHZH 3VWKC 3O3DA 4MB3A 4POYA 2E6QA 5F1SA 2AERT 5JOPE 3R1GL 4P3CL 1DLHB 1G0XA 4X9FA 5J11B 4HMEA 2BVPB 4Y4FB 4Y2DD 4E5XB 5KANI 5I1EH 4JFEB 2JJWA 4FQQB 3VWKB 4O2FA 4BKLB 3BX7C 1LMKA 2AV7A 4RAHA 3VXSD 3CNKA 1F3DH 2XXMB 3D9AL 3E6FB 4XP5H 1NUFA 5IEKA 5H2BA 5BW7C 3WYRA 4JN1H 2CJUL 1CLYH 2HG5B 1JZ6A 4BSJA 1Q0YH 5HYJE 4OFKA 1H3GA 3QIUC 4HGWA 4OD1L 5F1NB 5DSCA 1IM3B 2RHEA 3GBMH 5C0BA 3O9WB 1RHFA 1G9NC 4CU8A 3G6DH 5IQ9B 3T3MF 3C87A 2H6PB 4X99B 1A9BB 4U2YA 4JY6A 4NCC1 5I8OH 1T66C 5GGVL 1NAML 3U0TA 3PDOA 3CH1B 5I30L 2ZCHL 3JV0A 2V9RA 2WK2A 3EFDH 3R0NA 1YEJL 1VACA 5D5MF 5F7UA 4KPHH 5DD3H 5D5MA 2DJUA 3RJQB 2V2XA 5CBAB 4P46D 3IJHB 2Y25A 3FO0H 4FQ2L 4WI3A 3SCMB 3MOBH 2GI7A 3HG1B 3C6LA 3IAPA 2NY7H 4GQ9L 3OJ2C 4O4YH 2F54B 3Q5YA 4NZTL 5BQ7B 1U3YA 4RAUB 1IMHC 2NQCA 2CKBB 3FZUC 2X9XA 2IAMD 4X98A 3KJ6H 5D2NE 3U4BH 2X4SB 4P2OC 3VU2A 2DKUA 4MXVE 5IMLA 5E00B 4HUWA 4QCIB 3VMNA 1J0JA 4YHKH 4MNHA 5LXGH 4NKIL 2YPVL 3OKMB 4UUJA 4P2OB 4HIIB 2QJDA 4MXQD 1S9VB 4D9LH 3VG0H 3LS5H 4JQVA 1QLRB 4UOJA 3IU3A 4GBXC 3V6ZA 1Q9WB 3P0YH 1T04B 1EERB 3PXJA 2DN7A 5HDOA 1UM6L 4JZNB 5DJAA 5IESH 4GBXB 1PAMA 2VAAA 1J10A 3ULVF 3WEXB 3BPNC 1TTGA 1FSKC 4MQTB 2VQUA 4LK4A 3K80A 4PBXA 4M6AA 3WNPA 3I2CH 4JM2D 4NO3A 4XH2B 4J6RL 3NZHH 1I3GH 1UA6H 3N1QC 3OAUL 4XCYA 3DTXB 5C0NC 1DQQA 1NSNH 4Z7VE 4Z7UF 3QIBA 4XMLL 3RVWC 3BPNB 4TRPL 1FSKB 3L5WB 4Z7UA 1DN0B 2XWJB 2WIIB 3WKML 1QFWL 5D7IB 3K8LA 2OTUB 3IXAB 3GNMH 3WS3B 5T1MA 2P8MA 1YDPB 1JJUA 3L3IA 3HA0A 3MRDB 5IT2H 5SWZA 3OR6B 4ZOCA 4UT9H 4NQEE 2H32A 3WXWH 2HP4A 4OZHE 3WCYA 5IHBA 3EDFA 1Q9OA 3TESA 4BH7B 1U0QA 2AQ3A 4G6KL 4PJ8A 4D0CA 1CFQB 3MV9A 3LV3B 3VJ6A 3QWQB 3VFMA 1RZFL 1EK3A 1NMBL 4Z5RA 2AKRA 1BQLH 2EECA 1UB6B 5D6CA 5E08L 3MROB 3D85B 1FFOB 4WW2F 4R26L 2F5BL 4J4PA 1BZ9B 4K23H 4WW2A 1EDQA 2C3WA 1I7TB 4MDIA 4K2UH 3G5XA 2HFGL 4I1NB 4OZFG 3TBTB 4X4MA 5IVNA 3UPAA 4HFUH 4OZGB 1UCBL 4FQ1H 5GGRY 4NQSB 3VFUA 5SX4H 4L29B 1QLFB 2V2TA 1KLUA 4UDUA 1A7RL 5BS0B 3A0OA 1RIVL 2ZG3A 1B0RB 2YUVA 5GGRB 1D6EB 4HS6A 4XNXH 1PZ5A 2X5PA 1BBDL 2X70B 5D4QA 1IZJA 3Q6FA 5ICXA 4JFZL 2I9TA 4QT5B 1VADA 1YQ2A 2EDRA 2VITA 2VN7A 4PG9B 4AENB 3BZDA 1U8LA 4FQCL 1A4KA 1DBBL 5FYKE 4QNPE 4LKXA 2WV3A 3VXNB 3JV5A 4HQQL 4MJIA 4WUKL 5KOMC 1CF8L 3DROB 4FFYL 4P2QD 3U46A 3MYZA 2PO6A 2IBZY 4WFFD 2X4NA 4EDWL 1JPTH 5HVHC 3MRFB 1AHWA 4OZFB 2Y72A 1NC4A 5DS8A 5DK0A 4K8RD 4FNLL 3JZ7A 4FXLA 4Y1AB 3H9SB 4PJAB 3IU4H 4GW1A 3U7WH 4RCAA 4J8RA 3WFCL 3HRZA 2QKIB 4OD3H 1D5BB 5HVHB 1P4BL 1WT5C 1UZ6E 2CDGA 3B2VH 1FC1A 1JNNH 5DVLA 2XZCL 3QZWB 1U91B 1ZHKB 1KENH 4Z8FL 1JV5B 3CFIC 1CGUA 1BQHA 3S5LG 4R90H 5CKAA 2ZPKH 1YEFH 4AMKH 2D2OA 1G7HA 1PG7X 3WD5L 1NUGA 3IT8D 1Q0XL 1RUAH 1A0QL 3V7AE 4YBQC 1CZ8H 3WO4B 2P5WA 5EO0B 3KPRB 1WBYA 4NZDA 3RNKB 2OQJB 2A1WL 4X9GA 4JO3H 3DX6B 4QGYA 4XBEL 1FPTL 3EDJA 3MRRB 1NGWB 2APFA 2R56L 4JG0H 2GQHA 4JFOA 1GXEA 4AT6A 1QYGL 1WC7B 2EYRB 4LNVA 2WBJA 3FOLA 4S1DC 5DRXB 5JOFB 3IGAA 3CX5K 2VMFA 1JI1A 2XYCA 2NLJB 4W6XB 5I2IA 5DQ9B 3ZYOA 3UTOA 1MRFH 4YDVB 1Q9LB 1XR8B 2AK4B 2AI0H 2QQLL 3L3OA 3QDMD 1FIGL 4MNGB 3QQ4A 4G80B 3L3DB 1XF5B 4N1EA 2L0DA 3ULVH 5JXAH 4BA8A 3S5LB 2G5BB 2Y06L 5KJRH 4MHHG 2HT3D 4ZOBA 5DDHA 2X4TB 1U8MB 2IBBA 1JGLH 3ZDZF 2BP3A 4L4VA 2CDFB 1CGVA 5FOBA 5DJCA 4MQXD 4WUUA 2NY6B 3GSXA 4ZFZA 4K3EL 5INCB 3B3IA 1RI8A 4ETYA 1X5FA 1EO5A 6FABH 1C7TA 1G7QB 2H32H 1KJVA 2CRMA 1XGTB 3P30L 1YC8A 2X7LB 2AGJL 1JK8A 2NY1C 1ZKAA 3BP5A 4ENED 1A1MA 3OPZL 3HE6A 4YC2C 4ZAKA 2FATH 4L8SC 4XCFH 2X4RB 2K7QA 2P8LA 4PB9H 4POZD 1H3UA 1J0IA 3S97C 1PVHA 5I1IL 3G5YB 3IFOB 3C9NB 4YC2B 1EEYB 1XGQA 1DBKL 5C70A 4L8SB 5EBLB 3B9EA 3UZQA 1ZTXL 5F3HA 4OM1H 5GRJL 3MMEA 3DBXB 5F7DB 4F37K 1BLNA 1ZT7B 5TE4L 5GGQH 4GXUN 3S96A 4GKSA 3HC4H 2Q86B 3QPXL 2HH0H 3QISA 2MCG1 4JO1H 4MYWB 2CK0H 5GZOD 3MNZA 4NN6C 4P3DA 4G42A 2CRYA 3QXWA 3SY0A 1VERA 1YYML 2J2ZA 3PP4H 4HPOH 4QHMA 1YMMB 2VWEC 3UDWC 1CICD 2XFXB 4NN6B 1EXUB 1PKQB 5KTEL 1J11A 1A4JA 8FABA 2FD6H 2HJFB 2P46B 2YWYA 2YRZA 5GIRB 3CSYB 1JZ7A 1MLBB 1FYTE 5FOJA 3T65B 2VR9A 2I26N 5HDQH 1TCRB 4JPVL 5CD3B 5I15L 2OK0H 1N2RB 3U9PH 4F9PC 4XAWH 3U2SB 3MGTA 2A6KA 1H8OA 4OCSH 5EZLA 2R4SL 1KEML 4GOSA 2BSSA 3TEUA 5C0RH 1HK6A 2WLZA 5INDA 3V4VL 2AXJA 1N7MH 5JR1L 5GRUL 5DZOA 3SDXB 5CAYB 2PYED 5F7MC 3PHQB 4EJ1C 5ICYB 1B0GA 1FCCA 5KVDH 2QV2A 2NY3D 1N5YL 4EBQH 4OD2B 5AD0A 1JWSB 3MBEA 1IGFL 2J8UE 3BSZL 3JTSB 1YJDC 3JBG7 3W9DB 1KC5L 4U1KB 1F11B 4NQUA 2OP4L 3RBSA 4K3GA 3NABH 4LPYA 5FUOL 1TNNA 2R1WA 3U7AA 1N3NA 4NQXA 3TWCH 1I1FA 3G5VA 1FZMA 4H0GA 3T3PE 2FECI 1D5IH 3OKEB 1HHHA 4OZ4A 2ZCKH 2IFFL 1QBMH 4O58H 3BN9C 1MCWM 5C09B 1QRNB 4TULL 4PP2A 3L9RB 3EHBD 2CH8A 3MRQA 2DLEA 3P9WB 3E2HC 4TNWF 3MLSL 1QFWI 3SDCD 3JVGA 4ODXB 5DZNA 3V4UH 2ESVA 4OGAD 5L2KA 3MREA 3P4OB 1DBML 1S3KL 1I1CA 1L7IL 1MELA 1XF3A 4NHCH 3OAYK 1R24A 3E2HB 3FFDA 2L4OA 3LRGA 3MLVH 5E2JA 5ALCL 1MFBL 5DVKA 2FL5A 3MJ8A 4LIQL 4MJ6B 2PTVA 3PGCB 4V2BA 1YMHA 4R3SB 5EIIA 4MNQE 4XNZC 3IFPB 5FYLD 1I7RA 2JKXA 1J05B 2P8PB 3HR5A 2CIKA 5JHDE 5I18H 1MWAA 3I3BA 1RURH 3I3DA 3U7YH 2E5EA 4P9HL 4XGZA 4XNZB 1A14L 1KN4H 1LO5A 2BSRB 1BZQK 5F1IB 1F8TL 5C6TH 2MFNA 2WM0A 4P2RD 3PJSB 2J5LB 1CIDA 4R96B 5DJDB 1OAQH 1F4HA 4JO4L 3T08A 1EHLL 5DMYA 4LCCC 5GRYA 3TIDB 1PY4A 2VXVL 3FQXA 1MFEL 3FTGA 5GGSY 3ULUL 4JY4B 4PRHB 1I8MA 4KK5C 3KG5A 2NW2A 2EO9A 2WANA 3CFEB 1HHJA 4LCCB 3DYMA 1JN6B 1V7ML 4O9HH 4UAOC 3L5IA 3K1DA 1P2CA 5A43C 2ARJB 3HUJE 3MCKB 4L1DA 5HHNB 1JZ3A 1JPGB 1A7NL 1DLFH 3I75B 1NCDH 4UAOB 1A6ZB 2ADFL 3QEHB 3GSUA 1GGCH 4ZUVB 3OKDA 4GAYB 5T1KD 4J3VA 1YUHA 3SE3A 4C57C 5IFHH 1JNJA 4GRWB 3SDDC 1QSVA 3MR9A 3C5ZA 1IBGL 3ABZA 5C07A 3BGAA 3CUPB 1RIUH 5D70H 1A3QA 1MVFA 2H2PD 5DD6A 5TE6H 4O2CA 3PHSA 1TQBC 5SWSD 3SDDB 2Q7YB 5CHNB 4YHYC 3O3EA 2I9LA 4WCYH 3MLWH 4PRNB 4X8XA 5JIKA 4ONGL 5C0AA 2EYSA 1KIPA 3U0PB 5GSRA 3L3KB 3VXRA 3BXNB 4FN0A 3H9YA 4YHYB 2XKNB 3IXTA 5I1GL 1UB5A 1CLZL 5DMIH 1ZGLP 2Y1VA 5HVGB 3L3HA 2C26A 4NKOA 4OSUL 2B7DT 1KCUH 1ULVA 4PGBA 2R2EA 4KROD 3U48A 4HJJH 3T77B 4YK4C 3EJJX 1T7VA 1WBXB 4M6OL 4Q74A 4RMQA 2R0KH 4L5FL 3V0WL 4LKCA 3BIKB 3TPUA 4PGZA 3EW3B 4ZYKA 2FLBT 4GW5A 3G6JB 4L1HA 5DQDH 5DD0L 4G8IB 4U1LA 3GI9L 4IOFC 3EYVA 4YK4B 4OUOA 1F6FB 1DQDL 1IAII 4D9QD 3I84A 4N8CL 2AABH 1T1XA 1D9KD 3LHPH 2WINA 2YRPA 4PS4H 4R7DB 2KUTA 5CGYC 2DQDL 1J1OH 1FGNL 1N4XH 1V7NH 2ITDA 3C60A 3SGDI 3QEUA 4DW2H 5KG9B 3VCLA 5E4EC 4OLXH 1IL1B 5F1KC 5IR1A 4MSWB 1VGEL 4J12A 3O3DB 3QIWD 3O4LE 2JB5L 5JHLL 3QWRA 3KPOB 1BQSA 5FYJD 3ZKMC 2C7UA 3UMTA 5E4EB 1UQSA 3QNYA 3O6KH 1I9RL 3IS0X 4O2FB 4AQ1B 4XWGL 2AV7B 3WUZA 4KKNA 4RA0C 1Y6KR 2BDNL 3OX8B 4M1GH 2R0ZH 5F9JA 4YPJA 5IEKB 3QO1B 4PJEF 4KAQH 3VXMD 1GC1H 5HHVL 3N06B 4PJEA 3QJFA 5DFTA 4OIIL 3VMOA 2BNQB 5I1LB 1FVCB 1FORH 1MCQA 4M4PA 4ERSL 5C0BB 5F44A 5EWIL 5E03A 4WY7H 2AEIT 3D39B 3HZVB 3GIVA 4R9HA 1BJMA 2XTJC 3SE8L 4JY6B 4LSQL 1Z9OA 1QFHA 2OTPA 3SDAC 1P6AB 2VXUL 1INEL 1LO3L 3EDEA 5SV3A 2ZKHH 3IRPX 4Z7WA 1U3ZA 5F9DC 1P9MA 2CR3A 1E4XL 3CCHB 2XTJB 4IHOB 5D5MB 2FH6A 2IGFH 4M61A 4KJQD 3UTTE 3SDAB 4F7CA 4LSUH 1R5IB 4M9PA 4QHLA 1X5ZA 3KYOA 1CD1A 1MWAH 1N0XL 2D7TL 4IRJA 2G75B 5C9JA 1T1WA 2X1PA 3QG6B 4RBPH 5A2KH 3BD5A 4X98B 5T1LD 1JRHL 5LQBL 3WFEH 3N1GC 5BRZA 4RZCA 4KUCF 1MREH 2IH1B 2I5YH 2DQGL 3QULA 4OFIA 3A6CH 2BOCA 2J3SA 4MNHB 5LJYH 2G9HA 2HT4D 1F90L 1W0VA 2QADC 1PG7H 3G04A 1V3LA 5IHLB 5D7KD 4Z76A 4DZ8A 3EAKA 3VD3A 1RZJH 3IU3B 1NGZB 1QEWA 2OJEA 3RY5A 3WFBH 3O8XC 5D7JC 1K3ZA 2QADB 5IFAH 3GSNL 3RKDC 2LAGB 5DJAB 2BOBA 5E6IA 2EZ0C 4XPFL 5KS9E 3T1FB 3BP7B 4FHBD 2NCMA 3O8XB 1LVEA 4QRSB 3X12A 1IC4H 3O4OC 3MLXL 3BT2H 3P77A 4JRWA 3R8QA 2FWOA 4ELKB 1SHMA 2YN5A 1G0DA 4XCYB 3O41A 3L5JA 1KCVH 3VFTB 1T0PB 2HAZA 1NL0H 4BUGA 3O4OB 2ADJB 5E2VH 4Z7UB 1N5AA 3QDJD 3HRPA 4YDLC 4YDKL 5E5RB 1MHEA 5T1MB 2P8MB 2BRRL 4HG4J 3L3IB 3UYRL 1QVOA 2H32B 2XN9D 5DXWA 1OLLA 1Q9OB 1PEWA 4YDLB 2BY0A 4JFDB 1IAOA 3MJGX 1MI5E 25C8H 1UACL 4L3EA 2BX5A 1IAMA 3MV9B 3RBGA 3B6SB 5DMGC 4YHZL 3GGWB 2X40A 1WAAE 4P5MB 3UTSD 2AKRB 4FG6D 5AYQA 3KXFB 1B2WL 1H0DB 3UBXA 3VW3H 5IVXE 3OJVC 1PLGH 3B9VA 3IB4A 3OKNA 1QKZL 2V7NB 4CVZA 3L3JB 4PR5B 3UPRA 2PYFA 3GHBL 4JHWL 4WW2B 5A40E 4MDIB 1NBVL 2V5MA 1GYAA 3RPKA 3WXVH 1MAKA 1BFTA 3HNTL 2PKDA 1NDGB 3GSVB 1I4FB 5M7QA 2D0HA 5DUPL 3RWDA 3QUXD 2M2DA 4P3WA 4PYGA 2DOCA 1P5UA 2DWEB 1MCKA 2K3TA 5C3LD 1NJ9A 5HYQA 4HW6A 3U36A 2MTPA 3QUML 4M7LH 1KLUB 4UDUB 4Y2DA 4YJZL 5I0DA 3QNXB 3ARED 1DE4A 2FEEI 1ITBB 1PZ5B 3W11D 4RGND 3T0ED 5LCVH 1QTYT 1BQHG 2LV4A 5ICXB 2YWZA 2I9TB 1F97A 2GTZB 4K3JH 1AD9B 4ONFH 5CWSA 4JR9H 1NKOA 4I0PD 1ED3A 4KUZH 5K9QI 1MQKL 3PP3H 4LLWA 4MJIB 2QHRL 4IOIA 2PW1A 1M05A 2VDRH 3HCVA 4ZMAT 2EIZA 2PN5A 4UNTA 1AI1L 5I74C 1HKLL 3ESVF 1NGQL 2IALA 1KIQB 4ZXBD 5DD1L 1FL3B 1NC4B 2OR7A 3PGFH 5I1HH 5DK0B 3SGJC 2RR3A 4GW1B 4EVNA 1QQDB 4J8RB 3HRZB 2VB5A 3T3ME 5FECA 3MJ7B 2QQNH 4S10A 2X1WL 1LNUA 3CFJB 5CEZL 3BYTA 4LRNH 2FX9L 1IT9H 2QR0A 1FG2A 3BEVB 2CLRA 2IAMA 1BQHB 3TO4A 3I85A 3KNBB 2FIKA 2F19H 1G7JB 3E1F1 2IMNA 1G7HB 5E9DA 1FZJB 5JLZA 3REWB 5JDSA 3D5OF 4ZPTA 4AK1A 4DTGH 4PJCF 3IVKA 4L3CA 3EYUH 3BWAB 4Z7NE 4PJCA 5HVWA 1A2YB 2X4PB 3V0AC 4AQOA 1Y18A 1P4LB 1L9MA 5AZEL 5FFLA 2VLJD 1JGUH 4M03A 1UWGL 4JKPH 4YH6A 4Q2ZA 5L6YH 5I1JH 2KQNA 5CBEA 3IGAB 2ZNWA 2QSQA 5I2IB 1PYWB 4M5YL 1MHPH 1IAKA 4JM2F 3VRIA 1HINL 1ZANH 5HHME 5EZJA 4M9OA 3RVUD 4EKXA 5EN2A 4JM2A 4PBVC 4ODVL 2OX5A 3O2DL 3GMQB 3GBNL 5I75C 3AXLA 4A6YH 4NM4H 3DX9B 3DWTA 4QOKD 1KPUB 3DV6A 4H1LA 4JG1L 5DDHB 4OZHB 1WJ3A 5I75B 1FL6A 4QXGH 2VZSA 4L4VB 2ITCB 5FOBB 5DJCB 4OKVA 4FZEH 2MPAL 4WUUB 3DNKA 1CTOA 3GSXB 2Q7NA 1R5WA 4RDQF 1DQJA 5DMJB 4M7KH 2A38A 2AXGA 3K2MC 1KCRH 2EDOA 2Q8BL 4RFOH 3BP5B 2E9WA 1A1MB 3FO9B 4JM4L 4KKCC 5HI4D 5IHZA 2NR6C 1S7RA 5AG9A 4LDEB 3MODH 3HMXL 4WTZA 2YPLE 3EO9H 2P8LB 2DI8A 5ESAA 3QXVA 4PJDA 1OLZA 4KWUA 3SDYL 3ARBC 1I7UA 2R0WH 3K81A 3LKRB 5ISZE 1CXLA 2EKSA 1XGQB 2DLHA 5IWLA 4GUPA 2E7MA 5AZ2L 4EI5D 4DN4H 4WO4D 5IMOA 1RUQL 4LFHG 2OTWA 4K94H 3TIEB 4NNPH 4G9FE 1OM3L 4J2XA 4PJFE 4FFWD 3BGFC 2UZIH 3E8UH 3F62A 4KJWC 3OL2A 3MNZB 2YBRA 1OW0A 2VYRE 3VFVA 4YAQA 3Q1SH 1F5WA 4G6FD 4HS8L 4R7NB 4JLRA 5DO2C 1OTTC 1AC0A 3NCMA 4OGXH 4XP1L 4TUKH 2B39A 3BGFB 1A6AA 5IV2A 2Q20A 2V5RA 3V7AG 8FABB 1KGCE 3GSOB 4KRMB 2DQUL 2ARWA 1LO2H 4Q9QL 3TFKC 2XZZA 2EC8A 2FB4H 3PL6A 1AY1L 3NPZB 5E99H 4HIJA 2W1NA 2Z35A 5CLTA 4LVOB 4P2QA 2O5YL 4FQXC 5J9PA 3MGTB 1KJ2A 2A6KB 4JHAH 3W81A 2IFGA 5ICZB 5EZLB 3D2UB 3V5KA 2W9DH 5CKGA 1BBJA 3V5DB 3X3FH 4FQXB 1JRHI 3ARRA 4P57B 1WQVT 3GBLA 1AR1D 3BMWA 2E7LA 3O81A 4MMXC 3MRGB 5HDBE 1F45A 4HXAL 4KMTH 5J4MA 4OCWH 3B9DA 5DT1L 5HYFA 2O5ZL 3ROOA 2WNGA 4JVUA 4PBWD 3OKKA 5DURB 4D0DA 5EBGA 3D3VD 1XCTA 2J6EL 2V17L 5ALBH 1EUUA 2EDFA 5T5FH 3K4DA 4TUJA 12E8H 2Q3ZA 4QRRA 1NLDH 3S3PA 1N6QL 2X4QA 3RVXD 1KXTB 1Z6JT 2ED7A 1MPAH 3NA4A 4L8DA 4DQOL 1JHTB 2D03L 5H35B 5DJXB 2NYYD 3N9GH 3ZL4L 1I3RA 3NN8A 1M71B 4LEOA 2YUWA 4LCYA 1A47A 1GSMA 1N3NB 1IGCH 1U2HA 2A9NL 4NQXB 5HYIA 1I1FB 3BPLC 3CZFA 2OXGA 2O93L 4MD0A 1HHHB 3Q2CA 2J12B 4TPRL 1BVKA 4XNUL 2M26A 4AG4L 5F7KC 5FEBA 2VE6A 5I76A 1CGXA 4LLVA 4PP2B 2IQAB 2MQCA 3MRQB 4NKMB 1AFVH 3TJEL 4PGCB 2ESVB 3REVA 3WSQL 2FHFA 2NY4C 2BC4A 4XT1C 3T0BA 1MLCA 4DGIH 1XF3B 5DJZA 3M1BB 3QDMA 1OGTB 2XPGB 3B43A 3FFDB 1MCSA 3NIDF 1OAUL 3ALWA 2FL5B 3MJ8B 1G7MB 3ARXA 1MCOL 2NY4B 1YMHB 5EIIB 2V9TA 2VDLH 1ZLVK 4PRPE 4YIQA 1I7RB 2DTSA 3HR5B 4YUEH 2CIKB 1MWAB 3QEQD 1AQDA 2XZCH 1RV6X 4R6UA 4E41E 4H1LH 1IARB 5FGCB 1OGAE 1NDMA 1DN2A 1RU9H 3W39B 2HJKA 3NCEB 3CFCL 4XVUC 1IC7L 1KFAH 5FUZH 3FQXB 3VRJA 3FTGB 3MZTA 3KJ4C 1I8MB 4NQVB 1OAXH 3QIUD 4JB9L 2NW2B 4HK0B 1HHJB 3PV6A 1NCWH 4LLYA 1QHOA 1UT9A 2X10A 1PDKA 4O5LH 1P2CB 3PG2A 4L9DA 3RU8H 4NC1E 3KS0J 1PQZA 3C5ZC 1T66D 3U4EA 1JGVL 1IGIL 1KLGA 4LHUD 2YUXA 3MV7A 2HMIC 5HPOA 2FR4B 3QUKA 1YUHB 5DRWB 3F7VA 5C08D 4PFEA 3C5ZB 1ORSA 2M1KA 5C07B 1FO0L 5LGHL 3WIHL 4D3CH 2XWBA 2MKLC 5DD6B 4UT6H 3IETB 3NFPA 3QCTH 4O2CB 3WE6A 3O3EB 5K33A 5IFJA 3OB8A 1CICA 2QBWA 2I9LB 1WZKA 3FZUD 2Y06H 2YSSA 5F3BA 2Y6SD 1NPUA 4P2OD 2EYSB 1KIPB 5GSRB 3HFMH 4NNXA 4X6DE 1LDPH 3IYLW 1F13A 1D7FA 3H9HA 1UB5B 1A7PL 1FE8H 2Z31D 1CGSL 1MAML 1A6VL 1CD0A 5IOPB 3K2UH 1PSKL 3ULUF 3L3HB 4NKOB 4WEBL 1MVUA 1KCKA 2E8YA 4PGBB 3QQNA 2R29H 3EFFA 2C4XA 5E8OA 3TPUB 4DKFH 2XA8H 1KJ2H 1HDMA 4LSVH 4ZYKB 2ZOLA 3X17A 1YQVL 2A0LC 3UTZB 4U1LB 3MFFA 4W70A 4PG2A 4ZO8A 4K8RH 2WP3O 3EGSB 4OFPA 1ITCA 5DEGB 4PJGF 4OCXL 1C5BH 1P5VA 4MLSA 2WINB 4PJGA 3TN0C 1RVFL 1SEBB 1JTPA 1QO3B 1MRDH 3CFKA 4HDIB 4L3AA 3C60B 2H3NB 2OMBA 3PWVB 1CI5A 1AE6H 3H42H 3TN0B 1E4WL 3MPCA 2Z92B 1R3HA 3RFZC 1VGKA 3OZ9H 4U1SA 2B1HL 1UQSB 3EYSH 1S8DB 4GXUM 3HMWL 1VFUA 5GQBA 5F9JB 2O61A 4JFXA 4JZOA 3QXDA 1RZ7L 1S7VA 1TZHA 4OLVL 2XZAH 3D85D 4OQTA 4PJEB 1UYWH 2ZG2A 3KPMA 4GAJL 1G9NL 3QJFB 4NUJA 4CW1A 1GIGL 4R8WL 1J12A 1CL7L 1SJXA 1MSPA 4JPVH 1RJLA 3SDCA 2YXFA 1CR9L 1KXVC 3LEYH 3O2VH 3KPSD 3I6KA 3AVEA 5CP3H 4WFGE 3ARDC 3NA9H 5TPWL 4ZDHB 3SO5A 3WIIH 4ZUSA 3GIVB 3CXHK 4LCWD 4LASL 1RFDL 2EDNA 3L5XL 5L8LB 3D0LA 5L8KB 2CQVA 3MACH 1TPXC 4MNQB 5IBTL 4X80L 3FN3A 3NTCL 5CUSL 2JK5A 4R97C 3GI8H 5AAWA 3V0VA 3ARDB 3PE9A 4Z7WB 3UC0L 4XP4L 4OLWL 2X1OA 1FZOA 1M6OA 4M61B 1TPXB 2Q8AH 4ZS6C 2C3XA 3QXTA 4F7CB 4FP8H 1QRKA 3RUGE 4R97B 3QG7H 4LU5H 3LKNA 3ZTJH 4QHLB 4Y5XC 3KYOB 3VI4E 1CD1B 1NGPL 4P2RA 2YMXH 4IRJB 3E6HB 4H8WH 3GK8L 1T1WB 4EQ2A 4LL9A 3BAEL 4X7TB 5EUOE 5KZCB 3FB6A 4Y5XB 5BRZB 3DMMC 4RZCB 1KC5H 1W2KT 4L8BB 5DWUL 4NUGH 4ESKA 4B7LA 2BOCB 1QNZH 1F4XH 2Y23A 2C1PA 4KV5E 2HRLA 3G04B 2I07B 1CYGA 5BZDA 4Z76B 4S1RL 5E6IC 1CXHA 3NFSH 3ZKSD 4BFIB 1QEWB 1T4KA 1X5HA 2OJEB 1MJ8L 3UBXG 1S5HA 1NMCC 1M4KA 2C3VA 1JF1A 5TFSL 3MLSH 1BQUA 5T1KA 3QCVH 2VLLB 5JW4Q 5E6IB 4U7SA 4NKDA 3SQOL 1KYOJ 1HH9B 2IQ9H 5TH2A 2DQIL 2E9IA 2UYLA 1K6QH 3ARGC 3GRWL 4PJ7F 3P3YA 4A6YB 4LGPB 3P77B 1KN2H 5E1AA 4RMWA 4WFHD 3FMGL 5SWSA 2DICA 2ERJC 3R06A 1XGYH 1ACZA 4Z0XB 2X9YA 1KTLA 2VZVA 1ZT1B 1TJHL 5GS0L 1N5AB 2EDEA 1P4IH 2V9QA 4PJXF 4QXTA 4BM7A 4LPXA 4PJXA 4XI5C 4IRZH 3FFCE 1Q94B 4K9EL 1QVOB 1T2QH 3O6FB 3L6FB 3SKNA 3MNVA 3CZJA 4U3XA 4NYLB 5MP6H 2R2CA 4UT7L 5C2UB 2DIAA 3OHXA 1U3HC 4JRYE 4ORGB 5C0AE 32C2B 1F4YL 1F58H 3N1MC 1TVBA 2HKFL 3GKWL 1KTDA 3LH2L 4TTGA 4ZTOH 4GRLA 4XPBH 3NCCB 4Z78A 5IW6A 3L95B 1U3HB 5CSBA 4S1DD 1IILE 3UJTH 4CVZB 4FQPA 5KSAC 1MCPL 4F7PA 1RULH 3FB8A 4FMFA 5ADOL 1A1OA 1D9KA 5EU6E 3KLAA 3ARFC 1HYSD 3GSNA 1NBZA 4NWTH 2R69L 1ZHBB 5DRNA 1Q38A 4GMTL 4J1UA 5FDYA 2LQRA 1KCSH 5T3ZL 4Y2DC 4OFYD 5IJKC 4X9BA 3G9VA 5E7BA 1T2JA 3BRDA 1SEQL 3IRZA 3QIWA 4YQXH 3BKML 4QRPE 5LBSL 4LQFL 3U36B 5E8DL 4JEGB 4Y2DB 4AIOA 5A16A 4UTAL 3MCG1 1T0NA 5I1KH 4X0KA 3VXSB 1DE4B 4HH9B 1NBQA 4LNRB 1S7TA 3VD5A 5CS7A 4KHTH 4YGAB 4Z7OF 1WZLA 4WHCA 4OLEA 3T0EE 3VXMA 3BPCA 4LHQB 3HZKB 3F6LA 1DBJH 1T1YA 4PRID 4MX7A 4HH8A 4BZYA 3UJIL 5T3XE 5F97E 1JP5A 3V6OA 4OKDA 4PJIA 2NY1D 1TQCB 3VMPA 4H20H 4OQTH 3HE7C 4HCRL 1JGEB 3KLSA 4MJ5A 4LLWB 1TJIL 2X4OA 2BY2A 2XRAL 4HWEH 1M05B 4LGSB 3WNKA 3HCVB 2EIZB 1CQYA 2ICCA 4EUPH 1E6OL 5EOQL 2EDXA 1KTRL 4P46C 1EBAA 4PTTA 4WTXA 4YBHA 1J0YA 4HBCL 2DBLL 4KK8D 2HFFA 3O3BA 3CMOH 4EVNB 1CFTA 4DVRL 1AP2B 4WRLA 2KZ1B 5L7XL 4QHKJ 1DQLH 1KLFA 4P46B 3GMMA 3GO1L 1U58A 5FYLH 1J86A 5HHOA 2QSCL 2W92A 4KQ4L 3BJLA 1PY9A 4GAFB 3RL2A 5BV7L 2IPUG 2VO5A 4PRAB 3I6LE 1FG2B 4XNQB 2WBWB 1U6AL 4D94A 2UY7A 2EKJA 2FIKB 1VFAB 4XVSL 1T20A 1RUML 2YK1L 1OQXA 4H1LG 1KG0B 2MNUA 2R1XA 2XWTB 1JPSH 1GAFH 4H25A 3FOMB 1ADQA 3ARYA 4PIRF 4ZPTB 5JDSB 2D7PA 3ES6A 4FXKA 4WI9A 5F88A 3BZEB 1Y6MR 3FT4A 4RRPG 3CIQA 3IVKB 5DFVD 2BDNH 1IGTB 4JFYA 4PLKD 4PJCB 1XGRA 1UJTA 4X6CE 1G6RA 3U6RB 2VRAA 4RDQG 3SOBL 3OAZH 3P9LB 5FV1L 5AWNL 4I77L 1Y18B 1T5WA 2A6DA 3JWDL 1NCAL 1YC7A 5I1AA 3EOBB 1WZMA 5CBEB 4LLQA 5EWIH 1Z3GH 3BD4A 4R4NC 1KELH 2FRGP 3HI6H 3VRIB 5JDJA 4JM2B 3OR7B 5CD5D 3QQ9D 5C0CE 3CVIH 1MIML 2VUYA 3OGCA 4XCCL 1H8NA 3Q6GL 1ZSDB 4LARH 1Q9KB 3EYOB 4RQQB 5IK3A 3QDJA 5KAQF 3TVMC 2AK1H 2LABA 3DV6B 1K5NA 3BGMA 4H1LB 2VZUA 1P1ZA 1Q1JH 3MV8D 1FL6B 1OP3H 4DGYH 1J8KA 2DDQH 3MXWH 2XN9A 4OKVB 4M6ML 4APQD 4UDTA 1J0KA 3TVMB 5I6XC 1R5WB 2YEZB 3TT3L 1IKNC 2XQBH 2DIJA 1DQJB 1R3IL 4NKQB 2EH8L 4M1DH 3IJSA 1F4WL 1LO4H 1GHFH 3HC3H 3UTSA 4PLOB 5K9KB 3A67H 1P53A 1VA9A 1MRCH 1IKFH 3OJDA 1S7RB 4OCRH 4ODUB 4FA8A 3MRCA 3OXRB 4ZD3H 3WFHA 5EC2B 2EC9T 5I8CA 4PJDB 4G6JH 4OLYL 3P73A 1I7UB 2BVOA 3KPPA 4I3GA 4ZUUA 1CXIA 5H94B 3INUH 5KVGL 2FZ3B 2Y4SA 3MOAH 4Z0BL 2XY1A 2FSEB 5DFWH 3GMPA 5IMOB 1DL7H 3SBWC 5TGBA 2Z4QA 3ARWA 3K0WA 1CT8A 3O2DA 1CL7I 2AEPH 1Z2KA 1X5IA 1T2XA 3MLXH 3Q48A 1HCFX 1A6WL 4KI5F 4YAQB 3VFVB 2AAVA 3W9EA 4KZEH 4JLRB 3RL1A 5FYJH 4U6VH 1TETL 4JFPA 2W0PA 1U8KA 3BKCL 3FQUA 2Q3AA 2R0LL 4I0PA 3UTQA 3UTPD 4YPGA 4L8CB 4LSRH 3W2DH 1FNEB 3D25A 3HTLX 4WU5A 3QI9C 2Z35B 5J9PB 4P2QB 3H8NA 1BGXH 4I18A 1HHIA 1KJ2B 2BSTB 5BZWB 4NWUH 3LQMA 1F42A 1P84J 3MCLH 3QHZL 3V5KB 5KVFH 5B39A 3DGGA 4ZXBA 3V8CA 1WZ1H 3QI9B 3UAJC 1MJJB 5D96B 4FQHA 4XAKE 4HKZA 4X5LA 4ZUTB 3OF6A 4P5KA 3WKNA 2Z93A 2BY1A 3QDGE 5I1EL 3M17B 4C59B 3CVHH 5EA0H 4HMCA 4TUOA 2I60H 5BXFB 3FRUA 3GSRA 1NH6A 2JJVA 2ZUSA 1A3LH 2IC2A 3MRKB 3NFNA 5I8KH 4M00A 4XP5L 3ROOB 5GXBB 4JN1L 3EOAA 1CLYL 4D0DB 1XCTB 1KYOK 5ID1B 4NQCD 3F7RA 2SEBA 1Q0YL 4HIXH 4TUJB 3RA7H 2EICA 4LLAA 3ZTJG 3B4NA 3GBML 4Z7QE 1U8OB 1MNUH 1ZA3A 4ACPA 5C1MB 3G6DL 3QFDA 4IM8A 3EKCA 5EZIH 3WL9B 2JB6A 5EO1B 4X7CC 1I3RB 1AO7D 2BY3A 1ADQH 5I8OL 1JIBA 2DBJA 3MLTA 4JKLA 3UO1H 2NXYC 4YEFA 1J18A 3EFDL 4MXWH 2G2RA 2VISB 5BJTA 2VLJA 4KPHL 3GSQA 1BVKB 5DD3L 3FT2A 1G6RH 3DPBA 1IJ9A 2GJ6E 2VE6B 4TVPD 3QB7C 2NNAA 2X05A 2NXYB 1MFAH 3FO0L 5JPNB 3JUYA 3MSPA 1FZKA 3MOBL 3P4NA 4LPVA 1QOKA 3KVQA 3N1FC 5EO9A 3WLWD 5MENE 3REVB 4G8GD 2NY7L 4O4YL 4IOFD 5E94A 1DQMH 3BDYH 1MLCB 1AKJD 1AI1H 3TCLB 5DJZB 3LY6A 1MCEA 3QDMB 4HUNB 3KJ6L 4TNWK 3C5SA 5TQ0H 5DD1H 3U4BL 3F65A 3FO2A 3IDGA 5CGYD 1KPRA 2VIRA 1U92A 3PABA 5CJQH 4MQXC 2D31B 1JHKH 4QOKA 5IF0B 4YHKL 3HC0B 5LXGL 4LP5A 5IIEB 1OD7A 3MRBA 1MJ7H 3DGCR 4QHKI 1OB1A 5H8DA 4D9LL 3VG0L 3LS5L 1EH9A 4KRPD 3ZKMD 4ENEC 5CJXA 2VLRD 1FC2D 1NDMB 3P0YL 4RBPK 5HGDB 2BNQD 4KH2A 4P99A 2OYPA 4NPYA 1FN4B 2YPLB 2W65A 5IESL 3VRJB 1NANI 4HMDA 4K7PX 1K4DA 4OF8A 4Y5VA 1C7SA 5ISZB 1RK0A 4RX4D 3BMVA 2BVUA 5IJVA 3I2CL 1ZLUH 3PIQA 2Z8WC 2HVJA 3NZHL 1I3GL 1UA6L 2BZDA 3UCRA 1NSNL 2MWCA 1PQZB 1UEMA 2XTJD 5GPRA 4EI5A 5GZOC 2PF6A 4WO4A 4ODBD 3U4EB 1EV2E 5FHAH 4N0FA 3SDAD 4JQXA 3GNML 5CIPA 1I9EA 5IT2L 1ZT4A 3JSSA 4FZ8H 4LVHB 4UT9L 3F7VB 1YEDB 3WXWL 5B3JE 5DHYA 1RZKH 2XKSA 4MCZA 3ZHLA 5J6HA 1YY9C 3Q3GA 5L2JA 5CILH 4OGYH 1BQLL 4PTUA 3TZVC 1CICB 5HGHA 2C3GA 4PGEB 2CLVB 4LSPH 2D3VA 3BO8A 1YN6A 4NNXB 4K23L 2VXQH 1I8LC 3MLPA 4ODWA 3H9HB 5D7SH 4HZLA 4K2UL 3CD4A 3NZ8A 3SE4A 2IBGA 1JGDA 1U8IA 4N0RA 3ZE2E 3HZMA 4HFUL 3MJ6A 1XR9A 1X7QA 1ZVHA 3EFFB 4FQ1L 4JDTH 4XPAH 2Q87A 3UZEA 1HDMB 4GRMB 4LSSH 1BMGA 2VAJA 2AEWA 2ZOLB 2NY3C 5D7JD 4ZPVA 1WFOA 1E4KC 1F6LL 1YEGH 4ZNEA 2CIIB 1DVFD 5DK3A 2PYEB 5IW1A 4EUPG 2EIBA 5HGBA 4XNXL 4NCDA 1XF1A 4KKLC 2YR3A 4KXZI 2NY3B 1ZWIA 1VPOH 2JJUA 4PB0H 4PREB 4U6YA 2EIDA 3ARSA 2NZ9D 3D3VA 2F53E 3RWIA 3V6BR 1Q8MA 1FO0A 5FB8A 3NGBC 3WIHA 2YKLH 5KSBF 4FXGB 2RIKA 1BX2A 5KSBA 3W0WD 3S6CA 1AIFA 1R3HB 3LKPA 3ESUF 5GISH 4JFDD 1VGKB 4U1SB 5DMKB 2ATKB 5H37H 3NGBB 1CD9B 5DGRA 2IBZX 4QRRE 3ROLB 2O61B 4JFXB 4JZOB 3QXDB 3DUSB 1S7VB 1TZHB 5FKPB 5LGJB 3P0GB 4QTHA 4OGAC 3MLRH 4NGHH 1FNGA 3IU4L 3FAWA 3U7WL 1U2CA 1QD0A 3HHRB 5IBLD 4OD3L 2EE2A 2VTFA 2EEAA 2N7BA 35C8H 1NGXA 1RJLB 3SDCB 3B2VL 5KSVB 4HUUA 1JNNL 3PP3K 2Z8SA 4MVBC 4EUPB 3I6KB 3WHE0 1I1AC 1KENL 1JUFA 3KPSE 2ZOKB 1AGCA 2AV1A 4I48B 2J8OA 4R90L 3D0LB 2Q76B 5JOPD 3UYOD 3S36X 2ZPKL 4N5EC 3STLA 4NCC2 1YEFL 2EDJA 2OCFD 1FL5B 3CK0H 4PRPB 4AMKL 4GG6E 1DLHA 2NTFA 3V0VB 2BVPA 4E5XA 5KANG 1RUAL 3ECBB 4FQQA 4XWOD 2HRPH 1V8HA 4WJ5A 3VWKA 2P1YA 1CZ8L 3UJJH 3H3BC 2JELH 4E41B 4ZSOE 3HPJB 4JO3L 5F6HJ 1T0MB 4KRNA 4V2CB 3LKNB 2DB8A 5GS1C 3NIDE 5HYJD 4LAQH 2HG5A 5F71A 3U1SH 4JG0L 1X5XA 4S2SA 1RIHH 4E0RA 1G9MH 5BW7A 5GS1B 4NOFA 4I3RH 4HF5H 4NC1C 4P23D 4TN9A 4UV4H 3RI5F 3AFLA 3LOWA 4HIHB 3ZL4H 2H6PA 1MRFL 4PY7A 3QIUA 3KAAA 1YN7B 1WIPA 4TQEH 2AI0L 3EO0A 2C1PB 2VDMH 3CH1A 1KJMA 1B4JL 5B8CA 1KUMA 2APXA 3MO1A 5CCKH 3ULVL 3MLYH 5JXAL 1VESA 3T0XA 1X3DA 1UKTA 1S5HB 5C8JA 2C3VB 5CBAA 5KJRL 3IJHA 5DEFB 4CVWA 2GFBA 4LHJB 4OCYH 3O45B 2ZUWA 5T1KB 1JGLL 4BQ8A 2X4UB 2NX5E 2AS5M 5C08A 4NKDB 3HZYA 4GG8B 5CIPH 2CKBA 3H0TB 2DLIA 4ZODA 2UYLB 3S88H 2C4FT 6FABL 1S5IH 5D7LE 2X4SA 3P9MA 3JV4B 5SWSB 3MV7E 3R06B 4QCIA 1KTLB 3SJVE 4LIQE 4U0QB 2FATL 4X6DB 1NKRA 4XCFL 4P2OA 4HIIA 4M62H 2COQA 4PB9L 1M7IA 4OV5A 4PJXB 4OB5H 4I2XB 4Z77A 1S9VA 4KROC 3NCFB 4YFLF 3TBVA 2UVEA 3GMNB 1LP9E 1GGYA 3PUCA 3SKNB 4V1DE 3MNVB 1T04A 1ZAGA 2ICWI 4OM1L 2O5XH 4KROB 2BK8A 4JZNA 5GGQL 3HNVH 1BEYH 1N64H 5A2LH 4GBXA 3HC4L 3P2TA 2HH0L 3KYKH 4JO1L 1TJGH 2CK0L 4ZS7H 1EFXD 1Z9SA 4I3SH 1E6JH 5GZNC 3EUUA 1GVIA 4XH2A 1W8NA 3FB8B 3VFOA 4F7PB 3ULUE 4EEEA 1A1OB 1D9KB 3CGTA 3DTXA 3KLAB 4DUWA 1NBZB 1S9XA 3PP4L 4HPOL 1I3VA 5DRNB 1QACA 3L5WA 5D7IF 3IF1A 2XWJA 1DN0A 1IGJA 4J1UB 1A3RH 1JNLH 5D7IA 4ZUWA 2OTUA 3IXAA 2FD6L 4NQED 2L7UA 1JF6A 3OR6A 2X2YA 3QIWB 1EFQA 2OJZH 5HDQL 4FFZH 3IKCA 4BH7A 3BH9A 5JIPA 5A16B 2OK0L 3U9PL 1HHGA 3VXQB 4J23A 4OIAA 4XAWL 4NBYB 4X0KB 3QUZC 4OCSL 1CG9B 2VXTH 3V6OC 3N50A 1UB6A 1IC1A 1MCBA 3ALPA 3MROA 5C0RL 3VXMB 3D85A 3BPCB 1FFOA 1OTSC 1N7ML 4PJBE 1BZ9A 2D9CA 2FHBA 1CWVA 1I7TA 4PJIB 2HLAA 4KK9D 4WGVB 5GS3A 2LE9A 1CFVH 2NR6D 1MAMH 2VDNH 5KVDL 1S7XA 2V2WA 4EBQL 4OZGF 4HV8B 3MGOA 4LCWA 2ZJSH 3H6JA 3ARBD 4OZGA 4P2YA 1PZUB 1FLTX 1AJ7H 4NQSA 3OMZA 4PTTB 5KVEH 5BS0A 2GK0A 3CVHB 1ORQA 5GGRA 3O3BB 4WI8A 4CMHB 4XMKH 1D6EA 1CFTB 1FIEA 1ZS8B 3NABL 3GMMB 5D2LF 2X70A 3LAFA 3TWCL 3M8OH 5D2LA 4QT5A 3ZDXF 1EA9C 1D5IL 2ZUVA 4X7DC 2ZCKL 1QBML 4O58L 5EUOB 5FYKD 5DO2D 5T1LB 2UWEF 1MHCB 4HS3A 1T20B 2UWEA 5EOCJ 2BNRD 1Y6NR 3BUYB 5DD5H 2UZYB 3X3GH 1XF2A 2R1XB 4HK3J 3V4UL 4EI6B 1CVRA 3FRPA 1FH5H 5F88B 1F02I 4MA7L 4RMSA 2CDEA 1G7LA 4NHCL 4F57H 3TFKD 1CE1H 1IAIH 1XGRB 3MLVL 4OZFA 2DQJH 1G6RB 4PJAF 2XKUA 1T5WB 4FQXD 1JZ8A 3B9AA 3H9SA 4HCRA 4PJAA 1OVZA 2BNUB 1VDGA 2QKIA 5I1AB 1QSEE 5C86A 5I18L 1TENA 4LLQB 4UOW0 1RURL 3QZWA 1U91A 3U7YL 1ZHKA 3BH8B 1JV5A 1KN4L 4F2MA 3TO2B 4HEPG 3NIGE 1WT5A 5C6TL 2W60A 1DDHB 1MHHB 4M02A 1OAQL 3TP4A 3PF2A 3OGCB 2CKBH 5IQ7L 4G7VH 4BUHA 1VFBB 4JJ5B 4XP4H 2DI9A 2X41A 2KDGA 3QDJB 5EPMB 5J0BA 4MQSB 5EO0A 2IPUK 3KPRA 3RNKA 2CD0A 1K5NB 3BGMB 2OQJA 2Y07H 4XPGH 2ZSWB 4PJ7E 1P1ZB 5IB2B 4O9HL 3MRRA 1NGWA 2XN9B 3S4SA 1YPZE 3EOYG 5EU5B 5TQ2H 2PUQT 1RHHB 1WC7A 1DLFL 2EYRA 4YHPB 5D93C 4FOMA 4RWYH 1FAIH 4MDJA 4C56E 5DRXA 3SKOA 1YNTB 1NCDL 3IJSB 3UTSB 4IOSD 2NLJA 1GGCL 3LRSA 5DQ9A 4L9LA 1A8JH 3OJDB 4NOBA 5IFHL 5D93B 5EU7E 2AK4A 5I66A 2P44B 4PY8I 3HPLA 3LDBC 4RAVA 1RIUL 3CXDH 5D70L 4MNGA 4G80A 5I8CB 1F3RB 1XF5A 2P42B 3QUXC 5TE6L 4ZUUB 1LDSA 2V7HA 3O0RH 1TDQA 1RZKC 4K7PH 5B39G 3LDBB 4WCYL 2G5BA 3MLWL 1UVQA 2KBGA 5KSUB 1S9YB 3AMKA 2FO4A 3QUXB 4I0CC 2X4TA 1Y0LB 1U8MA 3AREC 4L4JA 4OZIE 3QRGH 1U95A 4U3CA 3T0EC 2Z4QB 5CJ8A 1CT8B 5CZKA 3OBAA 1EJ6A 4NDMA 5DJ8A 5DMIL 4HFWA 1CDIA 1G7QA 3AREB 1MH5A 1RZIB 2Z8VC 3ZTNH 1XGTA 1KCUL 2MJWA 2X7LA 2H26B 4NQDE 1ND0A 3W9EB 3MGAA 3LPWA 3T0EB 4HJJL 2R0KL 3TBWB 2YD3A 4JFPB 1RZ8A 4PRIA 2X4RA 5H37G 1ERNA 3JTTA 5DQDL 3CJJA 3RTQD 3G5YA 3IFOA 4I18C 4I0PB 1GCFA 3C9NA 7FABH 1T3FB 3B9KD 2AABL 3LHPL 1MUJB 4L8SA 4M5ZH 5EBLA 4PS4L 5TDOB 4WU5B 4JFQA 4IRSD 2HA1A 1C5CH 3WJLC 2BVYA 3DBXA 1J1OL 1V7NL 1N4XL 1ZT7A 4I18B 5F7DA 5B38A 4XZUA 4DW2L 2XG5A 2Q86A 4U6XA 3DGGB 3MA7A 4ZXBB 3DXAE 1JYVA 2FGZA 2Z93B 3QWOA 3VRLE 4OI7A 5JORB 3LN4A 3LIZH 3H3KA 3O6KL 2HMID 4TUOB 4U1HB 3G08B 3GSRB 4HKJB 4M1GL 4OJFH 2R0ZL 3C5JB 2ADIB 3NFNB 1EXUA 1PKQA 1FYTD 4DFIA 2HJFA 3EOAB 4KAQL 5D72H 3CSYA 1NFDE 1MLBA 1OCWH 3T65A 3THMH 4JFFE 3UDWA 4HIEA 2DRUA 4EXKA 5ANME 1FORL 1MCWW 3RKPA 5CD3A 5HHOE 5GHWH 1N2RA 4WY7L 3U2SA 2VDPH 2WW8A 4U31A 4KKAC 4X6CB 3TJHD 1UJ3C 3SPVA 2DQTH 1MCHA 5F93C 1GZQB 3MLTB 4F9PA 3RGVC 1UXWB 4U49A 1K8DB 1WWBX 4HPYH 3SDXF 2G2RB 3K74B 2ZKHL 5BJTB 2VLJB 4OZFH 1UJ3B 3SDXA 2IGFL 3PWUA 2NNAB 1KULA 5ICYA 3RVUC 5AUMB 1XCQA 4TVPE 4M93C 4LSUL 2A0LD 5EO9B 4XNMA 5GGVY 1MWAL 5E94B 5DJYA 5C0CB 4PUBH 5EOQH 4LGRB 2EH7H 1JWSA 1NAMB 4M93B 3TN0D 2HJLB 3C5SB 4ZFOB 3QPQD 4OCNC 3WFEL 1HEZB 5D71H 5EZOH 3IDGB 3W9DA 4QY8B 1MREL 1KPRB 3RWCB 2I5YL 3PABB 2GITA 3ARPA 4QOKB 5ILTH 5L7XH 2M8XA 1BZ7B 3A6CL 5CJXC 1G9MC 4JZJC 3S36H 3MV8A 1PG7L 3OKEA 3F7QA 3WJJC 4CN1A 3BW9B 3DSFH 1RZJL 3O11B 5HI4C 4JZJB 5C09A 1QRNA 3WFBL 3L9RA 1RUMH 2R15A 4ONHB 3VFWB 1X4YA 5JNYA 5E2WH 5IFAL 1SQ2N 4NPYB 4DOHE 1NC2D 2IMMA 2VDQL 3P4OA 1EVTC 2YA2A 3DVGA 3PWPD 1VEPA 4NZJA 1IC4L 2X89A 4U05A 1KACB 4YLQT 1S7SA 3O2WH 3BT2L 4MJ6A 4URTB 4YZFE 4G43A 3PGCA 4MNQD 1R3LA 3O6MH 1PX4A 1KCVL 3ARDD 1HYRC 1NL0L 2NY2D 3IFPA 4FFWC 4YHLH 5JHDD 4I5BA 5E2VL 1I85C 1J05A 1I1YA 4EI5B 1A22B 4WO4B 1BHGA 3L7EB 4AEIH 3BISA 5F9AC 5CIPB 4N1CA 3RRQA 3V5HA 1ZE3C 4Q7DA 4JANA 2BSRA 3MJ9A 1QG3A 4YHIB 3IDJA 3PJSA 2DYPB 4OCMC 1QHPA 4IJ3C 4R96A 4ZS6D 1CU4H 5KW9H 4G6FB 25C8L 1RUKH 4MJ4A 5J6HB 3TIDA 3Q3GB 1JFQH 2WBKA 1RMFH 3P11H 2BHUA 4PTUB 3ARZA 2VDKH 5HGHB 4JY4A 4C83A 1J8HE 3ZE0F 4IJ3B 1PLGL 3IFLH 5DQJA 3BO8B 4LCCA 2X9WA 1JN6A 5GGSA 4YGVA 1YN6B 1OAZH 3DMMD 2OZ4H 4KI5E 3NMEA 1MIEH 4ODWB 5ENWA 2VSDA 3UPCA 2R2BB 2ARJA 4HZLB 3MCKA 3WXVL 3RZCD 4PGJA 1MCJA 2BVEA 2ZSVB 2GAZB 1U8IB 3HB3C 4NP4H 1LEKA 2W38A 4GRWF 4ZUVA 5HXMA 4CVUA 1HE7A 3WIFA 2BHYA 1O5DT 5ITFA 3QDGB 4Z18A 3DVIA 4M7LL 3CUPA 1L9NA 4Y0GA 4BK5A 5HGBB 4EXPX 2Q7YA 5CHNA 5LCVL 1V05A 43C9A 4Y4HC 2IWGA 4U6HA 4KVCH 2PR4H 3ARGD 1UWEH 4PRNA 5EDXA 4U6YB 1NFIB 3D3VB 3U0PA 3L3KA 4K3JL 4NQCA 3RWIB 4ONFL 1IM9B 3BXNA 4JR9L 2FO1A 2XKNA 3U9UA 4QYOA 4Y4HB 3PGDA 4KUZL 5DVNA 1BX2B 4L4TE 2GSIA 2AJYH 5GSVA 1INQA 1JWMA 2WQRA 3LKPB 4XI5D 4J3UA 5ETUB 3I9GH 2VDRL 1BD2E 1AO7A 4E42A 2IF7A 2P5EE 3DRQA 3MYJB 3UP1A 2EXWD 1CXFA 2F5AH 3DHJA 3PGFL 5I1HL 4QTHB 2GJ6B 4XX1E 1U3HD 3BKCH 2A77H 4UINH 5J7CC 1A7QH 4NJ9H 4AY0A 2IJ0C 5JMOC 4DK6A 5MENB 3MTRA 4CN6A 1NGXB 5IROA 2QQNL 4G8GA 4ELMF 5FK9A 4B41A 4LRNL 5KSAD 4X6EA 4ELMA 4F8TA 1AKJA 1IT9L 1JUFB 5KG9A 5F9OH 1N6UA 1AGCB 2AV1B 3ARFD 2MKWA 3FQTB 3O4LD 4MSWA 2FLRT 15C8H 1X5JA 5ESQB 2ZUXA 2F19L 3STLB 4U1GC 4LHUG 2NTFB 3KPOA 2JCCE 3BDBA 4DTGL 1WFTA 3UX9B 4A2LA 4OV6F 4LLMB 4WJ5B 4R4FH 3QEQB 3C8HA 3EYUL 4U1GB 3OX8A 4TYUA 3TYGH 2J88H 4N9GA 3QO1A 4JDZB 1H3XA 4EDXA 2VLRA 1VEMA 3TNNA 1KIUA 2FYYB 1YJDH 4ISVA 1JGUL 4S2SB 5F21B 4JKPL 2BNQA 5I1LA 1ZGLA 1FVCA 1AGFA 4E0RB 3BDXA 5L6YL 1FFQA 5I1JL 4LPUA 4KDWA 1DUZB 5B8CC 3D39A 3HZVA 3SGKC 1HQ4B 4XCEB 3TBYB 4PY7B 3QIUB 2WQ8A 2YD8A 1MHPL 2UV3A 4RX4A 3EO0B 1ZANL 5GS2D 1NCCH 3HE7D 4MA3A 1KJMB 1UXSB 4JRXE 5B8CB 4TTDC 2PETA 1U3JA 3MO1B 3OAZK 4GW4A 2A73B 3F5WB 4A6YL 3CCHA 4NM4L 4OM0H 3RX5A 4ZO6A 4IHOA 3UTTD 1NCBH 5C8JB 4LHUB 2PXYC 3SDAA 1SMAA 2GFBB 4IMLA 4ODTH 4RMRA 1TCMA 1R5IA 2UZXB 3WUWA 1CXEA 1T5XB 4QXGL 5C08B 5ACLA 2WMPA 3HZYB 2ZG1A 3DVNB 4FZEL 2G75A 5FYJU 3QG6A 3VDBA 3QHFH 2Y6SC 1UG9A 4M7KL 1EZVX 3MJ9H 1ZA6B 1ES0B 3P9MB 1XAUA 2WWKT 4HAFA 2WZPD 2IH1A 4KZDH 1KCRL 4RFOL 2Z31C 1DZBA 3MODL 5FHBH 3EO9L 1M7IB 4OV5B 4Z77B 3G6AB 2LVCA 2MOVA 3TBVB 1HI6A 1OP3K 2R0WL 2Z31B 1NGZA 1ZHLB 2J8HA 5B4MD 3PHOB 3EJZC 4OBRA 4KMQA 4DN4L 1WF5A 4LRIA 1QA9B 4DKAA 2AJXH 4BFEA 4K94L 4NNPL 4KI1A 3T1FA 3BP7A 5CEYA 4K7PY 3O8XA 4QRSA 5D7JA 3LQAH 4C4KT 4I9WE 4F33A 4ZNCD 1KNOA 1DVFA 2UZIL 3E8UL 4GRWH 1LK2A 1XIWD 4ELKA 1Z0NA 2FHCA 1BECA 3OG6B 3VFOB 3Q1SL 4FFVD 3KLDA 5HPMB 3VFTA 4OGXL 1OWWA 4R4ND 4TUKL 1S9XB 1QPPA 2F53B 3B5GA 2ADJA 2OI9C 3IF1B 1IGJB 1YEIH 5K9OB 2A83A 4ZUWB 4Y19E 1UZ8A 1UC6A 1SBSH 4U1MB 2EDBA 3RY4A 5T5NF 3L1OH 2FBOJ 2APBA 1LO2L 2OI9B 4AEHH 3W0WA 3LS4H 3VG9C 1MI5D 3IKCB 3TVMD 2FB4L 3BH9B 4PJ5E 4QWWD 4JFDA 2JJSC 5E99L 5FCSH 1HHGB 2VL5B 1VEOA 3B6SA 4OQ1A 1CLOH 4JHAL 3GGWA 43CAA 4P5MA 4ZTPH 3VG9B 4OF3A 3KXFA 1H0DA 2W9DL 4FABH 4UIKH 5BVJB 3X3FL 2K1MA 5A3ID 5KSBE 1CDHA 2V7NA 5IMKA 3L3JA 1UWXH 4PR5A 2ED9A 4KDTC 2NY0D 1PKOA 2QQKH 5D1QD 3QCUH 4CJ1A 3FRPG 2HLAB 4KMTL 5JIIA 4OCWL 1BF2A 1J9CT 3MRJA 3KPSB 4TVPH 1S7XB 4Z6AT 1QFOA 2V2WB 5DJ2B 1NDGA 3GSVA 1I4FA 3MGOB 4LCWB 5FGBC 4M4RA 3O6LH 1H15B 5ALBL 5T5FL 4GG6B 12E8L 2UUDH 1KB9J 2DWEA 1NLDL 1F2XK 5HTSA 3ARQA 4PJHE 2GK0B 2HYMA 3T0DA 1MPAL 4MWFB 4R4BB 1ORQB 4PV9B 2EDQA 3QNXA 5JUEH 1WTLA 3QZWG 3FHAA 3X11B 2P43B 4BQCA 3N9GL 1OSZA 1CBVH 1KB5H 4XNYH 1IGCL 5D2LB 5EB9A 5A2JH 2GTZA 4F7TB 1AD9A 4JFEE 1NCTA 1N8ZA 2QQQA 4HS3B 4PP1C 1NMAH 5K9QG 4CGTA 2UWEB 1IEHA 4CKVX 1AC6A 5K9JH 4MCYB 3N1PC 1S7WB 1AFVL 1XF2B 2BNRE 4B50A 3OG4B 4PLNC 2HTLD 1TNMA 1QZ1A 4DGIL 3S4SG 3SKUD 2CDEB 1G7LB 2YPKA 3EDDA 1KIQA 5F7LB 1FL3A 3QI9D 3H7BA 2YZ8A 2X1XR 1IGYA 1JL8A 2ZUUA 5I19H 4MJ2A 1QQDA 5CMAB 2VDLL 2VLME 4DGVH 1H8SA 3MJ7A 4YUEL 2YD4A 1LE5A 4WU7B 4FQJH 3UAJD 4DUVA 5EORH 3SGJA 3CFJA 3VI3F 2EEBA 4BSWB 1QSFE 4MXVF 1B90A 1JCKA 3BEVA 4MB5A 5D7LB 4F2MB 3ZYZA 3U4AA 5IEHA 1RU9L 2JJTC 3KNBA 4N0UE 2W60B 3C6LD 1G7JA 2F58H 4KTEH 5ID0B 3HG1E 1FZJA 4BQBA 5DI8B 1KFAL 5FUZL 3REWA 2EDHA 2F54E 4P9HC 1ZVYA 2CMRH 3WFDH 4NN7C 1OAXL 3BWAA 1LP9B 1A2YA 2X4PA 4V1DB 1NCWL 4NZUH 1P4LA 4O5LL 2HWZH 3S9DB 4F58H 3GKZA 3S4SB 4L9LC 4NN7B 3RU8L 4HULB 2WSKA 2HFEB 1MFCH 1CN4A 2PCPA 1MJUH 4MDJB 1OWRM 5F6IC 3SKOB 4R2GC 1JBJA 2NXYD 3CFBB 3WLBB 3LRSB 4L9LB 1PYWA 1HYSC 1WUNT 5HHMD 3JUZA 3B8YA 5CJ5A 1EFXA 5I66B 3HPLB 5F6IB 4RAVB 1B4JH 4Z7VA 2AW2A 5K59E 3DJ9A 3L7FA 4D3CL 2DKSA 3WDIA 1CDUA 4UT6L 3GMQA 3QCTL 1L0XA 1ZLUK 5B38G 1PD6A 2V7HB 3DX9A 1NGYB 4K71C 1J87A 1KPUA 1UVQB 4G6MH 2FX7H 4OZHF 1FCGA 4NJAH 1FRGH 1AD0A 4NQEA 1RJYB 2FO4B 2R8SH 4OZHA 1H3PH 5L88H 3HFML 3ZMRA 1LDPL 2ITCA 4YDIH 1U95B 3Q0HA 4K71B 1T03H 1WICA 2XV6B 1FE8L 1U8NA 4WDIB 4NDMB 5DJ8B 4HFWB 3K2UL 4D9RE 1LILA 2OL3A 1MH5B 4XHJD 5D7IE 5SWZD 4J3OC 4O02H 1I9IH 1ND0B 1RAMA 5DC0A 1UM4H 2VC2H 3FO9A 2YPLD 4QRTB 2R29L 1IVLA 1I8KB 2WWKO 1O0VA 4PJBB 4Y16C 4DKFL 2XA8L 1KJ2L 1RZ8B 4LSVL 4PJ8D 4PRIB 1OAKH 3JTTB 1CE6B 1MEXH 2F8VA 5ISZD 2NY1B 4NNYA 3H2WA 4WWKD 4K8RL 3LKRA 2QL1A 2UVFA 1UADC 1C5BL 2YOCA 3N0PB 4JFQB 4N0YH 3RY6C 2YC1B 1MRDL 3AMLA 4KK8C 5CSGA 3ARBA 4G9FD 5B38B 4UILH 4XZUB 3TIEA 1CDJA 4HHAB 4U6XB 2CSPA 4UQ2A 1AE6L 3H42L 3UZVB 3MA7B 4PJ9C 2IANE 4B0MM 4P5TD 1WK0A 2YD7A 3QWOB 4C4KO 3OZ9L 2YD2A 1D5ZA 2H9GB 3LN4B 4FRWA 4FTVE 4R7NA 3EYSL 4H26A 5IW3A 4PJ9B 3RDTC 4WI6A 1OL0A 1UH4A 3VD9A 5JW4M 1YNLH 1KGCD 2YZ1A 3GDBA 5FM8A 1R0AH 4QNPF 3HI1B 2XZAL 2XT1B 1U36A 3GSOA 1UYWL 1YY9D 3RDTB 1GOHA 5DFVC 4M48H 5T3ZE 4HIEB 4PLKC 3TZVD 1JYWA 1X5LA 3L3GB 1IEBA 2G5RA 3LEYL 3O2VL 4G5ZH 4LDLB 2DMKA 5ACZB 3ZDXE 3DRTB 2X42A 3NA9L 4K3HA 3WIIL 5ICZA 3D2UA 3SPVB 1KT2B 1FLRH 3V5DA 2BVTA 3MACL 2FJGA 1DP0A 4FQXA 1UZ6F 4YXLH 2NTSP 4P57A 3GI8L 1QSEB 1D6VL 5TE7H 3GSWB 2PO6D 4NO0B 4RISH 3KS0H 4JN2B 3MRGA 1G7PB 3H3PH 4W4OC 3PWUB 2YA1A 1T80A 1XCQB 3MLUH 2Q8AL 3ZHKA 2AJVH 3QQ9C 5CD5C 4FP8L 4MA8L 3QG7L 4LU5L 4XNMB 3UBXI 4GAGH 4Y1AE 3IDUA 4PJAE 5FO7B 1R3KA 5DJYB 1N59A 2YMXL 2PTUA 4H8WL 4KKLD 3T1WA 5SWQB 1BFSA 1A5FH 1JHTA 5H35A 2Y36H 5DJXA 2GITB 3R4DA 3WHXB 5F8QC 4APQC 5JW3H 4NUGL 4CBPA 2ZUTA 1M71A 5CZVH 1QNZL 1F4XL 4LLUA 2QTEA 3MV8B 1WGOA 4QLRA 3STZB 2AVGA 1X5AA 1L0QA 4APQB 5FO9B 1D5XA 2P5WD 5MEQB 1RSFA 1BJ1H 3NFSL 4EQ3A 1QLEH 1PFCA 4KGJA 4Q6IC 4IEFB 1CK0H 2IQAA 3KPRE 5C6PB 4JCMA 5JNYB 4NKMA 3QFJE 3MUJA 2WUCH 1F00I 3RNQB 4PGCA 3QCVL 5DVOA 4Q6IB 3DVGB 2IQ9L 1CCZA 3MXVH 4MA7H 1J0HA 3M1BA 1OGTA 1K6QL 1S7UA 2XPGA 3PWPE 1S7SB 1KN2L 5KN5A 3VFSB 4G43B 1G7MA 3V6FB 4MVBD 3LVEA 4YE4H 4PRPD 1R3LB 1XGYL 3NIFE 3LPFA 1E27A 1I1AD 3ZKND 4I5BB 2AK4E 4IIQA 5M95B 1I1YB 4OZIB 4CUCA 1P4IL 5AYUH 3IFNH 4N5ED 4E41D 4IRZL 3S3SA 1OGAD 5HDLA 3V5HB 4YHNB 3C8DA 2D0FA 1MCLA 4JANB 5GRWA 1T2QL 3OGOE 5J1AB 2R23B 4LF3A 3IDJB 3W39A 3RQ3A 2DLFH 5MP6L 3QDAA 2VR4A 1XZ0B 3RVVD 3B2UC