2KKVA

Solution nmr structure of an integrase domain from protein spa4288 from salmonella enterica, northeast structural genomics consortium target slr105h
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
b'MENSGAYTFETIAREWHESNKRWSEDHRSRVLRYLELYIFPHIGSSDIRQLKTSHLLAPIKEVDTSGKHDVAQRLQQRVTAIMRYAVQNDYIDSNPASDMAGALSTTKARHYPLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Solution NMR structure of an integrase domain from protein SPA4288 from Salmonella enterica, Northeast Structural Genomics Consortium Target SlR105H
rcsb
source organism Salmonella enterica subsp. enterica serovar paratyphi a
molecule tags Dna binding protein
total genus 31
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kkvA01
1Z19A 1DRGA 1NZBA 2HOFA 1CRXA 1MA7A 2HOIA 1A0PA 1Q3UA 2KIWA 2KHVA 1Q3VA 1PVQA 1OUQA 5CRXA 2KOBA 4CRXA 1P7DA 3NRWA 3MGVA 1PVRA 1XNSA 1KBUA 4ACOA 1XO0A 2A3VA 2KJ5A 1F44A 2CRXA 2KJ9A 3LYSA 2KKPA 2KEYA 2KJ8A 2KD1A 3C29A 2KHQA 2KKVA 2OXOA 3CRXA 4A8EA 1PVPA 3C28A 1Z1BA
chains in the Genus database with same CATH superfamily
3C5GA 4K4IA 9ICQA 1YT3A 1PVQA 1OXJA 4Y2JA 4MF2A 1X2IA 5L1LA 4OD0A 2E8MA 4RQ7A 4C8OA 2HSZA 3ISCA 4NLCA 1IV8A 3QEBZ 2E1FA 2FPKA 2G09A 2KMDA 4Z6DA 5KFRA 4QWAA 3PV8A 2AJQA 4PHDA 2JEFA 2DL0A 5IIOA 2V4RA 4DFJA 1MN8A 4ED8A 1HEKA 1MSWD 3RFAA 2PMZC 3H40A 5EOZA 4B6JA 1ZQLA 5DB8A 2ESEA 1FIQA 4GIBA 4NLKA 2A1JA 4GXJA 4KLOA 2KNJA 4C0ZA 2A1AA 1FO4A 2Q0ZX 4NL9A 2P66A 1Q46A 4OJPA 3F2BA 4F4ZA 3GU3A 3KKAC 2LI6A 2H3FA 5DDMA 5EE9A 3AU6A 4YFKA 3Q8KA 3NVZA 8ICPA 1PK1A 1OW5A 4PL2A 2H3ZA 4XQ8A 2WAQC 3D2QA 2VJ5A 3UXOA 3RAXA 1XO1A 4RNMA 4ED6A 2BCUA 2YX8A 2DGZA 4F5OA 2BZFA 2HHSA 3IDWA 4M9HA 4WJ3B 5AI9A 5HMMA 4YQWA 5KFJA 5EWFA 4KX3A 8ICGA 4JK1A 5DBBA 2EZZA 2H3QA 5AICA 3TAPA 4ICAA 2XGPA 1D9FA 3UQ0A 8ICZA 3HPOA 2P6UA 3HW8A 4JB3A 1ED1A 3BZKA 5B66U 3RAQA 2ZJ5A 4QZAA 5DG7A 3SAFA 2AGQA 2LMRA 3B9JA 2K8CB 2JH7A 1JI7A 3DV9A 5L1IA 3RB3A 4P0QB 5AK5A 4KMUA 5AKHA 4J9RA 3BQ0A 3EW9A 5J0YA 1S0OA 3L5KA 3TADC 3G6XA 4FBUA 2ASJA 5DGAA 4B9TA 1F44A 4OJ6A 1ZQWA 3G6VA 4IR1A 2YN4A 4DQRA 4NLZA 2HBKA 1K5OA 4I2GA 2W9AA 3PO4A 3SAGA 1SL1A 2WF7A 3QU2A 1X66A 3T5KA 1SKSA 2HBMA 4MEXA 2VA3A 1SWVA 2HBJA 2Y0SF 1L3UA 2ZTCA 3C5FA 7ICFA 3RJEA 5KTQA 4Y2PA 4F8RA 2ZIVA 4F5QA 4DL5A 1QQ5A 2NRZA 2YQEA 3MFHA 3HWTA 2DKXA 3IN5A 2C22A 4UAYA 1DXSA 5KNIA 3KTQA 1ZQMA 1A76A 5HHHA 2NRWA 3RJHA 4HAIA 4QZCA 2EH9A 2K89A 1L3TA 5AM3A 2LBOA 5ALGA 1S0VA 5J2BA 2OWOA 3SD7A 4FE3A 4DOCA 3PW4A 5CWRA 1ZJMA 1EXNA 8ICJA 2JH1A 4PJ0U 1HUZA 5J0UA 2W8LA 1L7NA 5AM5A 4QZBA 4BX9C 3NUQA 2OXOA 4RUAA 1UCVA 4O5EA 2C2DA 2E8NA 1X42A 1TAUA 1X9XA 1KDHA 2HI0A 4IRKA 4C4RA 2K8BB 4KX5A 2KN7A 3RJJA 4UB2A 3N7RC 4BUGA 3THVA 4JWNA 3KHRA 9ICCA 4XA5A 2L5YA 3C1ZA 2KKVA 3IG5A 2FPMA 2BHNA 2XI9A 1K1QA 4O3RA 3WKBA 4GC7A 4M47A 2RP5A 4R8UA 5DQIA 4TUQA 2IHMA 5KT3A 1NJWA 4DL6A 2DWQA 1JXLA 1L7OA 1ZQGA 2DPJA 2XC9A 4B9NA 3E58A 1ZQYA 1KW4A 1TK5A 5CP2A 2ZUBA 4UBBA 4KTQA 3A0BU 1RXVA 5KT6A 1TE2A 3C2KA 2F77X 4QZ8A 4F2SA 1A77A 2PI4A 5IIIA 1F0MA 5AM2A 2ASLA 1ZOLA 1N60A 1RM6C 2ZJ8A 3U26A 5HNKA 5J2AA 8ICLA 1L5UA 2O6KA 5KFDA 2PFNA 4QNLA 4Q8EA 4QIWC 5J0PA 2HW3A 2AQ4A 5IIJA 4IRCA 1JMSA 2MRLA 3HX0A 2KK0A 2XGQA 8ICWA 2W7PA 2KJ9A 2EAPA 5T14A 2YTUA 4Q8FA 3M8RA 1KKXA 2WAQF 1X6IA 1S8OA 3JPTA 1BPBA 5KFGA 2KE7A 3QEAZ 2A19A 2N1RA 5CEHA 2WF5A 5ALHA 3LVWA 5ALWA 3MGVA 8ICOA 3RJIA 3E0FA 4Y2QA 5BPCA 2W9BA 2YB4A 2KZ3A 5J8YC 3ZI4A 3H0MB 8ICEA 3PO5A 1RDFA 3GDXA 4IL6U 3PSTA 2AHOB 2IOFA 3M6KA 4LZGA 2HHWA 1JUDA 1D8YA 4F50A 1N62A 3EYZA 4IQWA 4YP3A 2W11A 5KT5A 3MGHA 2LPEA 4PHEA 1L6NA 1VDVA 3PMLA 2K4HA 3C28A 5AKEA 3QYPA 3RJKA 4RT3A 1SWWA 4KLLA 1U49A 2ZIUB 3HRDD 1T7PA 4BDPA 4F2RA 4CGZA 5CJ7A 2W04A 4E0DA 5D46A 2KJ5A 4QW9A 4RQ0A 1T3NA 1ZQTA 2RDIA 1KFSA 5J0QA 2AGPA 3FAHA 1U45A 5AKLA 4UW9A 2KSOB 3MR6A 2AQ0A 4IQUA 1KFDA 2M0NA 8ICQA 4F4WA 3QU4A 2BCSA 2K60A 2Q4TA 2UVRA 3TFSA 4O0IA 8ICCA 3CYMA 2YMMA 2KEYA 4MF8A 3ZDAA 4CF5A 1ZQIA 3UMGA 4C8NA 9ICLA 4ELTA 2XY6A 4IRDA 5AI0A 1KL9A 4IC9A 3PSFA 3RTVA 3JPNA 1SXDA 2R18A 5KFIA 3MABA 1JXEA 2JXJA 1BVSA 9ICVA 8ICYA 4O3MA 3PX6A 4B9UA 4OJOA 3T5JA 2BCVA 3LK9A 2IHNA 4DLGA 4AYBC 3N7PD 2QARA 3QE9Y 5DLGA 9ICFA 1QQ7A 5AKJA 3GIJA 2E3TA 5KFYA 4BWJA 2KTQA 2H5XA 9ICOA 4ED3A 4P0PA 1C20A 4CCHA 3CRXA 5HR7A 4KLEA 3H8SA 4PZOA 3OSNA 3H0RB 4O5KA 4OCZA 4R64A 2XVTA 4YXJA 1BGXT 1ZD5A 1S77D 3OHAA 3I1YA 1T4GA 5AI8A 3ZDCA 3SENA 2QLTA 2MA1A 4YMOA 5AI5A 3RH4A 1KLNA 4YXMA 2W9MA 2EAMA 5ALOA 4NM1A 3V6JA 4Q45A 3QU5A 1V38A 3Q8LA 2I5HA 1X9SA 5AKKA 3BZCA 2BGWA 3ISDA 3WK4A 3A0HU 2G0AA 2FLNA 3F2CA 2W3SA 3F5EA 3KKAA 1QCKA 3AQFA 2Z7JA 1U9LA 3ZDEA 3LYSA 5BOMA 5DLFA 4DWIA 2RHFA 4RQ3A 2EAOA 2NYVA 2BCQA 5J2GA 1NNLA 5KG7A 2PXIA 3GIKA 1Q3UA 1J2NA 4UAZA 3UPQA 3RH5A 1RYUA 5B5EU 2UVVA 4FZLA 4PGYA 4BXOA 2GOLA 4MEYA 2D3DA 3TANA 2G08A 5KL8B 3H8MA 4R66A 4YVZA 4FS1A 7ICIA 1UHUA 5ALQA 4ECRA 3HP6A 3MR3A 5AIBA 4QZDA 4CE6A 3E2EA 4KLIA 3I76A 3SAHA 2BPFA 1ZD3A 2HBLA 5KFHA 2W55A 2XCAA 9ICNA 3JPRA 4DSEA 1ZQBA 8ICSA 3CP8A 4A8EA 4R65A 5KFKA 5KFVA 3SV3A 3PR5B 5KFCA 5IIMA 3GIIA 5CHGA 4EZ6A 2YB1A 2K4EA 1RPLA 3L4PA 8ICRA 5J29A 4QJFB 3ETRA 4DEZA 5AI6A 2BPCA 3H8JA 4KLHA 1KQQA 3TADA 4M6WA 1XS9D 4OJ5A 3ETLA 2F3NA 4UB3A 4BWMA 4UB8U 2G07A 2HHUA 4UARA 5ALPA 2MAXA 1XSNA 5AK6A 1BPDA 9ICIA 4DFPA 5AKZA 2HHVA 8ICIA 4F4XA 4Y2UA 4RQ2A 4NLNA 2LHTA 1X9WA 7ICNA 2OHFA 2KJ8A 4DSLA 3V7LA 9ICGA 3MFIA 1SGGA 3TQ1A 3FM9A 5DB7A 9ICTA 4RQ4A 3LWLA 2ZIWB 2EDUA 3HILA 4Z6EA 4M04A 3M1YA 1ZQFA 5AKYA 2HCFA 4EEKA 2XO7A 2DPIA 1IXRA 4RZRA 1DGJA 2P6RA 3MR2A 4I2CA 2GWSA 3KD3A 1V85A 1WG8A 1ZRMA 3RBEA 3AM9A 3C29A 4F4YA 3QNMA 3N28A 2ZIXB 2KIVA 2EQYA 1D8LA 2MU2A 9ICEA 3K75D 4C4TA 2G5HB 8ICHA 2F1IA 5J0WA 2F2AB 4Z6FA 1QLNA 2XCPA 4ZOHC 4O9MA 3WK9A 3PVXA 4TQRA 1KEJA 2FMQA 4US8A 2F1HA 4QZEA 1ZQUA 1VLBA 3RF9A 1V97A 4FZMA 3AU2A 4QWDA 3BQ2A 2W03A 2JZBB 3PX4A 9ICKA 4J9NA 1RQNA 4YD2A 1S76D 4BJQA 2KIWA 4UBCA 4B9LA 3EWAA 3Q8SB 2ZIVB 2UVWA 8ICTA 4AYBF 3OHBA 4QWEA 4KN7A 1QQ6A 4UAUA 4IR9A 5J2DA 3T5HA 3RH6A 2LKYA 3VCBA 2JEJA 1XU4A 5DDYA 2K8AA 2Y9UA 5DG9A 1WWUA 1ZD4A 2F44A 7ICEA 2R8JA 3V72A 1N63A 4I2JA 4F5PA 2M9NA 3IG8A 4DL2A 2NO4A 4Y2SA 1HUOA 4JWMA 1K1SA 3SV4A 1QSYA 1AROP 1PUZA 4EBEA 2CXYA 2F1JA 5G5HA 5J0XA 4Y2TA 4F72A 5L1MA 4DQSA 4KLMA 1JN3A 2KD1A 2OCEA 4JMUA 1QTMA 3LDAA 3GILA 1L3VA 3KBBA 4I29A 4JUZA 1NK4A 2Y9TA 1X9MA 4MFAA 3M9NB 2J6UA 2ZXIA 1VJ5A 4KN4A 4QWBA 2NV3A 1J97A 5DKWA 4ACOA 1RZTA 2DBYA 4R8UB 8ICBA 5J2EA 3ORYA 2ZJAA 4M9LA 5DBAA 2P35A 2HHTA 1GO3F 3IV6A 5J8YA 1NK9A 4TUPA 2B6GA 1OUQA 5CRXA 5J0TA 4RQ5A 1L8LA 7ICJA 1SXEA 4KLJA 3M9MB 2HMXA 2VIXA 2MUTB 2NO5A 3UQ2A 1IG6A 9ICJA 4UAWA 5TZVA 7ICSA 2NRXA 1XC9A 2FI1A 3ZDDA 1L7MA 1NZPA 2R8IA 5GTHU 4M9GA 2IOFK 1XSPA 2PMZF 4C7ZA 4R63A 4DQPA 5EE1A 2DUYA 3I28A 5J2IA 5BOLA 1N5WA 5AHXA 3MC1A 4FZNA 2PFPA 2W9BB 4OJLA 3AN1A 7ICRA 1Z1VA 3ZD8A 3LVVA 2KICA 1JROA 3TI0A 2FLLA 3WKAA 1NI3A 3WK6A 3ZDBA 1SKRA 3RJGA 3MR5A 1ZXIA 3HT3A 3WKEA 3QU9A 4Y2XA 1TK8A 7ICPA 4RUCA 2W54A 1BNOA 5EWEA 1NK8A 5ALYA 3HKZC 3SYZA 3RB0A 3SR6A 4EYIB 1QSSA 2HOIA 2LYHA 3MDCA 1U48A 5L1JA 5EE3A 1LKYA 1Z4NA 3WK5A 1RYRA 2I6XA 4G3IA 4KITB 3D6JA 2BDUA 3JPPA 3Q8QB 5ALDA 4YR0A 4ELUA 1NZBA 5KFOA 4M0AA 1AQ6A 4DS4A 2GLEA 2HDOA 2J6TA 3WK7A 4RNOA 5H2FU 2D6FC 3FDSA 5AM4A 1Z4OA 2HOQA 5ALIA 4O3PA 2ZTEA 2QB0A 4O5CA 4Q44A 5ALUA 1N5XA 2RQ5A 2ISPA 4MFFA 2ZTDA 1QH9A 3B0YA 4DL4A 1CI4A 2R8GA 5J2KA 1JIHA 2CN1A 2I9GA 2W9CB 5K4LA 1SZHA 4KLGA 4RQ1A 1PVRA 2ZXHA 3CNHA 5DGBA 3PR4A 3BS7A 3KOOA 5KT4A 4YG2A 4EX6A 4Y2VA 3PZPA 4NLBA 3NS1A 1KN5A 5KFUA 2ODGA 2HHXA 4JV2A 1Z00B 1NJZA 2E1EA 4DSFA 1S10A 1HJPA 3QUBA 3ED5A 4XRHA 2HVIA 4DF8A 1N48A 5HR6A 3TFRA 2FE9A 4FFDA 2QARB 2AH5A 1WYGA 4C80A 1JALA 3L3FX 1XWLA 3S6JA 5J2CA 4Y2RA 1ECWA 1NKBA 2FJ6A 3BS5A 1DGSA 5ALLA 5L9XA 4C4SA 3NASA 4CRXA 5CA7A 4DS5A 4I2DA 5HMLA 4YD1A 4QWCA 4QZ9A 5J0RA 3PW5A 1S0MA 4ECUA 2IOHA 4RQ8A 3EPIA 3OPXA 3TACB 2HOFA 3FYHA 4KLUA 3NVVA 4C7YA 7ICUA 1DK2A 3C2MA 3RRGA 1ZETA 4DSKA 4F5NA 2KSOA 3WKDA 4DFKA 1N61A 1FFUA 2ZG6A 5KFSA 8ICKA 4CNQA 1BPEA 4DCCA 3NVWA 2F8KA 1KRPA 2JRZA 5KFFA 4PHAA 2YMLA 1NOMA 5DQGA 7ICGA 3V6KA 4DSIA 4DOBA 4GXKA 2VA2A 2JEGA 4DL7A 2AXTU 1D8BA 2WB1C 4CF3A 7ICVA 3UXPA 2E5SA 2BQRA 2WTFA 2KG5A 4G9BA 2LM4A 4BXOB 5IIKA 2JGAA 2Y0SC 4J9MA 2KOBA 4YR3A 3C2LA 4ED1A 2KFZA 1FEZA 3KHLA 2Y1JA 1XNSA 5KFBA 1XO0A 1NJYA 1ZQOA 1MQ2A 4J9QA 1D9DA 2KHQA 3OGUA 2KV2A 4ECYA 2QB1A 3BQTA 5KFQA 2C2EA 1BPZA 5FP0A 4TURA 4J9SA 3RJFA 5KG3A 1O08A 2F76X 2W43A 4PL1A 5KFZA 3SMVA 3V7JA 3T3FA 4P4OA 4Q43A 3PW0A 9ICWA 1JX4A 3QXGA 1HIWA 3EZ5A 5JUMA 5JRTA 3RB4A 3QUTA 5EE0A 9ICMA 4QIWF 5AKGA 2QKQA 2MSNA 1L8OA 3ZD9A 3C21A 2A1JB 1UPHA 4USAA 3G6YA 2JHDA 3PX0A 4F3OA 4PPXA 3TKAA 2BDPA 3M7DA 1ZQAA 4J9KA 3HKZF 5IILA 5AKXA 4RPXA 1CUKA 4ED0A 1COOA 1ZRNA 1PK1B 1YZ6A 2WF6A 2HHQA 2BPGA 1ZQNA 5KFEA 1PK3A 4LJXA 4ECTA 3H7IA 3KZIU 5A0LA 1MA7A 4GXIA 5D4BA 3OTQA 3H4BA 5ALKA 4J9OA 4UB4A 2DFLA 2ALZA 2NRTA 4MFCA 1ZQDA 2JV3A 9ICXA 4RQMA 5KG0A 5KT2A 3RRHA 1CRXA 5J0SA 3V7KA 9ICBA 5AK3A 2XICA 4IQTA 3NRWA 4NLGA 4DSJA 3DEEA 1WWVA 3IP4B 4NWIA 4F4KA 2BKEA 1FFVA 4ECVA 4YCXA 4EZ9A 1RXWA 2FMPA 4EYHB 3T5LA 3SQIA 1NJXA 4KLDA 5F9NA 2WFAA 7ICOA 3BQ1A 3QUQA 5J0OA 5KAFU 3PNCA 4KLSA 1C7YA 2FDRA 2G5IB 3QX7A 3F2DA 5KAIU 1YZ7A 1H38A 7ICLA 4UB5A 2C2RA 3D2NA 3MBYA 4YMNA 4K4HA 3H8WA 4J9LA 4QZGA 1ZQXA 2FMSA 4ZH4A 4DO9A 3RBDA 1TAQA 3RB6A 2BQUA 2ASDA 4KMOB 4P2HA 2EANA 2J6SA 2K4PA 3KHHA 2PI5A 2RRDA 5F3XB 3HJEA 3GIMA 9ICRA 4M2YA 5J2HA 4YMMA 1SKWA 4EBDA 4RQNA 3D2SA 1F5SA 1Z3EB 1ZQCA 5KFPA 4LVSA 1JRPA 2I1QA 1URJA 3MGIA 5AK4A 9ICUA 3ONNA 2W8KA 1RYSA 4DL3A 1B0XA 1B4FA 2CPRA 2ZIWA 1ZQHA 5DB9A 4QZFA 4F92B 1Z1BA 3GV7B 3AMZA 4EBCA 1Q8KA 2F8LA 4J03A 1TVAA 2ES6A 7ICQA 4PH5A 3Q8RB 2KHVA 1ZQEA 4FBTA 5G5GA 4GLXA 1TKDA 1U47A 1S97A 2ZIXA 1WCLA 4NL9C 4ED2A 4ECXA 8ICXA 1NKCA 5DB6A 5KFMA 4I2HA 1MQ3A 3H0LB 4ECZA 2WHEA 2BQ3A 3SZ2A 3BJYA 2WB1F 4CF4A 2UVUA 4NV0A 5AI4A 5J2FA 5C0YA 1O03A 1UQVA 2WF8A 4P0QA 1ZYQA 2GO7A 5HHIA 2KKPA 2JZBA 2R8HA 1KTQA 1T3QA 1RG6A 4OO1J 1Y88A 3OSPA 4EX7A 3K1RB 3UXNA 2KVSA 5KG4A 2DQNB 2YY6A 4UQGA 1COKA 4I2AA 2WF9A 3OJUA 1S9FA 3GFKB 4U6PA 4BGDA 5KG5A 4KLTA 1UA1A 4I2EA 4M9NA 2DKZA 1A0PA 4MHVA 2PFQA 1CEZA 2GH1A 5C5JA 4O3SA 4PHPA 3O0FA 3C23A 4NM2A 1DK3A 4IS7A 1SV0A 5KT7A 3EUB2 4UAVA 1SL2A 9ICPA 4EEYA 5JU5A 1ZJNA 1DRGA 1SIJA 4TUSA 3SI8A 8ICVA 4I2IA 4F93B 2AGOA 2BR0A 2VA8A 4AP9A 5AIAA 2D8CA 4TQSA 4DF4A 1KBUA 4I27A 2NRVA 3K1ZA 5HP4A 3J81j 4F5RA 3R9KA 4QW8A 4Z6CA 4B9VA 1ZQ1C 3Q8MA 3UMBA 1LKYB 5ALFA 2PFOA 4RT2A 2FPLA 4U7CA 3QUCA 1T8EA 1L3SA 3FC4A 2W7OA 2ATLA 3UM9A 5DG8A 4NXZA 2R8KA 3QZ7A 2XIDA 3DDHA 5ALRA 4ED7A 4IQVA 4RNNA 3Q8PB 4DFDA 4K4GA 9ICAA 1ZQSA 2RDJA 2H3IA 2KVCA 3EPGA 2QB0B 4YN4A 4O3QA 1TV9A 5KFWA 2OEHA 5ALVA 5EWGA 1ZD2P 1J2MA 2MUTA 3ALRA 4RPYA 1TK0A 1X40A 5KFTA 2DF4B 3UMCA 1S0NA 3N97B 3N7SC 8ICFA 4C8MA 1TAMA 3IRUA 3PSPA 3PW7A 1UT8A 4DFMA 5KL1B 1SZPA 1DOQA 1SV0C 3LWMA 1KSPA 1P7DA 1N2XA 2V4QA 4P4PA 1RQLA 4PGXA 1IM4A 2KP7A 1UA0A 5KG2A 3WKCA 4C8KA 1PZNA 1LB2B 3KHGA 2XY7A 5ALMA 4DQIA 3GQCA 4ECSA 3IM1A 1BPXA 1MC8A 4I2FA 1V9PA 3AUOA 4FS2A 2K4IA 4O3NA 3BS5B 2ZUDA 4DOAA 2RLTA 1SL0A 3OJSA 2V9WA 3T79A 3ICXA 1IIPA 8ICNA 2BCRA 3C1YA 2B0CA 3WU2U 3N4MB 4ELVA 9ICSA 7ICMA 4QZIA 4DLEA 2VANA 3TARA 2C28A 4UB1A 3PY8A 3BDPA 4RU9A 4RQ6A 3M9OB 2G06A 4EELA 8ICAA 2LYAA 1ZQVA 4M9JA 2ISOA 4F71A 1UT5A 3AL0B 8ICMA 1Z19A 1NK5A 5KFAA 1ZQJA 1N56A 5KG1A 5KFNA 2EZYA 3PSIA 2JR5A 4P0PB 3F53A 2LM1A 3PW2A 1ZQKA 2JEIA 2YMPA 5CB1A 1QSLA 4C8LA 4PGQA 2E8PA 1ZQRA 5GTIU 4X5VA 2Y1IA 1BNPA 4QZHA 3MDAA 5J2JA 5AKIA 2CRXA 5ALEA 8ICUA 5AM0A 2ZIUA 4Y2YA 2ZUCA 5ALZA 5KG6A 4F91B 4O3OA 2W9CA 3SEIA 4HYKA 3IHQB 5CR0A 4XUSA 2VKQA 2FLPA 1LV5A 5D49A 4ECQA 2EZXA 1SB3C 3JPQA 5DQHA 4DQQA 1B43A 4KLQA 4J9PA 3AEVA 1M6YA 3F5AA 5KFLA 3GZFA 5JTIA 4I2BA 3NGDA 1Z00A 2AU0A 2IA6A 3V6HA 1NK6A 5AM1A 4B9MA 3NTUA 4FO6A 2YMQA 5IINA 2H3VA 7ICKA 5L1KA 1T94A 1WUDA 5E79U 2LYBA 4US9A 3AQEA 5ALJA 1NKEA 3M8SA 3B0XA 3JPOA 2VJ4A 5DBCA 7ICHA 2HVHA 3TAQA 1TFRA 1U4BA 2PKEA 3BQ7A 3NRZA 5ALTA 3NVYA 2JMGA 3JPSA 3VC8A 4NY8A 4B9SA 1Q3VA 2OYYA 4JV1A 3K4GA 5ALSA 4YR2A 1X6JA 3KZXA 4GFJA 2B21A 4UASA 2IMWP 4UATA 4RPZA 3WK8A 1SV4A 1PVPA 1B22A 2OM6A 4NJ8A 3CW2C 4CDGA 4UB6U 1BPYA 4I28A 1NK7A 4EENA 4KLFA 2KFNA 2W3RA 4PZNA 4LZDA 4ECWA 2IBKA 2A3VA 3H4DA 2E8OA 2KZMA 1XSLA 3M6ZA 2KZZA 2OH2A 3RR7A 3RR8A 1ZQQA 1KFTA 5F9LA 5KFXA 9ICHA 1ZQZA 5ALXA 1ZQPA 5ALNA 3QZ8A 3GV8B 4P4MA 4M6WB 2XY5A 1L7PA 3GV5B 3ISBA 1NK0A 1A6SA 1WCNA 1S5LU 4JV0A 3KFUF 7ICTA 1LVHA 5TISU 3QU7A 4GC6A 3PMNA
chains in the Genus database with same CATH topology
3IG8A 2WAQF 2F8LA 1ED1A 4FE3A 4OJLA 1DRGA 2H3VA 4IC9A 2ZIWB 2JGAA 3PSFA 2Y0SC 1T94A 1WUDA 2E1EA 3LVVA 2KICA 2JH1A 1Q3UA 1CRXA 5HR7A 1YT3A 2KHVA 2N1RA 1PVQA 2LYBA 2KOBA 2R18A 2XICA 3NRWA 3LVWA 3MGVA 1XNSA 3AQEA 2ZIXA 3K1ZA 1KBUA 1XO0A 3SAFA 2K4IA 3DEEA 2K8CB 5HR6A 4FZLA 4NLCA 3IP4B 4NWIA 1ZQ1C 2E1FA 2JH7A 3E0FA 2GOLA 2KD1A 2VJ4A 3ICXA 2G09A 1IIPA 3C29A 2YB4A 2KHQA 4JMUA 4O3MA 4BX9C 2G08A 2KV2A 3NUQA 2OXOA 5KL8B 4P0QB 3H0MB 3H0LB 2ZIXB 4OJOA 3L3FX 4U7CA 2JMGA 3HKZC 3PSTA 2G5HB 3VC8A 3SQIA 2W7OA 2WB1F 1ECWA 3M6KA 3T79A 2F2AB 2ZXIA 2HOIA 1HEKA 4AYBC 3N7PD 1Q3VA 4NV0A 2F76X 2OYYA 2PMZC 4PL1A 3RFAA 3SMVA 4CRXA 2K8BB 2NV3A 2G5IB 4KX5A 3SAHA 5C0YA 3KZXA 3N7RC 4GFJA 1HIWA 4BUGA 3F2DA 4P0QA 2HBLA 4ACOA 2XIDA 1L6NA 1F44A 2G06A 4OJ6A 2KKPA 2KNJA 4C0ZA 2LYAA 3OPXA 2BDUA 4QIWF 2KKVA 3D2NA 3IG5A 4P0PA 3CP8A 3CRXA 4A8EA 2XI9A 1PVPA 2OM6A 2H3IA 2HBKA 1GO3F 2K4HA 3RF9A 4CDGA 3C28A 3AL0B 4OJPA 3F2BA 4FZMA 3GU3A 3H0RB 1Z19A 2KVCA 2W03A 1NZBA 1UPHA 2HOFA 2H3FA 2ZIUB 2XVTA 2RP5A 3SAGA 4OO1J 3PSIA 2JHDA 4P0PB 3F53A 2YB1A 4BJQA 2KIWA 2K4EA 1OUQA 3M7DA 4KMOB 5CRXA 4QJFB 4CGZA 2D6FC 3ALRA 2W04A 3HKZF 2DQNB 2H3ZA 4PL2A 2ZIVB 2HOQA 2A3VA 2MA1A 2KJ5A 2HBMA 2RRDA 2WAQC 2CRXA 4AYBF 2HBJA 2Y0SF 2VJ5A 3D2QA 3M6ZA 2HMXA 2DF4B 2ZIUA 2OH2A 3N7SC 2VIXA 2ZG6A 2F77X 4OJ5A 2YX8A 2DGZA 1TAMA 3PSPA 4U6PA 2G07A 3D2SA 5KL1B 2VKQA 4WJ3B 2LKYA 3VCBA 2ZIVA 5A0LA 1MA7A 4QNLA 1A0PA 2M0NA 2CN1A 2G0AA 4QIWC 1URJA 2GH1A 2K8AA 3F2CA 1SZHA 3O0FA 1P7DA 1A6SA 2Q4TA 3F5EA 3IN5A 4KX3A 1PVRA 2ZXHA 2MRLA 3ONNA 3AQFA 3CYMA 2Z7JA 3F5AA 2H3QA 2LHTA 3GZFA 2W7PA 2KJ9A 3LYSA 4ICAA 2KEYA 5T14A 1D8BA 2KJ8A 2WB1C 3KFUF 2ZIWA 2CPRA 2E5SA 2PMZF 2RHFA 2K89A 3PZPA 4NLBA 2LBOA 1Z1BA 4FZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z19 A;  1DRG A;  1NZB A;  2HOF A;  1CRX A;  1MA7 A;  2HOI A;  1A0P A;  1Q3U A;  2KIW A;  2KHV A;  1Q3V A;  1PVQ A;  1OUQ A;  5CRX A;  2KOB A;  4CRX A;  1P7D A;  3NRW A;  3MGV A;  1PVR A;  1XNS A;  1KBU A;  4ACO A;  1XO0 A;  2A3V A;  2KJ5 A;  1F44 A;  2CRX A;  2KJ9 A;  3LYS A;  2KKP A;  2KEY A;  2KJ8 A;  2KD1 A;  3C29 A;  2KHQ A;  2KKV A;  2OXO A;  3CRX A;  4A8E A;  1PVP A;  3C28 A;  1Z1B A; 
#chains in the Genus database with same CATH topology
 3C5G A;  4K4I A;  9ICQ A;  1YT3 A;  1PVQ A;  1OXJ A;  4Y2J A;  4MF2 A;  1X2I A;  5L1L A;  4OD0 A;  2E8M A;  4RQ7 A;  4C8O A;  2HSZ A;  3ISC A;  4NLC A;  1IV8 A;  3QEB Z;  2E1F A;  2FPK A;  2G09 A;  2KMD A;  4Z6D A;  5KFR A;  4QWA A;  3PV8 A;  2AJQ A;  4PHD A;  2JEF A;  2DL0 A;  5IIO A;  2V4R A;  4DFJ A;  1MN8 A;  4ED8 A;  1HEK A;  1MSW D;  3RFA A;  2PMZ C;  3H40 A;  5EOZ A;  4B6J A;  1ZQL A;  5DB8 A;  2ESE A;  1FIQ A;  4GIB A;  4NLK A;  2A1J A;  4GXJ A;  4KLO A;  2KNJ A;  4C0Z A;  2A1A A;  1FO4 A;  2Q0Z X;  4NL9 A;  2P66 A;  1Q46 A;  4OJP A;  3F2B A;  4F4Z A;  3GU3 A;  3KKA C;  2LI6 A;  2H3F A;  5DDM A;  5EE9 A;  3AU6 A;  4YFK A;  3Q8K A;  3NVZ A;  8ICP A;  1PK1 A;  1OW5 A;  4PL2 A;  2H3Z A;  4XQ8 A;  2WAQ C;  3D2Q A;  2VJ5 A;  3UXO A;  3RAX A;  1XO1 A;  4RNM A;  4ED6 A;  2BCU A;  2YX8 A;  2DGZ A;  4F5O A;  2BZF A;  2HHS A;  3IDW A;  4M9H A;  4WJ3 B;  5AI9 A;  5HMM A;  4YQW A;  5KFJ A;  5EWF A;  4KX3 A;  8ICG A;  4JK1 A;  5DBB A;  2EZZ A;  2H3Q A;  5AIC A;  3TAP A;  4ICA A;  2XGP A;  1D9F A;  3UQ0 A;  8ICZ A;  3HPO A;  2P6U A;  3HW8 A;  4JB3 A;  1ED1 A;  3BZK A;  5B66 U;  3RAQ A;  2ZJ5 A;  4QZA A;  5DG7 A;  3SAF A;  2AGQ A;  2LMR A;  3B9J A;  2K8C B;  2JH7 A;  1JI7 A;  3DV9 A;  5L1I A;  3RB3 A;  4P0Q B;  5AK5 A;  4KMU A;  5AKH A;  4J9R A;  3BQ0 A;  3EW9 A;  5J0Y A;  1S0O A;  3L5K A;  3TAD C;  3G6X A;  4FBU A;  2ASJ A;  5DGA A;  4B9T A;  1F44 A;  4OJ6 A;  1ZQW A;  3G6V A;  4IR1 A;  2YN4 A;  4DQR A;  4NLZ A;  2HBK A;  1K5O A;  4I2G A;  2W9A A;  3PO4 A;  3SAG A;  1SL1 A;  2WF7 A;  3QU2 A;  1X66 A;  3T5K A;  1SKS A;  2HBM A;  4MEX A;  2VA3 A;  1SWV A;  2HBJ A;  2Y0S F;  1L3U A;  2ZTC A;  3C5F A;  7ICF A;  3RJE A;  5KTQ A;  4Y2P A;  4F8R A;  2ZIV A;  4F5Q A;  4DL5 A;  1QQ5 A;  2NRZ A;  2YQE A;  3MFH A;  3HWT A;  2DKX A;  3IN5 A;  2C22 A;  4UAY A;  1DXS A;  5KNI A;  3KTQ A;  1ZQM A;  1A76 A;  5HHH A;  2NRW A;  3RJH A;  4HAI A;  4QZC A;  2EH9 A;  2K89 A;  1L3T A;  5AM3 A;  2LBO A;  5ALG A;  1S0V A;  5J2B A;  2OWO A;  3SD7 A;  4FE3 A;  4DOC A;  3PW4 A;  5CWR A;  1ZJM A;  1EXN A;  8ICJ A;  2JH1 A;  4PJ0 U;  1HUZ A;  5J0U A;  2W8L A;  1L7N A;  5AM5 A;  4QZB A;  4BX9 C;  3NUQ A;  2OXO A;  4RUA A;  1UCV A;  4O5E A;  2C2D A;  2E8N A;  1X42 A;  1TAU A;  1X9X A;  1KDH A;  2HI0 A;  4IRK A;  4C4R A;  2K8B B;  4KX5 A;  2KN7 A;  3RJJ A;  4UB2 A;  3N7R C;  4BUG A;  3THV A;  4JWN A;  3KHR A;  9ICC A;  4XA5 A;  2L5Y A;  3C1Z A;  2KKV A;  3IG5 A;  2FPM A;  2BHN A;  2XI9 A;  1K1Q A;  4O3R A;  3WKB A;  4GC7 A;  4M47 A;  2RP5 A;  4R8U A;  5DQI A;  4TUQ A;  2IHM A;  5KT3 A;  1NJW A;  4DL6 A;  2DWQ A;  1JXL A;  1L7O A;  1ZQG A;  2DPJ A;  2XC9 A;  4B9N A;  3E58 A;  1ZQY A;  1KW4 A;  1TK5 A;  5CP2 A;  2ZUB A;  4UBB A;  4KTQ A;  3A0B U;  1RXV A;  5KT6 A;  1TE2 A;  3C2K A;  2F77 X;  4QZ8 A;  4F2S A;  1A77 A;  2PI4 A;  5III A;  1F0M A;  5AM2 A;  2ASL A;  1ZOL A;  1N60 A;  1RM6 C;  2ZJ8 A;  3U26 A;  5HNK A;  5J2A A;  8ICL A;  1L5U A;  2O6K A;  5KFD A;  2PFN A;  4QNL A;  4Q8E A;  4QIW C;  5J0P A;  2HW3 A;  2AQ4 A;  5IIJ A;  4IRC A;  1JMS A;  2MRL A;  3HX0 A;  2KK0 A;  2XGQ A;  8ICW A;  2W7P A;  2KJ9 A;  2EAP A;  5T14 A;  2YTU A;  4Q8F A;  3M8R A;  1KKX A;  2WAQ F;  1X6I A;  1S8O A;  3JPT A;  1BPB A;  5KFG A;  2KE7 A;  3QEA Z;  2A19 A;  2N1R A;  5CEH A;  2WF5 A;  5ALH A;  3LVW A;  5ALW A;  3MGV A;  8ICO A;  3RJI A;  3E0F A;  4Y2Q A;  5BPC A;  2W9B A;  2YB4 A;  2KZ3 A;  5J8Y C;  3ZI4 A;  3H0M B;  8ICE A;  3PO5 A;  1RDF A;  3GDX A;  4IL6 U;  3PST A;  2AHO B;  2IOF A;  3M6K A;  4LZG A;  2HHW A;  1JUD A;  1D8Y A;  4F50 A;  1N62 A;  3EYZ A;  4IQW A;  4YP3 A;  2W11 A;  5KT5 A;  3MGH A;  2LPE A;  4PHE A;  1L6N A;  1VDV A;  3PML A;  2K4H A;  3C28 A;  5AKE A;  3QYP A;  3RJK A;  4RT3 A;  1SWW A;  4KLL A;  1U49 A;  2ZIU B;  3HRD D;  1T7P A;  4BDP A;  4F2R A;  4CGZ A;  5CJ7 A;  2W04 A;  4E0D A;  5D46 A;  2KJ5 A;  4QW9 A;  4RQ0 A;  1T3N A;  1ZQT A;  2RDI A;  1KFS A;  5J0Q A;  2AGP A;  3FAH A;  1U45 A;  5AKL A;  4UW9 A;  2KSO B;  3MR6 A;  2AQ0 A;  4IQU A;  1KFD A;  2M0N A;  8ICQ A;  4F4W A;  3QU4 A;  2BCS A;  2K60 A;  2Q4T A;  2UVR A;  3TFS A;  4O0I A;  8ICC A;  3CYM A;  2YMM A;  2KEY A;  4MF8 A;  3ZDA A;  4CF5 A;  1ZQI A;  3UMG A;  4C8N A;  9ICL A;  4ELT A;  2XY6 A;  4IRD A;  5AI0 A;  1KL9 A;  4IC9 A;  3PSF A;  3RTV A;  3JPN A;  1SXD A;  2R18 A;  5KFI A;  3MAB A;  1JXE A;  2JXJ A;  1BVS A;  9ICV A;  8ICY A;  4O3M A;  3PX6 A;  4B9U A;  4OJO A;  3T5J A;  2BCV A;  3LK9 A;  2IHN A;  4DLG A;  4AYB C;  3N7P D;  2QAR A;  3QE9 Y;  5DLG A;  9ICF A;  1QQ7 A;  5AKJ A;  3GIJ A;  2E3T A;  5KFY A;  4BWJ A;  2KTQ A;  2H5X A;  9ICO A;  4ED3 A;  4P0P A;  1C20 A;  4CCH A;  3CRX A;  5HR7 A;  4KLE A;  3H8S A;  4PZO A;  3OSN A;  3H0R B;  4O5K A;  4OCZ A;  4R64 A;  2XVT A;  4YXJ A;  1BGX T;  1ZD5 A;  1S77 D;  3OHA A;  3I1Y A;  1T4G A;  5AI8 A;  3ZDC A;  3SEN A;  2QLT A;  2MA1 A;  4YMO A;  5AI5 A;  3RH4 A;  1KLN A;  4YXM A;  2W9M A;  2EAM A;  5ALO A;  4NM1 A;  3V6J A;  4Q45 A;  3QU5 A;  1V38 A;  3Q8L A;  2I5H A;  1X9S A;  5AKK A;  3BZC A;  2BGW A;  3ISD A;  3WK4 A;  3A0H U;  2G0A A;  2FLN A;  3F2C A;  2W3S A;  3F5E A;  3KKA A;  1QCK A;  3AQF A;  2Z7J A;  1U9L A;  3ZDE A;  3LYS A;  5BOM A;  5DLF A;  4DWI A;  2RHF A;  4RQ3 A;  2EAO A;  2NYV A;  2BCQ A;  5J2G A;  1NNL A;  5KG7 A;  2PXI A;  3GIK A;  1Q3U A;  1J2N A;  4UAZ A;  3UPQ A;  3RH5 A;  1RYU A;  5B5E U;  2UVV A;  4FZL A;  4PGY A;  4BXO A;  2GOL A;  4MEY A;  2D3D A;  3TAN A;  2G08 A;  5KL8 B;  3H8M A;  4R66 A;  4YVZ A;  4FS1 A;  7ICI A;  1UHU A;  5ALQ A;  4ECR A;  3HP6 A;  3MR3 A;  5AIB A;  4QZD A;  4CE6 A;  3E2E A;  4KLI A;  3I76 A;  3SAH A;  2BPF A;  1ZD3 A;  2HBL A;  5KFH A;  2W55 A;  2XCA A;  9ICN A;  3JPR A;  4DSE A;  1ZQB A;  8ICS A;  3CP8 A;  4A8E A;  4R65 A;  5KFK A;  5KFV A;  3SV3 A;  3PR5 B;  5KFC A;  5IIM A;  3GII A;  5CHG A;  4EZ6 A;  2YB1 A;  2K4E A;  1RPL A;  3L4P A;  8ICR A;  5J29 A;  4QJF B;  3ETR A;  4DEZ A;  5AI6 A;  2BPC A;  3H8J A;  4KLH A;  1KQQ A;  3TAD A;  4M6W A;  1XS9 D;  4OJ5 A;  3ETL A;  2F3N A;  4UB3 A;  4BWM A;  4UB8 U;  2G07 A;  2HHU A;  4UAR A;  5ALP A;  2MAX A;  1XSN A;  5AK6 A;  1BPD A;  9ICI A;  4DFP A;  5AKZ A;  2HHV A;  8ICI A;  4F4X A;  4Y2U A;  4RQ2 A;  4NLN A;  2LHT A;  1X9W A;  7ICN A;  2OHF A;  2KJ8 A;  4DSL A;  3V7L A;  9ICG A;  3MFI A;  1SGG A;  3TQ1 A;  3FM9 A;  5DB7 A;  9ICT A;  4RQ4 A;  3LWL A;  2ZIW B;  2EDU A;  3HIL A;  4Z6E A;  4M04 A;  3M1Y A;  1ZQF A;  5AKY A;  2HCF A;  4EEK A;  2XO7 A;  2DPI A;  1IXR A;  4RZR A;  1DGJ A;  2P6R A;  3MR2 A;  4I2C A;  2GWS A;  3KD3 A;  1V85 A;  1WG8 A;  1ZRM A;  3RBE A;  3AM9 A;  3C29 A;  4F4Y A;  3QNM A;  3N28 A;  2ZIX B;  2KIV A;  2EQY A;  1D8L A;  2MU2 A;  9ICE A;  3K75 D;  4C4T A;  2G5H B;  8ICH A;  2F1I A;  5J0W A;  2F2A B;  4Z6F A;  1QLN A;  2XCP A;  4ZOH C;  4O9M A;  3WK9 A;  3PVX A;  4TQR A;  1KEJ A;  2FMQ A;  4US8 A;  2F1H A;  4QZE A;  1ZQU A;  1VLB A;  3RF9 A;  1V97 A;  4FZM A;  3AU2 A;  4QWD A;  3BQ2 A;  2W03 A;  2JZB B;  3PX4 A;  9ICK A;  4J9N A;  1RQN A;  4YD2 A;  1S76 D;  4BJQ A;  2KIW A;  4UBC A;  4B9L A;  3EWA A;  3Q8S B;  2ZIV B;  2UVW A;  8ICT A;  4AYB F;  3OHB A;  4QWE A;  4KN7 A;  1QQ6 A;  4UAU A;  4IR9 A;  5J2D A;  3T5H A;  3RH6 A;  2LKY A;  3VCB A;  2JEJ A;  1XU4 A;  5DDY A;  2K8A A;  2Y9U A;  5DG9 A;  1WWU A;  1ZD4 A;  2F44 A;  7ICE A;  2R8J A;  3V72 A;  1N63 A;  4I2J A;  4F5P A;  2M9N A;  3IG8 A;  4DL2 A;  2NO4 A;  4Y2S A;  1HUO A;  4JWM A;  1K1S A;  3SV4 A;  1QSY A;  1ARO P;  1PUZ A;  4EBE A;  2CXY A;  2F1J A;  5G5H A;  5J0X A;  4Y2T A;  4F72 A;  5L1M A;  4DQS A;  4KLM A;  1JN3 A;  2KD1 A;  2OCE A;  4JMU A;  1QTM A;  3LDA A;  3GIL A;  1L3V A;  3KBB A;  4I29 A;  4JUZ A;  1NK4 A;  2Y9T A;  1X9M A;  4MFA A;  3M9N B;  2J6U A;  2ZXI A;  1VJ5 A;  4KN4 A;  4QWB A;  2NV3 A;  1J97 A;  5DKW A;  4ACO A;  1RZT A;  2DBY A;  4R8U B;  8ICB A;  5J2E A;  3ORY A;  2ZJA A;  4M9L A;  5DBA A;  2P35 A;  2HHT A;  1GO3 F;  3IV6 A;  5J8Y A;  1NK9 A;  4TUP A;  2B6G A;  1OUQ A;  5CRX A;  5J0T A;  4RQ5 A;  1L8L A;  7ICJ A;  1SXE A;  4KLJ A;  3M9M B;  2HMX A;  2VIX A;  2MUT B;  2NO5 A;  3UQ2 A;  1IG6 A;  9ICJ A;  4UAW A;  5TZV A;  7ICS A;  2NRX A;  1XC9 A;  2FI1 A;  3ZDD A;  1L7M A;  1NZP A;  2R8I A;  5GTH U;  4M9G A;  2IOF K;  1XSP A;  2PMZ F;  4C7Z A;  4R63 A;  4DQP A;  5EE1 A;  2DUY A;  3I28 A;  5J2I A;  5BOL A;  1N5W A;  5AHX A;  3MC1 A;  4FZN A;  2PFP A;  2W9B B;  4OJL A;  3AN1 A;  7ICR A;  1Z1V A;  3ZD8 A;  3LVV A;  2KIC A;  1JRO A;  3TI0 A;  2FLL A;  3WKA A;  1NI3 A;  3WK6 A;  3ZDB A;  1SKR A;  3RJG A;  3MR5 A;  1ZXI A;  3HT3 A;  3WKE A;  3QU9 A;  4Y2X A;  1TK8 A;  7ICP A;  4RUC A;  2W54 A;  1BNO A;  5EWE A;  1NK8 A;  5ALY A;  3HKZ C;  3SYZ A;  3RB0 A;  3SR6 A;  4EYI B;  1QSS A;  2HOI A;  2LYH A;  3MDC A;  1U48 A;  5L1J A;  5EE3 A;  1LKY A;  1Z4N A;  3WK5 A;  1RYR A;  2I6X A;  4G3I A;  4KIT B;  3D6J A;  2BDU A;  3JPP A;  3Q8Q B;  5ALD A;  4YR0 A;  4ELU A;  1NZB A;  5KFO A;  4M0A A;  1AQ6 A;  4DS4 A;  2GLE A;  2HDO A;  2J6T A;  3WK7 A;  4RNO A;  5H2F U;  2D6F C;  3FDS A;  5AM4 A;  1Z4O A;  2HOQ A;  5ALI A;  4O3P A;  2ZTE A;  2QB0 A;  4O5C A;  4Q44 A;  5ALU A;  1N5X A;  2RQ5 A;  2ISP A;  4MFF A;  2ZTD A;  1QH9 A;  3B0Y A;  4DL4 A;  1CI4 A;  2R8G A;  5J2K A;  1JIH A;  2CN1 A;  2I9G A;  2W9C B;  5K4L A;  1SZH A;  4KLG A;  4RQ1 A;  1PVR A;  2ZXH A;  3CNH A;  5DGB A;  3PR4 A;  3BS7 A;  3KOO A;  5KT4 A;  4YG2 A;  4EX6 A;  4Y2V A;  3PZP A;  4NLB A;  3NS1 A;  1KN5 A;  5KFU A;  2ODG A;  2HHX A;  4JV2 A;  1Z00 B;  1NJZ A;  2E1E A;  4DSF A;  1S10 A;  1HJP A;  3QUB A;  3ED5 A;  4XRH A;  2HVI A;  4DF8 A;  1N48 A;  5HR6 A;  3TFR A;  2FE9 A;  4FFD A;  2QAR B;  2AH5 A;  1WYG A;  4C80 A;  1JAL A;  3L3F X;  1XWL A;  3S6J A;  5J2C A;  4Y2R A;  1ECW A;  1NKB A;  2FJ6 A;  3BS5 A;  1DGS A;  5ALL A;  5L9X A;  4C4S A;  3NAS A;  4CRX A;  5CA7 A;  4DS5 A;  4I2D A;  5HML A;  4YD1 A;  4QWC A;  4QZ9 A;  5J0R A;  3PW5 A;  1S0M A;  4ECU A;  2IOH A;  4RQ8 A;  3EPI A;  3OPX A;  3TAC B;  2HOF A;  3FYH A;  4KLU A;  3NVV A;  4C7Y A;  7ICU A;  1DK2 A;  3C2M A;  3RRG A;  1ZET A;  4DSK A;  4F5N A;  2KSO A;  3WKD A;  4DFK A;  1N61 A;  1FFU A;  2ZG6 A;  5KFS A;  8ICK A;  4CNQ A;  1BPE A;  4DCC A;  3NVW A;  2F8K A;  1KRP A;  2JRZ A;  5KFF A;  4PHA A;  2YML A;  1NOM A;  5DQG A;  7ICG A;  3V6K A;  4DSI A;  4DOB A;  4GXK A;  2VA2 A;  2JEG A;  4DL7 A;  2AXT U;  1D8B A;  2WB1 C;  4CF3 A;  7ICV A;  3UXP A;  2E5S A;  2BQR A;  2WTF A;  2KG5 A;  4G9B A;  2LM4 A;  4BXO B;  5IIK A;  2JGA A;  2Y0S C;  4J9M A;  2KOB A;  4YR3 A;  3C2L A;  4ED1 A;  2KFZ A;  1FEZ A;  3KHL A;  2Y1J A;  1XNS A;  5KFB A;  1XO0 A;  1NJY A;  1ZQO A;  1MQ2 A;  4J9Q A;  1D9D A;  2KHQ A;  3OGU A;  2KV2 A;  4ECY A;  2QB1 A;  3BQT A;  5KFQ A;  2C2E A;  1BPZ A;  5FP0 A;  4TUR A;  4J9S A;  3RJF A;  5KG3 A;  1O08 A;  2F76 X;  2W43 A;  4PL1 A;  5KFZ A;  3SMV A;  3V7J A;  3T3F A;  4P4O A;  4Q43 A;  3PW0 A;  9ICW A;  1JX4 A;  3QXG A;  1HIW A;  3EZ5 A;  5JUM A;  5JRT A;  3RB4 A;  3QUT A;  5EE0 A;  9ICM A;  4QIW F;  5AKG A;  2QKQ A;  2MSN A;  1L8O A;  3ZD9 A;  3C21 A;  2A1J B;  1UPH A;  4USA A;  3G6Y A;  2JHD A;  3PX0 A;  4F3O A;  4PPX A;  3TKA A;  2BDP A;  3M7D A;  1ZQA A;  4J9K A;  3HKZ F;  5IIL A;  5AKX A;  4RPX A;  1CUK A;  4ED0 A;  1COO A;  1ZRN A;  1PK1 B;  1YZ6 A;  2WF6 A;  2HHQ A;  2BPG A;  1ZQN A;  5KFE A;  1PK3 A;  4LJX A;  4ECT A;  3H7I A;  3KZI U;  5A0L A;  1MA7 A;  4GXI A;  5D4B A;  3OTQ A;  3H4B A;  5ALK A;  4J9O A;  4UB4 A;  2DFL A;  2ALZ A;  2NRT A;  4MFC A;  1ZQD A;  2JV3 A;  9ICX A;  4RQM A;  5KG0 A;  5KT2 A;  3RRH A;  1CRX A;  5J0S A;  3V7K A;  9ICB A;  5AK3 A;  2XIC A;  4IQT A;  3NRW A;  4NLG A;  4DSJ A;  3DEE A;  1WWV A;  3IP4 B;  4NWI A;  4F4K A;  2BKE A;  1FFV A;  4ECV A;  4YCX A;  4EZ9 A;  1RXW A;  2FMP A;  4EYH B;  3T5L A;  3SQI A;  1NJX A;  4KLD A;  5F9N A;  2WFA A;  7ICO A;  3BQ1 A;  3QUQ A;  5J0O A;  5KAF U;  3PNC A;  4KLS A;  1C7Y A;  2FDR A;  2G5I B;  3QX7 A;  3F2D A;  5KAI U;  1YZ7 A;  1H38 A;  7ICL A;  4UB5 A;  2C2R A;  3D2N A;  3MBY A;  4YMN A;  4K4H A;  3H8W A;  4J9L A;  4QZG A;  1ZQX A;  2FMS A;  4ZH4 A;  4DO9 A;  3RBD A;  1TAQ A;  3RB6 A;  2BQU A;  2ASD A;  4KMO B;  4P2H A;  2EAN A;  2J6S A;  2K4P A;  3KHH A;  2PI5 A;  2RRD A;  5F3X B;  3HJE A;  3GIM A;  9ICR A;  4M2Y A;  5J2H A;  4YMM A;  1SKW A;  4EBD A;  4RQN A;  3D2S A;  1F5S A;  1Z3E B;  1ZQC A;  5KFP A;  4LVS A;  1JRP A;  2I1Q A;  1URJ A;  3MGI A;  5AK4 A;  9ICU A;  3ONN A;  2W8K A;  1RYS A;  4DL3 A;  1B0X A;  1B4F A;  2CPR A;  2ZIW A;  1ZQH A;  5DB9 A;  4QZF A;  4F92 B;  1Z1B A;  3GV7 B;  3AMZ A;  4EBC A;  1Q8K A;  2F8L A;  4J03 A;  1TVA A;  2ES6 A;  7ICQ A;  4PH5 A;  3Q8R B;  2KHV A;  1ZQE A;  4FBT A;  5G5G A;  4GLX A;  1TKD A;  1U47 A;  1S97 A;  2ZIX A;  1WCL A;  4NL9 C;  4ED2 A;  4ECX A;  8ICX A;  1NKC A;  5DB6 A;  5KFM A;  4I2H A;  1MQ3 A;  3H0L B;  4ECZ A;  2WHE A;  2BQ3 A;  3SZ2 A;  3BJY A;  2WB1 F;  4CF4 A;  2UVU A;  4NV0 A;  5AI4 A;  5J2F A;  5C0Y A;  1O03 A;  1UQV A;  2WF8 A;  4P0Q A;  1ZYQ A;  2GO7 A;  5HHI A;  2KKP A;  2JZB A;  2R8H A;  1KTQ A;  1T3Q A;  1RG6 A;  4OO1 J;  1Y88 A;  3OSP A;  4EX7 A;  3K1R B;  3UXN A;  2KVS A;  5KG4 A;  2DQN B;  2YY6 A;  4UQG A;  1COK A;  4I2A A;  2WF9 A;  3OJU A;  1S9F A;  3GFK B;  4U6P A;  4BGD A;  5KG5 A;  4KLT A;  1UA1 A;  4I2E A;  4M9N A;  2DKZ A;  1A0P A;  4MHV A;  2PFQ A;  1CEZ A;  2GH1 A;  5C5J A;  4O3S A;  4PHP A;  3O0F A;  3C23 A;  4NM2 A;  1DK3 A;  4IS7 A;  1SV0 A;  5KT7 A;  3EUB 2;  4UAV A;  1SL2 A;  9ICP A;  4EEY A;  5JU5 A;  1ZJN A;  1DRG A;  1SIJ A;  4TUS A;  3SI8 A;  8ICV A;  4I2I A;  4F93 B;  2AGO A;  2BR0 A;  2VA8 A;  4AP9 A;  5AIA A;  2D8C A;  4TQS A;  4DF4 A;  1KBU A;  4I27 A;  2NRV A;  3K1Z A;  5HP4 A;  3J81 j;  4F5R A;  3R9K A;  4QW8 A;  4Z6C A;  4B9V A;  1ZQ1 C;  3Q8M A;  3UMB A;  1LKY B;  5ALF A;  2PFO A;  4RT2 A;  2FPL A;  4U7C A;  3QUC A;  1T8E A;  1L3S A;  3FC4 A;  2W7O A;  2ATL A;  3UM9 A;  5DG8 A;  4NXZ A;  2R8K A;  3QZ7 A;  2XID A;  3DDH A;  5ALR A;  4ED7 A;  4IQV A;  4RNN A;  3Q8P B;  4DFD A;  4K4G A;  9ICA A;  1ZQS A;  2RDJ A;  2H3I A;  2KVC A;  3EPG A;  2QB0 B;  4YN4 A;  4O3Q A;  1TV9 A;  5KFW A;  2OEH A;  5ALV A;  5EWG A;  1ZD2 P;  1J2M A;  2MUT A;  3ALR A;  4RPY A;  1TK0 A;  1X40 A;  5KFT A;  2DF4 B;  3UMC A;  1S0N A;  3N97 B;  3N7S C;  8ICF A;  4C8M A;  1TAM A;  3IRU A;  3PSP A;  3PW7 A;  1UT8 A;  4DFM A;  5KL1 B;  1SZP A;  1DOQ A;  1SV0 C;  3LWM A;  1KSP A;  1P7D A;  1N2X A;  2V4Q A;  4P4P A;  1RQL A;  4PGX A;  1IM4 A;  2KP7 A;  1UA0 A;  5KG2 A;  3WKC A;  4C8K A;  1PZN A;  1LB2 B;  3KHG A;  2XY7 A;  5ALM A;  4DQI A;  3GQC A;  4ECS A;  3IM1 A;  1BPX A;  1MC8 A;  4I2F A;  1V9P A;  3AUO A;  4FS2 A;  2K4I A;  4O3N A;  3BS5 B;  2ZUD A;  4DOA A;  2RLT A;  1SL0 A;  3OJS A;  2V9W A;  3T79 A;  3ICX A;  1IIP A;  8ICN A;  2BCR A;  3C1Y A;  2B0C A;  3WU2 U;  3N4M B;  4ELV A;  9ICS A;  7ICM A;  4QZI A;  4DLE A;  2VAN A;  3TAR A;  2C28 A;  4UB1 A;  3PY8 A;  3BDP A;  4RU9 A;  4RQ6 A;  3M9O B;  2G06 A;  4EEL A;  8ICA A;  2LYA A;  1ZQV A;  4M9J A;  2ISO A;  4F71 A;  1UT5 A;  3AL0 B;  8ICM A;  1Z19 A;  1NK5 A;  5KFA A;  1ZQJ A;  1N56 A;  5KG1 A;  5KFN A;  2EZY A;  3PSI A;  2JR5 A;  4P0P B;  3F53 A;  2LM1 A;  3PW2 A;  1ZQK A;  2JEI A;  2YMP A;  5CB1 A;  1QSL A;  4C8L A;  4PGQ A;  2E8P A;  1ZQR A;  5GTI U;  4X5V A;  2Y1I A;  1BNP A;  4QZH A;  3MDA A;  5J2J A;  5AKI A;  2CRX A;  5ALE A;  8ICU A;  5AM0 A;  2ZIU A;  4Y2Y A;  2ZUC A;  5ALZ A;  5KG6 A;  4F91 B;  4O3O A;  2W9C A;  3SEI A;  4HYK A;  3IHQ B;  5CR0 A;  4XUS A;  2VKQ A;  2FLP A;  1LV5 A;  5D49 A;  4ECQ A;  2EZX A;  1SB3 C;  3JPQ A;  5DQH A;  4DQQ A;  1B43 A;  4KLQ A;  4J9P A;  3AEV A;  1M6Y A;  3F5A A;  5KFL A;  3GZF A;  5JTI A;  4I2B A;  3NGD A;  1Z00 A;  2AU0 A;  2IA6 A;  3V6H A;  1NK6 A;  5AM1 A;  4B9M A;  3NTU A;  4FO6 A;  2YMQ A;  5IIN A;  2H3V A;  7ICK A;  5L1K A;  1T94 A;  1WUD A;  5E79 U;  2LYB A;  4US9 A;  3AQE A;  5ALJ A;  1NKE A;  3M8S A;  3B0X A;  3JPO A;  2VJ4 A;  5DBC A;  7ICH A;  2HVH A;  3TAQ A;  1TFR A;  1U4B A;  2PKE A;  3BQ7 A;  3NRZ A;  5ALT A;  3NVY A;  2JMG A;  3JPS A;  3VC8 A;  4NY8 A;  4B9S A;  1Q3V A;  2OYY A;  4JV1 A;  3K4G A;  5ALS A;  4YR2 A;  1X6J A;  3KZX A;  4GFJ A;  2B21 A;  4UAS A;  2IMW P;  4UAT A;  4RPZ A;  3WK8 A;  1SV4 A;  1PVP A;  1B22 A;  2OM6 A;  4NJ8 A;  3CW2 C;  4CDG A;  4UB6 U;  1BPY A;  4I28 A;  1NK7 A;  4EEN A;  4KLF A;  2KFN A;  2W3R A;  4PZN A;  4LZD A;  4ECW A;  2IBK A;  2A3V A;  3H4D A;  2E8O A;  2KZM A;  1XSL A;  3M6Z A;  2KZZ A;  2OH2 A;  3RR7 A;  3RR8 A;  1ZQQ A;  1KFT A;  5F9L A;  5KFX A;  9ICH A;  1ZQZ A;  5ALX A;  1ZQP A;  5ALN A;  3QZ8 A;  3GV8 B;  4P4M A;  4M6W B;  2XY5 A;  1L7P A;  3GV5 B;  3ISB A;  1NK0 A;  1A6S A;  1WCN A;  1S5L U;  4JV0 A;  3KFU F;  7ICT A;  1LVH A;  5TIS U;  3QU7 A;  4GC6 A;  3PMN A; 
#chains in the Genus database with same CATH homology
 3IG8 A;  2WAQ F;  2F8L A;  1ED1 A;  4FE3 A;  4OJL A;  1DRG A;  2H3V A;  4IC9 A;  2ZIW B;  2JGA A;  3PSF A;  2Y0S C;  1T94 A;  1WUD A;  2E1E A;  3LVV A;  2KIC A;  2JH1 A;  1Q3U A;  1CRX A;  5HR7 A;  1YT3 A;  2KHV A;  2N1R A;  1PVQ A;  2LYB A;  2KOB A;  2R18 A;  2XIC A;  3NRW A;  3LVW A;  3MGV A;  1XNS A;  3AQE A;  2ZIX A;  3K1Z A;  1KBU A;  1XO0 A;  3SAF A;  2K4I A;  3DEE A;  2K8C B;  5HR6 A;  4FZL A;  4NLC A;  3IP4 B;  4NWI A;  1ZQ1 C;  2E1F A;  2JH7 A;  3E0F A;  2GOL A;  2KD1 A;  2VJ4 A;  3ICX A;  2G09 A;  1IIP A;  3C29 A;  2YB4 A;  2KHQ A;  4JMU A;  4O3M A;  4BX9 C;  2G08 A;  2KV2 A;  3NUQ A;  2OXO A;  5KL8 B;  4P0Q B;  3H0M B;  3H0L B;  2ZIX B;  4OJO A;  3L3F X;  4U7C A;  2JMG A;  3HKZ C;  3PST A;  2G5H B;  3VC8 A;  3SQI A;  2W7O A;  2WB1 F;  1ECW A;  3M6K A;  3T79 A;  2F2A B;  2ZXI A;  2HOI A;  1HEK A;  4AYB C;  3N7P D;  1Q3V A;  4NV0 A;  2F76 X;  2OYY A;  2PMZ C;  4PL1 A;  3RFA A;  3SMV A;  4CRX A;  2K8B B;  2NV3 A;  2G5I B;  4KX5 A;  3SAH A;  5C0Y A;  3KZX A;  3N7R C;  4GFJ A;  1HIW A;  4BUG A;  3F2D A;  4P0Q A;  2HBL A;  4ACO A;  2XID A;  1L6N A;  1F44 A;  2G06 A;  4OJ6 A;  2KKP A;  2KNJ A;  4C0Z A;  2LYA A;  3OPX A;  2BDU A;  4QIW F;  2KKV A;  3D2N A;  3IG5 A;  4P0P A;  3CP8 A;  3CRX A;  4A8E A;  2XI9 A;  1PVP A;  2OM6 A;  2H3I A;  2HBK A;  1GO3 F;  2K4H A;  3RF9 A;  4CDG A;  3C28 A;  3AL0 B;  4OJP A;  3F2B A;  4FZM A;  3GU3 A;  3H0R B;  1Z19 A;  2KVC A;  2W03 A;  1NZB A;  1UPH A;  2HOF A;  2H3F A;  2ZIU B;  2XVT A;  2RP5 A;  3SAG A;  4OO1 J;  3PSI A;  2JHD A;  4P0P B;  3F53 A;  2YB1 A;  4BJQ A;  2KIW A;  2K4E A;  1OUQ A;  3M7D A;  4KMO B;  5CRX A;  4QJF B;  4CGZ A;  2D6F C;  3ALR A;  2W04 A;  3HKZ F;  2DQN B;  2H3Z A;  4PL2 A;  2ZIV B;  2HOQ A;  2A3V A;  2MA1 A;  2KJ5 A;  2HBM A;  2RRD A;  2WAQ C;  2CRX A;  4AYB F;  2HBJ A;  2Y0S F;  2VJ5 A;  3D2Q A;  3M6Z A;  2HMX A;  2DF4 B;  2ZIU A;  2OH2 A;  3N7S C;  2VIX A;  2ZG6 A;  2F77 X;  4OJ5 A;  2YX8 A;  2DGZ A;  1TAM A;  3PSP A;  4U6P A;  2G07 A;  3D2S A;  5KL1 B;  2VKQ A;  4WJ3 B;  2LKY A;  3VCB A;  2ZIV A;  5A0L A;  1MA7 A;  4QNL A;  1A0P A;  2M0N A;  2CN1 A;  2G0A A;  4QIW C;  1URJ A;  2GH1 A;  2K8A A;  3F2C A;  1SZH A;  3O0F A;  1P7D A;  1A6S A;  2Q4T A;  3F5E A;  3IN5 A;  4KX3 A;  1PVR A;  2ZXH A;  2MRL A;  3ONN A;  3AQF A;  3CYM A;  2Z7J A;  3F5A A;  2H3Q A;  2LHT A;  3GZF A;  2W7P A;  2KJ9 A;  3LYS A;  4ICA A;  2KEY A;  5T14 A;  1D8B A;  2KJ8 A;  2WB1 C;  3KFU F;  2ZIW A;  2CPR A;  2E5S A;  2PMZ F;  2RHF A;  2K89 A;  3PZP A;  4NLB A;  2LBO A;  1Z1B A;  4FZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...