2KKVA

Solution nmr structure of an integrase domain from protein spa4288 from salmonella enterica, northeast structural genomics consortium target slr105h
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
MENSGAYTFETIAREWHESNKRWSEDHRSRVLRYLELYIFPHIGSSDIRQLKTSHLLAPIKEVDTSGKHDVAQRLQQRVTAIMRYAVQNDYIDSNPASDMAGALSTTKARHYPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Solution NMR structure of an integrase domain from protein SPA4288 from Salmonella enterica, Northeast Structural Genomics Consortium Target SlR105H
rcsb
source organism Salmonella enterica subsp. enterica serovar paratyphi a
molecule tags Dna binding protein
total genus 31
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kkvA01
1MA7A 1A0PA 1PVRA 2KJ8A 2KKPA 3LYSA 1Q3VA 2A3VA 2HOFA 1PVPA 2OXOA 1F44A 2KD1A 2KHQA 1Z19A 2KIWA 5CRXA 3C28A 2KJ5A 2KOBA 1XNSA 1P7DA 2HOIA 3MGVA 1NZBA 1PVQA 1DRGA 1OUQA 4ACOA 2CRXA 2KHVA 3C29A 3NRWA 4A8EA 2KKVA 1CRXA 3CRXA 4CRXA 2KJ9A 1KBUA 1Z1BA 1Q3UA 2KEYA 1XO0A
chains in the Genus database with same CATH superfamily
4B9NA 2W8KA 3PO4A 3PW0A 2XGQA 4I2AA 2Y1JA 3EPIA 3C28A 5AKLA 3OHAA 4JWMA 3KOOA 1OXJA 5ALNA 4Y2RA 3ISDA 3AQFA 4UB4A 5J2IA 2AGPA 2KHVA 2ASJA 3MFHA 5IIKA 4IS7A 2IBKA 2IA6A 3LWMA 2ZG6A 5H2FU 5KAFU 1NKBA 3NUQA 4YD2A 3ZDDA 1UPHA 2L5YA 5KT4A 3IRUA 2KJ5A 4UAVA 4XUSA 2FMPA 2YB1A 2ESEA 1Z1VA 9ICNA 3O0FA 5CEHA 1L7OA 5KFOA 5AIAA 1ZQNA 3IG8A 4DWIA 4WJ3B 1QQ7A 3KHGA 3RRHA 4YR2A 7ICOA 3QXGA 2DKXA 4F5PA 2YN4A 2JR5A 1FO4A 4US8A 5D46A 2HDOA 5CJ7A 5J8YC 3HRDD 1ZRMA 3KBBA 3ORYA 4CGZA 1T3QA 3VC8A 1HUOA 8ICHA 4ED6A 1N48A 3PVXA 4R8UB 3C5FA 4JWNA 1RXWA 1HEKA 8ICPA 4EZ6A 4C4TA 2H3IA 3CYMA 9ICOA 1A77A 5AM4A 1B22A 5J0QA 3I28A 1X9XA 5J2JA 4PPXA 1KLNA 4NV0A 1UT5A 1TK5A 2A1AA 9ICPA 2ZTDA 5DBAA 3S6JA 4QZFA 2VJ5A 3ISBA 2W04A 4I2EA 4DQSA 2KE7A 3DDHA 4NL9A 5KFBA 5AKYA 7ICUA 1L8OA 4ZOHC 3V6KA 2JH1A 2YY6A 4J9QA 3C1ZA 4MFCA 1KL9A 4QW9A 2H3QA 1BPYA 3Q8QB 5AM5A 5HP4A 4DFJA 2EZZA 4Q8EA 1RYUA 2ZXIA 4DS5A 5BOMA 4KLIA 4EENA 2KZ3A 1TE2A 3GZFA 2H3ZA 4F4ZA 1URJA 3KD3A 2W9BB 4MFFA 1Y88A 2AHOB 3SAHA 2KZMA 5ALSA 3N7SC 3MR6A 4YMOA 3EW9A 2ASLA 3RB3A 3SV3A 3SEIA 2OEHA 1ZQPA 3WU2U 4ACOA 3HT3A 4UB5A 3HX0A 3Q8RB 5KT7A 4UBCA 2QB0A 1NK6A 4QZEA 1DXSA 1NJXA 1OW5A 4RQ6A 4F5OA 3SAGA 1N62A 3GQCA 4ECXA 4ECVA 2PMZC 1D8LA 1FIQA 3PSTA 3C5GA 8ICVA 2G0AA 1EXNA 3OJUA 5HMLA 4PJ0U 2KEYA 5DB8A 3TACB 4UAUA 2MU2A 4Y2VA 2E8OA 3M9NB 3NS1A 2YMQA 3KZXA 1IG6A 5J0OA 4Z6DA 1UCVA 9ICWA 2Y9TA 5ALRA 4TUPA 1ZRNA 4DL3A 4TUSA 3FDSA 3BZCA 2LMRA 3DV9A 3UM9A 2HHWA 2YMPA 2BR0A 2BDUA 1SV4A 5EE3A 2V9WA 2F44A 4P4PA 3QU2A 4O3SA 7ICKA 4DSFA 3NRWA 1SL2A 4J9SA 5KFNA 3BQTA 2QARB 4F3OA 4M9GA 4DFPA 3IHQB 3RTVA 5ALMA 5E79U 3TAQA 3FYHA 3QX7A 3WK9A 2VJ4A 4LJXA 4RQMA 1PVQA 1Z00A 4KLEA 4PGYA 3H40A 2UVUA 3EWAA 1JRPA 1ZQLA 1XS9D 1V38A 2UVWA 2PMZF 5ALWA 4O3MA 1XSLA 4O9MA 2E5SA 1QQ5A 3SYZA 7ICVA 4ED0A 4PHDA 1ZQTA 3LVWA 8ICXA 1XO1A 3QNMA 4NL9C 4UW9A 4F4YA 3B9JA 5CB1A 1RZTA 1DGJA 2JXJA 2C22A 2YMMA 2KFZA 2J6SA 4F2SA 5DQHA 1H38A 1U48A 2K4PA 2W54A 2R8HA 7ICFA 4KMUA 2W7PA 1NNLA 3KKAA 5DDYA 5DQGA 2DBYA 3ICXA 2RRDA 1BPXA 1QSLA 2K8CB 1PK1A 4YP3A 5KG3A 5HR7A 9ICBA 3RFAA 3IP4B 1ZQXA 2ISPA 4OJPA 3QZ7A 4KLMA 1F44A 4Y2YA 2VKQA 4K4HA 4EYIB 5T14A 5ALKA 1SWVA 4ED8A 2ZIUB 2IOFK 1WCLA 4NLGA 4IL6U 5AM2A 3RBEA 3N4MB 5B66U 2WF9A 5ALFA 9ICJA 1BGXT 4PL2A 1S0OA 5CR0A 3GV7B 2GLEA 5F9NA 4CCHA 3I1YA 3HWTA 3SI8A 2E3TA 5DDMA 5FP0A 2Q0ZX 2BZFA 7ICTA 2VA3A 4EX7A 4DLEA 3RJHA 3PR4A 3MGHA 9ICSA 3QU5A 2FLNA 4E0DA 2F1JA 3RB6A 5G5HA 3MR2A 4IRKA 3K4GA 4QZCA 1RQNA 1ZJMA 1ZYQA 5BPCA 2MAXA 2K60A 5IIJA 1LKYA 2F8KA 1KQQA 3PW5A 2EANA 1KFTA 4PZOA 2ISOA 1JI7A 5KL1B 2KSOB 8ICYA 3H0LB 4RPXA 2JV3A 2IOHA 1YT3A 2BDPA 3BQ7A 1D8YA 1K5OA 2GWSA 4FS2A 3RAQA 5KTQA 3FC4A 3KTQA 5DKWA 4CE6A 5KFCA 4KLLA 4BJQA 2XIDA 1CRXA 8ICIA 3PSIA 3BJYA 1JALA 3L3FX 2OYYA 4UARA 4C8LA 1LV5A 2KVCA 3SMVA 4I2DA 1B0XA 4BWJA 5AM0A 3G6YA 4RQ4A 4FO6A 5KG0A 3RJEA 1ZQWA 4J9NA 9ICTA 1JXLA 1NKEA 5DGBA 3GDXA 5L1IA 4F4XA 4Q8FA 1JN3A 2EAMA 4C8NA 2A3VA 1V85A 2P35A 5JUMA 4Q44A 2KP7A 3F53A 1X2IA 1QTMA 2XGPA 2PFNA 4M9JA 4J9RA 3AEVA 2H3FA 1AROP 4Y2JA 2N1RA 4F50A 1N56A 5ALZA 4B9TA 5AI9A 4O3QA 2ZIWA 2FE9A 3AQEA 3F5AA 1F0MA 4QZ9A 4YQWA 3TANA 4IRDA 2DPIA 4USAA 4ECSA 4UBBA 1JROA 2Z7JA 4R64A 3KKAC 1XO0A 4ECYA 7ICHA 4GXKA 4P0QB 3N7RC 1N60A 4RQ3A 5HMMA 2D3DA 7ICIA 5KG6A 2OHFA 1VJ5A 7ICMA 1LVHA 3UPQA 4ECRA 4Q43A 8ICNA 4PGXA 5L9XA 2XI9A 4BGDA 3OHBA 1KSPA 1X9SA 3D2SA 5C5JA 1ZQFA 5AICA 4P0PA 4RNNA 3ISCA 3WKDA 8ICQA 3TARA 3JPOA 9ICMA 5AK6A 4UB1A 3M6KA 3OSPA 4FFDA 4NLBA 3SENA 3K1RB 4GC6A 8ICRA 4NM1A 4FS1A 3MBYA 3RJFA 5KG5A 1BVSA 3PX0A 1QLNA 4CNQA 2J6TA 1Q8KA 1XSPA 1ZQGA 2AU0A 2B6GA 1RM6C 3HPOA 4TUQA 1PVPA 3PMLA 4KLHA 2XVTA 2AGQA 2ZUBA 7ICGA 3NTUA 1ZQ1C 2C2EA 2P6UA 1L3UA 3ZI4A 2IHMA 2CXYA 9ICHA 4YN4A 3C23A 3UXNA 3MABA 3H7IA 5J2BA 1DK3A 1Z1BA 2NRZA 4CF4A 4RZRA 2K4EA 3SR6A 1X40A 1CUKA 3GIIA 4ECQA 2NRVA 5KFVA 4RPYA 2IMWP 2YX8A 4QZ8A 2FLLA 3NVVA 3PSFA 4YXJA 1KFSA 1S8OA 4ECZA 1NK5A 2ZUDA 3PSPA 5CWRA 4NXZA 3NRZA 2NO4A 1UHUA 3QUTA 4QWDA 1U47A 1V97A 2MUTB 4BXOB 2RP5A 3V6JA 2BQRA 2V4RA 2AQ0A 5KFKA 1RDFA 3LK9A 1TVAA 2G09A 5EWGA 3CRXA 4DQIA 2LHTA 3K1ZA 3G6XA 1NK4A 1UA1A 3CNHA 1QH9A 1Z00B 2ZIVB 2R8IA 2BHNA 1NJYA 5KFEA 2JH7A 3VCBA 4UAWA 1XC9A 1ZQHA 3RRGA 5KFRA 1KW4A 5KFHA 4DQQA 4PHPA 3H8JA 2B21A 4JV1A 2LYBA 1NK9A 4ELVA 1N5WA 4GIBA 4KLDA 4IC9A 5KG4A 2JGAA 2KNJA 1L3TA 2ATLA 2XC9A 1Q46A 4AYBC 3QEBZ 4UB8U 5KFZA 4OJ6A 1WG8A 3L4PA 2XY6A 4DF4A 3M8SA 1BPDA 4RT2A 5KFMA 3OJSA 4F8RA 3KFUF 2W9CB 1U9LA 2LI6A 5J2HA 5KFYA 3KZIU 4QWAA 3IV6A 4MFAA 3V72A 4KN4A 3NASA 5AI6A 4B9MA 4XA5A 3B0XA 3CW2C 5GTIU 5CA7A 4KLJA 1X9WA 2OM6A 4M2YA 3UMCA 2G08A 1SB3C 5B5EU 3SQIA 2HMXA 2YQEA 4IRCA 3QYPA 3BS5B 3AU6A 4PH5A 3UQ0A 3RJGA 2FDRA 2W11A 2F2AB 4O5KA 1SXDA 1PUZA 3C2KA 4CF3A 4G3IA 1ZD2P 4M04A 1ZD4A 5DG9A 5AKEA 5KT6A 3ZDEA 4EELA 3RB0A 4GXJA 4JB3A 2KJ9A 4DOCA 1AQ6A 4IR1A 4P2HA 4K4GA 3OPXA 5KNIA 5L1KA 3LYSA 4O3OA 3TKAA 4F93B 3WKBA 8ICZA 2KICA 1MC8A 4JMUA 1T94A 3WK8A 4UB3A 2A1JB 2GOLA 2WFAA 3QU7A 1L5UA 2HBKA 1ZQIA 1ZQEA 7ICNA 3MGIA 3H0MB 2VIXA 5AK3A 1WCNA 1Z4NA 4I2BA 1D9FA 3KHHA 4AYBF 4PHAA 3H8WA 4KLGA 4C7ZA 4F5RA 9ICEA 2JRZA 4ECWA 3FM9A 3WK7A 2Q4TA 2W3SA 1ZQUA 4Q45A 2ZIXB 8ICKA 3R9KA 4Y2UA 1ZD3A 4F72A 2ALZA 9ICKA 2PKEA 2LM1A 2PFQA 2E1EA 1F5SA 2LBOA 5AI8A 1TK0A 1FFVA 3H4DA 4OJLA 4R8UA 1NK8A 4UAYA 5KL8B 2PFPA 4QNLA 2LM4A 1KBUA 2JZBB 4DQPA 8ICUA 5AKJA 2HBMA 3D6JA 1YZ7A 4NJ8A 2JEIA 1X6JA 4JK1A 2KN7A 4ED3A 8ICFA 4EBEA 9ICQA 5ALLA 1Z19A 3PR5B 5IIOA 2VA8A 2F1IA 1UQVA 2NV3A 5EWEA 4M9LA 4OO1J 2W55A 5ALQA 8ICOA 5CHGA 2NRXA 4YR0A 4B9SA 2F77X 5L1MA 4C4SA 4IQWA 8ICCA 3PNCA 4EX6A 5J0PA 4B9UA 3E2EA 5KG7A 3OGUA 2KOBA 1SKSA 2HHUA 5HR6A 2ZIWB 3RH6A 1S0NA 1CEZA 2XY7A 1MQ2A 2D8CA 2OH2A 1MA7A 1J2NA 5TZVA 3QUCA 4RQNA 2W9BA 3BQ0A 4I2FA 4R65A 4ECUA 3I76A 3IG5A 1O03A 1T4GA 1Z3EB 2RLTA 3HP6A 1ZQRA 4JV0A 1NI3A 5D4BA 4F4KA 2IOFA 2G07A 4YFKA 3TI0A 3PW4A 2G5IB 1RXVA 2W43A 4TURA 4RUCA 2AGOA 3V7KA 4QWBA 4G9BA 1CI4A 3MR3A 2IHNA 1KKXA 1T3NA 2PFOA 1BPBA 4RUAA 2VA2A 1COOA 1QSSA 4DEZA 4P0PB 2FPKA 5AKZA 4R63A 3IDWA 3RH5A 1L7MA 3QZ8A 2LYHA 3Q8MA 2DKZA 2C2RA 1JXEA 3QU9A 1ZQKA 4KX5A 5ALGA 2FI1A 1LB2B 3Q8KA 1N5XA 4KLSA 1TV9A 2G5HB 3M8RA 2ZJ5A 4KMOB 3SD7A 4FZMA 2P6RA 2EZYA 3RJIA 3LWLA 3C21A 2NRTA 2HOFA 4MEXA 5KFLA 4OCZA 5CRXA 3F2BA 1L7PA 5HHIA 3ZDAA 5EOZA 3IN5A 2CRXA 2JMGA 1SGGA 4F91B 2BQUA 2CPRA 3OSNA 4EBDA 1DGSA 1X6IA 2F1HA 4ED7A 4MF2A 3HJEA 1C20A 5IIIA 2F76X 5AK4A 4DFDA 2I5HA 4UAZA 4Z6FA 2WF8A 1TAMA 5JTIA 5DB9A 4Y2PA 2OCEA 3UMGA 4UB2A 1DRGA 3EYZA 9ICUA 4XQ8A 2K4HA 3Q8LA 4YR3A 2OWOA 3WKEA 2XY5A 3F5EA 3H0RB 5AK5A 4GXIA 3T5KA 3QEAZ 3HILA 1FFUA 4M6WA 4KLUA 5AM1A 1JIHA 2Y0SC 2PI4A 2MSNA 3A0BU 4PZNA 1K1SA 4GC7A 1S0VA 4R66A 4O5EA 2KMDA 4DF8A 1TAQA 2KFNA 3C29A 2HBJA 3K75D 2BCRA 2ES6A 4KTQA 4GLXA 2QKQA 2RHFA 1T7PA 3H4BA 3RH4A 3BQ1A 3PO5A 4QJFB 2KZZA 3JPNA 2DQNB 5DG7A 3ZDBA 1KN5A 3D2NA 2Y9UA 4DS4A 2BKEA 5AM3A 2R8KA 2WF6A 2LYAA 3LDAA 3MR5A 3PX4A 4LVSA 4I2CA 7ICEA 3J81j 2R8GA 4DSEA 4ED2A 3UXPA 9ICIA 5DB7A 5ALUA 1SIJA 5KFTA 4LZDA 1V9PA 1ZJNA 2BGWA 5C0YA 4PGQA 4Y2XA 4F92B 1S9FA 1Z4OA 2K8AA 3WK4A 5ALIA 2ZIUA 3JPPA 3T5LA 4QZHA 4BX9C 5ALXA 4OD0A 1ZQQA 1A76A 4KN7A 5AKIA 4U6PA 3GV8B 2W7OA 2QB0B 8ICLA 1ZQAA 4F2RA 3QE9Y 1NZBA 3TQ1A 2HBLA 3DEEA 3RAXA 5JRTA 5AI5A 2JEJA 4DO9A 4M47A 3EPGA 3UXOA 2W03A 2C28A 1QSYA 2P66A 5J0XA 5DBCA 2R18A 4I29A 4EYHB 4O3PA 4NLZA 2HHVA 2Y0SF 4NLCA 1TKDA 2KTQA 4RQ1A 2ZUCA 4C8MA 4MF8A 7ICQA 1X9MA 3GV5B 2PI5A 4QIWC 1U45A 3H8SA 4IQVA 2K89A 4YXMA 3V7JA 5DGAA 1RYRA 2ZJAA 3PMNA 5D49A 5J0RA 3Q8PB 4NY8A 1U49A 2VANA 1RYSA 2NYVA 3TFSA 4RQ2A 9ICVA 4FZLA 8ICEA 9ICGA 3MFIA 1VLBA 2DPJA 4DL4A 2BPFA 5KFFA 4KLQA 2KSOA 2AXTU 3BS7A 5L1LA 1ZQCA 4YG2A 3AN1A 5ALJA 5KFIA 2ASDA 5KT5A 3M6ZA 5J2CA 5IINA 5KAIU 1TAUA 2ZJ8A 2H5XA 3H8MA 4NWIA 4EEKA 9ICFA 2WTFA 4UQGA 4FBTA 4FE3A 2E1FA 2ODGA 3GIMA 1ZQOA 8ICMA 5KT3A 4C8KA 2KKVA 2C2DA 4QWCA 1NKCA 1ZQMA 2BCUA 1ZQZA 5KFSA 5IILA 4Y2SA 1NOMA 1QQ6A 4TQRA 2XO7A 5TISU 2NO5A 1NK7A 4RU9A 3PW2A 3JPQA 4I27A 4QZIA 2HOIA 2PXIA 1JUDA 3MDCA 2JEGA 1OUQA 3F2CA 5F3XB 1DOQA 4CF5A 3C2LA 1ZD5A 4IR9A 4AP9A 2GO7A 2W9MA 4EZ9A 2G06A 1ZQBA 5IIMA 2QLTA 1L3SA 1N2XA 5AKXA 4MHVA 4M9NA 2DFLA 3RB4A 4I2HA 4QIWF 2FJ6A 2YMLA 3TADA 4F5QA 2W3RA 5DB6A 2W9AA 4I2IA 3AL0B 2HSZA 5AIBA 7ICSA 5KFDA 2FPMA 4UASA 4RNOA 5AKHA 3SV4A 3N97B 3KHRA 3UMBA 7ICPA 4P0QA 2JEFA 1PK1B 4OJ5A 5A0LA 1XNSA 1MQ3A 1S77D 2E8PA 2E8MA 2KV2A 4DOAA 2HOQA 3RR7A 5HNKA 2F3NA 1KDHA 3PZPA 2WAQC 3SZ2A 1L7NA 5KT2A 4PHEA 2DL0A 3WK5A 4BUGA 1NK0A 1B43A 3NVYA 4DL2A 4KLOA 2EAPA 5AI4A 5AHXA 4JUZA 1ZQJA 1ECWA 1QCKA 4FBUA 4DSJA 3RR8A 1XWLA 2JHDA 1K1QA 1SKRA 4B9LA 2EZXA 3AMZA 2A19A 2O6KA 4KLTA 5AKGA 5DLGA 4ECTA 2EQYA 4K4IA 3RF9A 2KJ8A 2RQ5A 4EEYA 3QUBA 3PW7A 4NLKA 4GFJA 3G6VA 2UVVA 7ICJA 4J9MA 1X42A 3AU2A 3SAFA 3WKCA 1MN8A 1KTQA 5GTHU 1NJWA 3HW8A 2HHSA 4U7CA 3GIJA 5ALVA 4O3RA 4Y2TA 5J0YA 5K4LA 1UT8A 2BPCA 1LKYB 4NLNA 2W8LA 3NGDA 1ZQYA 5DBBA 5ALPA 4US9A 4Z6EA 4MEYA 3M1YA 1S5LU 2BCVA 3N28A 2EDUA 1IM4A 1SWWA 3MGVA 5HHHA 3CP8A 4J9KA 3V6HA 4CRXA 3GU3A 2M0NA 4DFMA 5J0WA 2UVRA 3RJKA 1ZETA 1KFDA 2YB4A 3ZDCA 4EBCA 2MRLA 1J2MA 3LVVA 3E0FA 4J03A 5G5GA 2DUYA 4QZDA 3C2MA 5DG8A 4YMNA 2OXOA 3T3FA 4QZBA 2GH1A 2QB1A 4DL7A 2MUTA 5ALDA 3TAPA 4BXOA 2K8BB 5EWFA 2R8JA 2WAQF 4QZGA 4F5NA 4YMMA 5EE0A 9ICAA 2DF4B 3M9OB 5KG1A 1SXEA 3ETRA 3T5HA 1U4BA 4ELTA 5J0UA 2WHEA 1SL0A 3OTQA 4YCXA 3F2DA 3ZD9A 9ICRA 3RBDA 4RNMA 1FEZA 1UA0A 3WKAA 2ZIVA 3RJJA 1SZHA 1NZPA 4DL6A 1HUZA 5ALEA 5JU5A 4M6WB 2XICA 4YD1A 4M0AA 4O5CA 5KFJA 7ICLA 3HKZC 4RQ5A 5KFPA 5DLFA 8ICTA 3A0HU 3EZ5A 3GILA 8ICGA 2KIVA 4DSKA 4KLFA 4KX3A 3ED5A 1DK2A 4C80A 2AQ4A 2ZTCA 5EE9A 1S10A 2BCQA 8ICWA 7ICRA 3IM1A 1X66A 3TADC 3M7DA 4P4OA 3N7PD 3Q8SB 2EAOA 1HIWA 2BPGA 2W9CA 2D6FC 4ELUA 3ETLA 4RPZA 1WUDA 3PX6A 2AJQA 4CDGA 4X5VA 4C0ZA 3JPTA 2I9GA 4ZH4A 4OJOA 4F4WA 1SV0A 3GFKB 3QUQA 4Z6CA 3M9MB 3PV8A 3WK6A 1O08A 3TFRA 8ICAA 4ED1A 2WB1C 4J9LA 1ZQVA 5KG2A 4Y2QA 1XU4A 2HCFA 2RDIA 5ALOA 1KRPA 3BS5A 2HW3A 5KFXA 5BOLA 2XCAA 1D8BA 2AH5A 2HHQA 3AUOA 5KFWA 2V4QA 4RQ8A 1ED1A 1IV8A 2EH9A 1ZOLA 3BQ2A 4XRHA 5F9LA 3ZD8A 1KEJA 4IQTA 4BDPA 1WYGA 4RQ7A 4I28A 2HHXA 1A0PA 1BNPA 5L1JA 2KVSA 3GIKA 2KHQA 4KITB 2RDJA 4QWEA 1L8LA 4ICAA 4DCCA 5J2AA 5J2EA 4O0IA 1SZPA 3AM9A 1VDVA 2DWQA 2HHTA 4DSLA 2BCSA 1ZXIA 1WWVA 2BQ3A 1PK3A 1ZQDA 4C4RA 4DQRA 3HKZF 1GO3F 1C7YA 1HJPA 2WF7A 4QW8A 2A1JA 1PVRA 3T79A 2KKPA 2KG5A 5ALTA 1COKA 4F71A 9ICXA 1L6NA 3D2QA 3UQ2A 4JV2A 4IQUA 1YZ6A 1MSWD 4UATA 1TFRA 1ZQSA 2FLPA 3NVZA 2ZXHA 1T8EA 4C7YA 2LPEA 2E8NA 1D9DA 2HVIA 2F8LA 4J9OA 1SKWA 1BPEA 1XSNA 2M9NA 1BPZA 1A6SA 8ICSA 5ALYA 2FMQA 2ZIXA 4DLGA 2YTUA 3PY8A 5AKKA 5J0SA 3C1YA 4P4MA 5DQIA 4DFKA 1NJZA 5J8YA 4RQ0A 3MDAA 2QARA 4BWMA 3THVA 1JMSA 4RT3A 5J2GA 4YVZA 2FPLA 5ALHA 2CN1A 4HYKA 3FAHA 3U26A 2WB1F 1RG6A 5J29A 4NM2A 8ICBA 1TK8A 2JZBA 2KD1A 9ICLA 4DSIA 2XCPA 4O3NA 3V7LA 3BZKA 2ZTEA 3ONNA 2DGZA 5KFQA 2Y1IA 3QU4A 4DOBA 1S0MA 5KFGA 5J0TA 2I6XA 1PZNA 3MC1A 4QZAA 3B0YA 2I1QA 3L5KA 1Q3VA 1JX4A 2J6UA 4UB6U 2KIWA 5KFUA 1IXRA 5KFAA 2K4IA 1RPLA 1N61A 4HAIA 3EUB2 1BNOA 5EE1A 1S97A 4DL5A 2B0CA 4I2GA 5J2FA 3BDPA 5CP2A 3JPSA 4TQSA 4B9VA 4I2JA 1IIPA 2H3VA 5AI0A 4C8OA 2HI0A 1M6YA 1N63A 1RQLA 4FZNA 4PL1A 3JPRA 2HVHA 3NVWA 4LZGA 3E58A 1S76D 1SV0C 3ALRA 2WF5A 1L3VA 9ICCA 8ICJA 2LKYA 4M9HA 1P7DA 1B4FA 2MA1A 3T5JA 4J9PA 2NRWA 4B6JA 1SL1A 4A8EA 1WWUA 2KK0A 3KHLA 5J2DA 1J97A 5J2KA 1Q3UA 2FMSA
chains in the Genus database with same CATH topology
2MRLA 2WB1F 3LVVA 3E0FA 3H0LB 2RHFA 3N7RC 4FZLA 4NV0A 4P0QB 2WB1C 1YT3A 2VJ5A 2RP5A 4KX5A 2W04A 4QJFB 2F2AB 2OXOA 2KD1A 2DQNB 1Z19A 2GH1A 3C28A 4P0QA 5A0LA 3KZXA 4OJ5A 2NV3A 3ONNA 1XNSA 2G5HB 2KV2A 2XI9A 2HOQA 4OO1J 2DGZA 2JH1A 2K8BB 1XO0A 3AQFA 1D8BA 2WAQF 3D2SA 3D2NA 2G09A 4BJQA 2W7PA 2XIDA 3M6ZA 2KHVA 4KMOB 3PZPA 1CRXA 2WAQC 3ICXA 3PSIA 3CRXA 2DF4B 4P0PA 2RRDA 2KJ9A 3L3FX 2K8CB 4FZMA 2F77X 2LHTA 1ED1A 2H3QA 2OYYA 3K1ZA 5HR7A 4NWIA 3RFAA 4BUGA 3M6KA 2LYAA 3IP4B 3OPXA 1A0PA 4OJPA 3LYSA 2KVCA 1Q3VA 3SMVA 2ZG6A 3NUQA 2ZIVB 4NLBA 1UPHA 2HOFA 2BDUA 4FE3A 3F2DA 2E1FA 1F44A 2JH7A 2KHQA 2KICA 2KIWA 2VKQA 4ICAA 5CRXA 2ZXIA 3F2BA 3VCBA 2KJ5A 2KOBA 5T14A 2K4IA 3GZFA 1ECWA 2H3ZA 2YB1A 4JMUA 1T94A 1URJA 2ZIVA 3IN5A 2ZIUB 3O0FA 2CRXA 2JMGA 5HR6A 2JHDA 2ZIWB 1SZHA 3IG8A 2KKVA 3NRWA 2GOLA 5C0YA 2CPRA 2XICA 4WJ3B 3HKZF 2LYBA 1GO3F 2HBKA 3SAHA 2K8AA 2OH2A 3HKZC 1MA7A 3N7SC 2ZIUA 2F76X 4IC9A 1PVRA 2JGAA 3H0MB 3RF9A 3T79A 2KJ8A 2KKPA 2VIXA 2KNJA 2A3VA 4BX9C 1PVPA 3IG5A 1L6NA 2XVTA 4PL2A 3D2QA 4KX3A 4AYBF 4GFJA 4U6PA 2W7OA 4AYBC 1TAMA 1ZQ1C 3F53A 1IIPA 4OJ6A 2HOIA 3SAFA 2VJ4A 2H3VA 1NZBA 1PVQA 1DRGA 1OUQA 4ACOA 2HBLA 2ZXHA 3F2CA 2Q4TA 3DEEA 4FZNA 4PL1A 2G07A 3KFUF 2K4HA 4U7CA 2ZIXB 2G5IB 2F8LA 2H3FA 3M7DA 4CGZA 3VC8A 1Z1BA 3F5EA 3N7PD 3H0RB 2G06A 2N1RA 2K4EA 2W03A 1HIWA 3SAGA 1A6SA 2ZIWA 2PMZF 2R18A 3ALRA 4O3MA 2ZIXA 3AQEA 2D6FC 2E1EA 3F5AA 2Y0SF 4NLCA 2E5SA 2PMZC 2YX8A 2LBOA 1HEKA 4P0PB 2Y0SC 2LKYA 4QIWF 3PSTA 1WUDA 4OJLA 3PSFA 1P7DA 3LVWA 3MGVA 2MA1A 4CDGA 4QIWC 3CP8A 2K89A 4C0ZA 3PSPA 2H3IA 3CYMA 2OM6A 5KL8B 4OJOA 2G0AA 3C29A 4A8EA 4CRXA 2HBJA 2M0NA 3GU3A 4QNLA 2G08A 1KBUA 2Z7JA 2YB4A 3SQIA 1Q3UA 2HMXA 3AL0B 2KEYA 2HBMA 2CN1A 5KL1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MA7 A;  1A0P A;  1PVR A;  2KJ8 A;  2KKP A;  3LYS A;  1Q3V A;  2A3V A;  2HOF A;  1PVP A;  2OXO A;  1F44 A;  2KD1 A;  2KHQ A;  1Z19 A;  2KIW A;  5CRX A;  3C28 A;  2KJ5 A;  2KOB A;  1XNS A;  1P7D A;  2HOI A;  3MGV A;  1NZB A;  1PVQ A;  1DRG A;  1OUQ A;  4ACO A;  2CRX A;  2KHV A;  3C29 A;  3NRW A;  4A8E A;  2KKV A;  1CRX A;  3CRX A;  4CRX A;  2KJ9 A;  1KBU A;  1Z1B A;  1Q3U A;  2KEY A;  1XO0 A; 
#chains in the Genus database with same CATH topology
 4B9N A;  2W8K A;  3PO4 A;  3PW0 A;  2XGQ A;  4I2A A;  2Y1J A;  3EPI A;  3C28 A;  5AKL A;  3OHA A;  4JWM A;  3KOO A;  1OXJ A;  5ALN A;  4Y2R A;  3ISD A;  3AQF A;  4UB4 A;  5J2I A;  2AGP A;  2KHV A;  2ASJ A;  3MFH A;  5IIK A;  4IS7 A;  2IBK A;  2IA6 A;  3LWM A;  2ZG6 A;  5H2F U;  5KAF U;  1NKB A;  3NUQ A;  4YD2 A;  3ZDD A;  1UPH A;  2L5Y A;  5KT4 A;  3IRU A;  2KJ5 A;  4UAV A;  4XUS A;  2FMP A;  2YB1 A;  2ESE A;  1Z1V A;  9ICN A;  3O0F A;  5CEH A;  1L7O A;  5KFO A;  5AIA A;  1ZQN A;  3IG8 A;  4DWI A;  4WJ3 B;  1QQ7 A;  3KHG A;  3RRH A;  4YR2 A;  7ICO A;  3QXG A;  2DKX A;  4F5P A;  2YN4 A;  2JR5 A;  1FO4 A;  4US8 A;  5D46 A;  2HDO A;  5CJ7 A;  5J8Y C;  3HRD D;  1ZRM A;  3KBB A;  3ORY A;  4CGZ A;  1T3Q A;  3VC8 A;  1HUO A;  8ICH A;  4ED6 A;  1N48 A;  3PVX A;  4R8U B;  3C5F A;  4JWN A;  1RXW A;  1HEK A;  8ICP A;  4EZ6 A;  4C4T A;  2H3I A;  3CYM A;  9ICO A;  1A77 A;  5AM4 A;  1B22 A;  5J0Q A;  3I28 A;  1X9X A;  5J2J A;  4PPX A;  1KLN A;  4NV0 A;  1UT5 A;  1TK5 A;  2A1A A;  9ICP A;  2ZTD A;  5DBA A;  3S6J A;  4QZF A;  2VJ5 A;  3ISB A;  2W04 A;  4I2E A;  4DQS A;  2KE7 A;  3DDH A;  4NL9 A;  5KFB A;  5AKY A;  7ICU A;  1L8O A;  4ZOH C;  3V6K A;  2JH1 A;  2YY6 A;  4J9Q A;  3C1Z A;  4MFC A;  1KL9 A;  4QW9 A;  2H3Q A;  1BPY A;  3Q8Q B;  5AM5 A;  5HP4 A;  4DFJ A;  2EZZ A;  4Q8E A;  1RYU A;  2ZXI A;  4DS5 A;  5BOM A;  4KLI A;  4EEN A;  2KZ3 A;  1TE2 A;  3GZF A;  2H3Z A;  4F4Z A;  1URJ A;  3KD3 A;  2W9B B;  4MFF A;  1Y88 A;  2AHO B;  3SAH A;  2KZM A;  5ALS A;  3N7S C;  3MR6 A;  4YMO A;  3EW9 A;  2ASL A;  3RB3 A;  3SV3 A;  3SEI A;  2OEH A;  1ZQP A;  3WU2 U;  4ACO A;  3HT3 A;  4UB5 A;  3HX0 A;  3Q8R B;  5KT7 A;  4UBC A;  2QB0 A;  1NK6 A;  4QZE A;  1DXS A;  1NJX A;  1OW5 A;  4RQ6 A;  4F5O A;  3SAG A;  1N62 A;  3GQC A;  4ECX A;  4ECV A;  2PMZ C;  1D8L A;  1FIQ A;  3PST A;  3C5G A;  8ICV A;  2G0A A;  1EXN A;  3OJU A;  5HML A;  4PJ0 U;  2KEY A;  5DB8 A;  3TAC B;  4UAU A;  2MU2 A;  4Y2V A;  2E8O A;  3M9N B;  3NS1 A;  2YMQ A;  3KZX A;  1IG6 A;  5J0O A;  4Z6D A;  1UCV A;  9ICW A;  2Y9T A;  5ALR A;  4TUP A;  1ZRN A;  4DL3 A;  4TUS A;  3FDS A;  3BZC A;  2LMR A;  3DV9 A;  3UM9 A;  2HHW A;  2YMP A;  2BR0 A;  2BDU A;  1SV4 A;  5EE3 A;  2V9W A;  2F44 A;  4P4P A;  3QU2 A;  4O3S A;  7ICK A;  4DSF A;  3NRW A;  1SL2 A;  4J9S A;  5KFN A;  3BQT A;  2QAR B;  4F3O A;  4M9G A;  4DFP A;  3IHQ B;  3RTV A;  5ALM A;  5E79 U;  3TAQ A;  3FYH A;  3QX7 A;  3WK9 A;  2VJ4 A;  4LJX A;  4RQM A;  1PVQ A;  1Z00 A;  4KLE A;  4PGY A;  3H40 A;  2UVU A;  3EWA A;  1JRP A;  1ZQL A;  1XS9 D;  1V38 A;  2UVW A;  2PMZ F;  5ALW A;  4O3M A;  1XSL A;  4O9M A;  2E5S A;  1QQ5 A;  3SYZ A;  7ICV A;  4ED0 A;  4PHD A;  1ZQT A;  3LVW A;  8ICX A;  1XO1 A;  3QNM A;  4NL9 C;  4UW9 A;  4F4Y A;  3B9J A;  5CB1 A;  1RZT A;  1DGJ A;  2JXJ A;  2C22 A;  2YMM A;  2KFZ A;  2J6S A;  4F2S A;  5DQH A;  1H38 A;  1U48 A;  2K4P A;  2W54 A;  2R8H A;  7ICF A;  4KMU A;  2W7P A;  1NNL A;  3KKA A;  5DDY A;  5DQG A;  2DBY A;  3ICX A;  2RRD A;  1BPX A;  1QSL A;  2K8C B;  1PK1 A;  4YP3 A;  5KG3 A;  5HR7 A;  9ICB A;  3RFA A;  3IP4 B;  1ZQX A;  2ISP A;  4OJP A;  3QZ7 A;  4KLM A;  1F44 A;  4Y2Y A;  2VKQ A;  4K4H A;  4EYI B;  5T14 A;  5ALK A;  1SWV A;  4ED8 A;  2ZIU B;  2IOF K;  1WCL A;  4NLG A;  4IL6 U;  5AM2 A;  3RBE A;  3N4M B;  5B66 U;  2WF9 A;  5ALF A;  9ICJ A;  1BGX T;  4PL2 A;  1S0O A;  5CR0 A;  3GV7 B;  2GLE A;  5F9N A;  4CCH A;  3I1Y A;  3HWT A;  3SI8 A;  2E3T A;  5DDM A;  5FP0 A;  2Q0Z X;  2BZF A;  7ICT A;  2VA3 A;  4EX7 A;  4DLE A;  3RJH A;  3PR4 A;  3MGH A;  9ICS A;  3QU5 A;  2FLN A;  4E0D A;  2F1J A;  3RB6 A;  5G5H A;  3MR2 A;  4IRK A;  3K4G A;  4QZC A;  1RQN A;  1ZJM A;  1ZYQ A;  5BPC A;  2MAX A;  2K60 A;  5IIJ A;  1LKY A;  2F8K A;  1KQQ A;  3PW5 A;  2EAN A;  1KFT A;  4PZO A;  2ISO A;  1JI7 A;  5KL1 B;  2KSO B;  8ICY A;  3H0L B;  4RPX A;  2JV3 A;  2IOH A;  1YT3 A;  2BDP A;  3BQ7 A;  1D8Y A;  1K5O A;  2GWS A;  4FS2 A;  3RAQ A;  5KTQ A;  3FC4 A;  3KTQ A;  5DKW A;  4CE6 A;  5KFC A;  4KLL A;  4BJQ A;  2XID A;  1CRX A;  8ICI A;  3PSI A;  3BJY A;  1JAL A;  3L3F X;  2OYY A;  4UAR A;  4C8L A;  1LV5 A;  2KVC A;  3SMV A;  4I2D A;  1B0X A;  4BWJ A;  5AM0 A;  3G6Y A;  4RQ4 A;  4FO6 A;  5KG0 A;  3RJE A;  1ZQW A;  4J9N A;  9ICT A;  1JXL A;  1NKE A;  5DGB A;  3GDX A;  5L1I A;  4F4X A;  4Q8F A;  1JN3 A;  2EAM A;  4C8N A;  2A3V A;  1V85 A;  2P35 A;  5JUM A;  4Q44 A;  2KP7 A;  3F53 A;  1X2I A;  1QTM A;  2XGP A;  2PFN A;  4M9J A;  4J9R A;  3AEV A;  2H3F A;  1ARO P;  4Y2J A;  2N1R A;  4F50 A;  1N56 A;  5ALZ A;  4B9T A;  5AI9 A;  4O3Q A;  2ZIW A;  2FE9 A;  3AQE A;  3F5A A;  1F0M A;  4QZ9 A;  4YQW A;  3TAN A;  4IRD A;  2DPI A;  4USA A;  4ECS A;  4UBB A;  1JRO A;  2Z7J A;  4R64 A;  3KKA C;  1XO0 A;  4ECY A;  7ICH A;  4GXK A;  4P0Q B;  3N7R C;  1N60 A;  4RQ3 A;  5HMM A;  2D3D A;  7ICI A;  5KG6 A;  2OHF A;  1VJ5 A;  7ICM A;  1LVH A;  3UPQ A;  4ECR A;  4Q43 A;  8ICN A;  4PGX A;  5L9X A;  2XI9 A;  4BGD A;  3OHB A;  1KSP A;  1X9S A;  3D2S A;  5C5J A;  1ZQF A;  5AIC A;  4P0P A;  4RNN A;  3ISC A;  3WKD A;  8ICQ A;  3TAR A;  3JPO A;  9ICM A;  5AK6 A;  4UB1 A;  3M6K A;  3OSP A;  4FFD A;  4NLB A;  3SEN A;  3K1R B;  4GC6 A;  8ICR A;  4NM1 A;  4FS1 A;  3MBY A;  3RJF A;  5KG5 A;  1BVS A;  3PX0 A;  1QLN A;  4CNQ A;  2J6T A;  1Q8K A;  1XSP A;  1ZQG A;  2AU0 A;  2B6G A;  1RM6 C;  3HPO A;  4TUQ A;  1PVP A;  3PML A;  4KLH A;  2XVT A;  2AGQ A;  2ZUB A;  7ICG A;  3NTU A;  1ZQ1 C;  2C2E A;  2P6U A;  1L3U A;  3ZI4 A;  2IHM A;  2CXY A;  9ICH A;  4YN4 A;  3C23 A;  3UXN A;  3MAB A;  3H7I A;  5J2B A;  1DK3 A;  1Z1B A;  2NRZ A;  4CF4 A;  4RZR A;  2K4E A;  3SR6 A;  1X40 A;  1CUK A;  3GII A;  4ECQ A;  2NRV A;  5KFV A;  4RPY A;  2IMW P;  2YX8 A;  4QZ8 A;  2FLL A;  3NVV A;  3PSF A;  4YXJ A;  1KFS A;  1S8O A;  4ECZ A;  1NK5 A;  2ZUD A;  3PSP A;  5CWR A;  4NXZ A;  3NRZ A;  2NO4 A;  1UHU A;  3QUT A;  4QWD A;  1U47 A;  1V97 A;  2MUT B;  4BXO B;  2RP5 A;  3V6J A;  2BQR A;  2V4R A;  2AQ0 A;  5KFK A;  1RDF A;  3LK9 A;  1TVA A;  2G09 A;  5EWG A;  3CRX A;  4DQI A;  2LHT A;  3K1Z A;  3G6X A;  1NK4 A;  1UA1 A;  3CNH A;  1QH9 A;  1Z00 B;  2ZIV B;  2R8I A;  2BHN A;  1NJY A;  5KFE A;  2JH7 A;  3VCB A;  4UAW A;  1XC9 A;  1ZQH A;  3RRG A;  5KFR A;  1KW4 A;  5KFH A;  4DQQ A;  4PHP A;  3H8J A;  2B21 A;  4JV1 A;  2LYB A;  1NK9 A;  4ELV A;  1N5W A;  4GIB A;  4KLD A;  4IC9 A;  5KG4 A;  2JGA A;  2KNJ A;  1L3T A;  2ATL A;  2XC9 A;  1Q46 A;  4AYB C;  3QEB Z;  4UB8 U;  5KFZ A;  4OJ6 A;  1WG8 A;  3L4P A;  2XY6 A;  4DF4 A;  3M8S A;  1BPD A;  4RT2 A;  5KFM A;  3OJS A;  4F8R A;  3KFU F;  2W9C B;  1U9L A;  2LI6 A;  5J2H A;  5KFY A;  3KZI U;  4QWA A;  3IV6 A;  4MFA A;  3V72 A;  4KN4 A;  3NAS A;  5AI6 A;  4B9M A;  4XA5 A;  3B0X A;  3CW2 C;  5GTI U;  5CA7 A;  4KLJ A;  1X9W A;  2OM6 A;  4M2Y A;  3UMC A;  2G08 A;  1SB3 C;  5B5E U;  3SQI A;  2HMX A;  2YQE A;  4IRC A;  3QYP A;  3BS5 B;  3AU6 A;  4PH5 A;  3UQ0 A;  3RJG A;  2FDR A;  2W11 A;  2F2A B;  4O5K A;  1SXD A;  1PUZ A;  3C2K A;  4CF3 A;  4G3I A;  1ZD2 P;  4M04 A;  1ZD4 A;  5DG9 A;  5AKE A;  5KT6 A;  3ZDE A;  4EEL A;  3RB0 A;  4GXJ A;  4JB3 A;  2KJ9 A;  4DOC A;  1AQ6 A;  4IR1 A;  4P2H A;  4K4G A;  3OPX A;  5KNI A;  5L1K A;  3LYS A;  4O3O A;  3TKA A;  4F93 B;  3WKB A;  8ICZ A;  2KIC A;  1MC8 A;  4JMU A;  1T94 A;  3WK8 A;  4UB3 A;  2A1J B;  2GOL A;  2WFA A;  3QU7 A;  1L5U A;  2HBK A;  1ZQI A;  1ZQE A;  7ICN A;  3MGI A;  3H0M B;  2VIX A;  5AK3 A;  1WCN A;  1Z4N A;  4I2B A;  1D9F A;  3KHH A;  4AYB F;  4PHA A;  3H8W A;  4KLG A;  4C7Z A;  4F5R A;  9ICE A;  2JRZ A;  4ECW A;  3FM9 A;  3WK7 A;  2Q4T A;  2W3S A;  1ZQU A;  4Q45 A;  2ZIX B;  8ICK A;  3R9K A;  4Y2U A;  1ZD3 A;  4F72 A;  2ALZ A;  9ICK A;  2PKE A;  2LM1 A;  2PFQ A;  2E1E A;  1F5S A;  2LBO A;  5AI8 A;  1TK0 A;  1FFV A;  3H4D A;  4OJL A;  4R8U A;  1NK8 A;  4UAY A;  5KL8 B;  2PFP A;  4QNL A;  2LM4 A;  1KBU A;  2JZB B;  4DQP A;  8ICU A;  5AKJ A;  2HBM A;  3D6J A;  1YZ7 A;  4NJ8 A;  2JEI A;  1X6J A;  4JK1 A;  2KN7 A;  4ED3 A;  8ICF A;  4EBE A;  9ICQ A;  5ALL A;  1Z19 A;  3PR5 B;  5IIO A;  2VA8 A;  2F1I A;  1UQV A;  2NV3 A;  5EWE A;  4M9L A;  4OO1 J;  2W55 A;  5ALQ A;  8ICO A;  5CHG A;  2NRX A;  4YR0 A;  4B9S A;  2F77 X;  5L1M A;  4C4S A;  4IQW A;  8ICC A;  3PNC A;  4EX6 A;  5J0P A;  4B9U A;  3E2E A;  5KG7 A;  3OGU A;  2KOB A;  1SKS A;  2HHU A;  5HR6 A;  2ZIW B;  3RH6 A;  1S0N A;  1CEZ A;  2XY7 A;  1MQ2 A;  2D8C A;  2OH2 A;  1MA7 A;  1J2N A;  5TZV A;  3QUC A;  4RQN A;  2W9B A;  3BQ0 A;  4I2F A;  4R65 A;  4ECU A;  3I76 A;  3IG5 A;  1O03 A;  1T4G A;  1Z3E B;  2RLT A;  3HP6 A;  1ZQR A;  4JV0 A;  1NI3 A;  5D4B A;  4F4K A;  2IOF A;  2G07 A;  4YFK A;  3TI0 A;  3PW4 A;  2G5I B;  1RXV A;  2W43 A;  4TUR A;  4RUC A;  2AGO A;  3V7K A;  4QWB A;  4G9B A;  1CI4 A;  3MR3 A;  2IHN A;  1KKX A;  1T3N A;  2PFO A;  1BPB A;  4RUA A;  2VA2 A;  1COO A;  1QSS A;  4DEZ A;  4P0P B;  2FPK A;  5AKZ A;  4R63 A;  3IDW A;  3RH5 A;  1L7M A;  3QZ8 A;  2LYH A;  3Q8M A;  2DKZ A;  2C2R A;  1JXE A;  3QU9 A;  1ZQK A;  4KX5 A;  5ALG A;  2FI1 A;  1LB2 B;  3Q8K A;  1N5X A;  4KLS A;  1TV9 A;  2G5H B;  3M8R A;  2ZJ5 A;  4KMO B;  3SD7 A;  4FZM A;  2P6R A;  2EZY A;  3RJI A;  3LWL A;  3C21 A;  2NRT A;  2HOF A;  4MEX A;  5KFL A;  4OCZ A;  5CRX A;  3F2B A;  1L7P A;  5HHI A;  3ZDA A;  5EOZ A;  3IN5 A;  2CRX A;  2JMG A;  1SGG A;  4F91 B;  2BQU A;  2CPR A;  3OSN A;  4EBD A;  1DGS A;  1X6I A;  2F1H A;  4ED7 A;  4MF2 A;  3HJE A;  1C20 A;  5III A;  2F76 X;  5AK4 A;  4DFD A;  2I5H A;  4UAZ A;  4Z6F A;  2WF8 A;  1TAM A;  5JTI A;  5DB9 A;  4Y2P A;  2OCE A;  3UMG A;  4UB2 A;  1DRG A;  3EYZ A;  9ICU A;  4XQ8 A;  2K4H A;  3Q8L A;  4YR3 A;  2OWO A;  3WKE A;  2XY5 A;  3F5E A;  3H0R B;  5AK5 A;  4GXI A;  3T5K A;  3QEA Z;  3HIL A;  1FFU A;  4M6W A;  4KLU A;  5AM1 A;  1JIH A;  2Y0S C;  2PI4 A;  2MSN A;  3A0B U;  4PZN A;  1K1S A;  4GC7 A;  1S0V A;  4R66 A;  4O5E A;  2KMD A;  4DF8 A;  1TAQ A;  2KFN A;  3C29 A;  2HBJ A;  3K75 D;  2BCR A;  2ES6 A;  4KTQ A;  4GLX A;  2QKQ A;  2RHF A;  1T7P A;  3H4B A;  3RH4 A;  3BQ1 A;  3PO5 A;  4QJF B;  2KZZ A;  3JPN A;  2DQN B;  5DG7 A;  3ZDB A;  1KN5 A;  3D2N A;  2Y9U A;  4DS4 A;  2BKE A;  5AM3 A;  2R8K A;  2WF6 A;  2LYA A;  3LDA A;  3MR5 A;  3PX4 A;  4LVS A;  4I2C A;  7ICE A;  3J81 j;  2R8G A;  4DSE A;  4ED2 A;  3UXP A;  9ICI A;  5DB7 A;  5ALU A;  1SIJ A;  5KFT A;  4LZD A;  1V9P A;  1ZJN A;  2BGW A;  5C0Y A;  4PGQ A;  4Y2X A;  4F92 B;  1S9F A;  1Z4O A;  2K8A A;  3WK4 A;  5ALI A;  2ZIU A;  3JPP A;  3T5L A;  4QZH A;  4BX9 C;  5ALX A;  4OD0 A;  1ZQQ A;  1A76 A;  4KN7 A;  5AKI A;  4U6P A;  3GV8 B;  2W7O A;  2QB0 B;  8ICL A;  1ZQA A;  4F2R A;  3QE9 Y;  1NZB A;  3TQ1 A;  2HBL A;  3DEE A;  3RAX A;  5JRT A;  5AI5 A;  2JEJ A;  4DO9 A;  4M47 A;  3EPG A;  3UXO A;  2W03 A;  2C28 A;  1QSY A;  2P66 A;  5J0X A;  5DBC A;  2R18 A;  4I29 A;  4EYH B;  4O3P A;  4NLZ A;  2HHV A;  2Y0S F;  4NLC A;  1TKD A;  2KTQ A;  4RQ1 A;  2ZUC A;  4C8M A;  4MF8 A;  7ICQ A;  1X9M A;  3GV5 B;  2PI5 A;  4QIW C;  1U45 A;  3H8S A;  4IQV A;  2K89 A;  4YXM A;  3V7J A;  5DGA A;  1RYR A;  2ZJA A;  3PMN A;  5D49 A;  5J0R A;  3Q8P B;  4NY8 A;  1U49 A;  2VAN A;  1RYS A;  2NYV A;  3TFS A;  4RQ2 A;  9ICV A;  4FZL A;  8ICE A;  9ICG A;  3MFI A;  1VLB A;  2DPJ A;  4DL4 A;  2BPF A;  5KFF A;  4KLQ A;  2KSO A;  2AXT U;  3BS7 A;  5L1L A;  1ZQC A;  4YG2 A;  3AN1 A;  5ALJ A;  5KFI A;  2ASD A;  5KT5 A;  3M6Z A;  5J2C A;  5IIN A;  5KAI U;  1TAU A;  2ZJ8 A;  2H5X A;  3H8M A;  4NWI A;  4EEK A;  9ICF A;  2WTF A;  4UQG A;  4FBT A;  4FE3 A;  2E1F A;  2ODG A;  3GIM A;  1ZQO A;  8ICM A;  5KT3 A;  4C8K A;  2KKV A;  2C2D A;  4QWC A;  1NKC A;  1ZQM A;  2BCU A;  1ZQZ A;  5KFS A;  5IIL A;  4Y2S A;  1NOM A;  1QQ6 A;  4TQR A;  2XO7 A;  5TIS U;  2NO5 A;  1NK7 A;  4RU9 A;  3PW2 A;  3JPQ A;  4I27 A;  4QZI A;  2HOI A;  2PXI A;  1JUD A;  3MDC A;  2JEG A;  1OUQ A;  3F2C A;  5F3X B;  1DOQ A;  4CF5 A;  3C2L A;  1ZD5 A;  4IR9 A;  4AP9 A;  2GO7 A;  2W9M A;  4EZ9 A;  2G06 A;  1ZQB A;  5IIM A;  2QLT A;  1L3S A;  1N2X A;  5AKX A;  4MHV A;  4M9N A;  2DFL A;  3RB4 A;  4I2H A;  4QIW F;  2FJ6 A;  2YML A;  3TAD A;  4F5Q A;  2W3R A;  5DB6 A;  2W9A A;  4I2I A;  3AL0 B;  2HSZ A;  5AIB A;  7ICS A;  5KFD A;  2FPM A;  4UAS A;  4RNO A;  5AKH A;  3SV4 A;  3N97 B;  3KHR A;  3UMB A;  7ICP A;  4P0Q A;  2JEF A;  1PK1 B;  4OJ5 A;  5A0L A;  1XNS A;  1MQ3 A;  1S77 D;  2E8P A;  2E8M A;  2KV2 A;  4DOA A;  2HOQ A;  3RR7 A;  5HNK A;  2F3N A;  1KDH A;  3PZP A;  2WAQ C;  3SZ2 A;  1L7N A;  5KT2 A;  4PHE A;  2DL0 A;  3WK5 A;  4BUG A;  1NK0 A;  1B43 A;  3NVY A;  4DL2 A;  4KLO A;  2EAP A;  5AI4 A;  5AHX A;  4JUZ A;  1ZQJ A;  1ECW A;  1QCK A;  4FBU A;  4DSJ A;  3RR8 A;  1XWL A;  2JHD A;  1K1Q A;  1SKR A;  4B9L A;  2EZX A;  3AMZ A;  2A19 A;  2O6K A;  4KLT A;  5AKG A;  5DLG A;  4ECT A;  2EQY A;  4K4I A;  3RF9 A;  2KJ8 A;  2RQ5 A;  4EEY A;  3QUB A;  3PW7 A;  4NLK A;  4GFJ A;  3G6V A;  2UVV A;  7ICJ A;  4J9M A;  1X42 A;  3AU2 A;  3SAF A;  3WKC A;  1MN8 A;  1KTQ A;  5GTH U;  1NJW A;  3HW8 A;  2HHS A;  4U7C A;  3GIJ A;  5ALV A;  4O3R A;  4Y2T A;  5J0Y A;  5K4L A;  1UT8 A;  2BPC A;  1LKY B;  4NLN A;  2W8L A;  3NGD A;  1ZQY A;  5DBB A;  5ALP A;  4US9 A;  4Z6E A;  4MEY A;  3M1Y A;  1S5L U;  2BCV A;  3N28 A;  2EDU A;  1IM4 A;  1SWW A;  3MGV A;  5HHH A;  3CP8 A;  4J9K A;  3V6H A;  4CRX A;  3GU3 A;  2M0N A;  4DFM A;  5J0W A;  2UVR A;  3RJK A;  1ZET A;  1KFD A;  2YB4 A;  3ZDC A;  4EBC A;  2MRL A;  1J2M A;  3LVV A;  3E0F A;  4J03 A;  5G5G A;  2DUY A;  4QZD A;  3C2M A;  5DG8 A;  4YMN A;  2OXO A;  3T3F A;  4QZB A;  2GH1 A;  2QB1 A;  4DL7 A;  2MUT A;  5ALD A;  3TAP A;  4BXO A;  2K8B B;  5EWF A;  2R8J A;  2WAQ F;  4QZG A;  4F5N A;  4YMM A;  5EE0 A;  9ICA A;  2DF4 B;  3M9O B;  5KG1 A;  1SXE A;  3ETR A;  3T5H A;  1U4B A;  4ELT A;  5J0U A;  2WHE A;  1SL0 A;  3OTQ A;  4YCX A;  3F2D A;  3ZD9 A;  9ICR A;  3RBD A;  4RNM A;  1FEZ A;  1UA0 A;  3WKA A;  2ZIV A;  3RJJ A;  1SZH A;  1NZP A;  4DL6 A;  1HUZ A;  5ALE A;  5JU5 A;  4M6W B;  2XIC A;  4YD1 A;  4M0A A;  4O5C A;  5KFJ A;  7ICL A;  3HKZ C;  4RQ5 A;  5KFP A;  5DLF A;  8ICT A;  3A0H U;  3EZ5 A;  3GIL A;  8ICG A;  2KIV A;  4DSK A;  4KLF A;  4KX3 A;  3ED5 A;  1DK2 A;  4C80 A;  2AQ4 A;  2ZTC A;  5EE9 A;  1S10 A;  2BCQ A;  8ICW A;  7ICR A;  3IM1 A;  1X66 A;  3TAD C;  3M7D A;  4P4O A;  3N7P D;  3Q8S B;  2EAO A;  1HIW A;  2BPG A;  2W9C A;  2D6F C;  4ELU A;  3ETL A;  4RPZ A;  1WUD A;  3PX6 A;  2AJQ A;  4CDG A;  4X5V A;  4C0Z A;  3JPT A;  2I9G A;  4ZH4 A;  4OJO A;  4F4W A;  1SV0 A;  3GFK B;  3QUQ A;  4Z6C A;  3M9M B;  3PV8 A;  3WK6 A;  1O08 A;  3TFR A;  8ICA A;  4ED1 A;  2WB1 C;  4J9L A;  1ZQV A;  5KG2 A;  4Y2Q A;  1XU4 A;  2HCF A;  2RDI A;  5ALO A;  1KRP A;  3BS5 A;  2HW3 A;  5KFX A;  5BOL A;  2XCA A;  1D8B A;  2AH5 A;  2HHQ A;  3AUO A;  5KFW A;  2V4Q A;  4RQ8 A;  1ED1 A;  1IV8 A;  2EH9 A;  1ZOL A;  3BQ2 A;  4XRH A;  5F9L A;  3ZD8 A;  1KEJ A;  4IQT A;  4BDP A;  1WYG A;  4RQ7 A;  4I28 A;  2HHX A;  1A0P A;  1BNP A;  5L1J A;  2KVS A;  3GIK A;  2KHQ A;  4KIT B;  2RDJ A;  4QWE A;  1L8L A;  4ICA A;  4DCC A;  5J2A A;  5J2E A;  4O0I A;  1SZP A;  3AM9 A;  1VDV A;  2DWQ A;  2HHT A;  4DSL A;  2BCS A;  1ZXI A;  1WWV A;  2BQ3 A;  1PK3 A;  1ZQD A;  4C4R A;  4DQR A;  3HKZ F;  1GO3 F;  1C7Y A;  1HJP A;  2WF7 A;  4QW8 A;  2A1J A;  1PVR A;  3T79 A;  2KKP A;  2KG5 A;  5ALT A;  1COK A;  4F71 A;  9ICX A;  1L6N A;  3D2Q A;  3UQ2 A;  4JV2 A;  4IQU A;  1YZ6 A;  1MSW D;  4UAT A;  1TFR A;  1ZQS A;  2FLP A;  3NVZ A;  2ZXH A;  1T8E A;  4C7Y A;  2LPE A;  2E8N A;  1D9D A;  2HVI A;  2F8L A;  4J9O A;  1SKW A;  1BPE A;  1XSN A;  2M9N A;  1BPZ A;  1A6S A;  8ICS A;  5ALY A;  2FMQ A;  2ZIX A;  4DLG A;  2YTU A;  3PY8 A;  5AKK A;  5J0S A;  3C1Y A;  4P4M A;  5DQI A;  4DFK A;  1NJZ A;  5J8Y A;  4RQ0 A;  3MDA A;  2QAR A;  4BWM A;  3THV A;  1JMS A;  4RT3 A;  5J2G A;  4YVZ A;  2FPL A;  5ALH A;  2CN1 A;  4HYK A;  3FAH A;  3U26 A;  2WB1 F;  1RG6 A;  5J29 A;  4NM2 A;  8ICB A;  1TK8 A;  2JZB A;  2KD1 A;  9ICL A;  4DSI A;  2XCP A;  4O3N A;  3V7L A;  3BZK A;  2ZTE A;  3ONN A;  2DGZ A;  5KFQ A;  2Y1I A;  3QU4 A;  4DOB A;  1S0M A;  5KFG A;  5J0T A;  2I6X A;  1PZN A;  3MC1 A;  4QZA A;  3B0Y A;  2I1Q A;  3L5K A;  1Q3V A;  1JX4 A;  2J6U A;  4UB6 U;  2KIW A;  5KFU A;  1IXR A;  5KFA A;  2K4I A;  1RPL A;  1N61 A;  4HAI A;  3EUB 2;  1BNO A;  5EE1 A;  1S97 A;  4DL5 A;  2B0C A;  4I2G A;  5J2F A;  3BDP A;  5CP2 A;  3JPS A;  4TQS A;  4B9V A;  4I2J A;  1IIP A;  2H3V A;  5AI0 A;  4C8O A;  2HI0 A;  1M6Y A;  1N63 A;  1RQL A;  4FZN A;  4PL1 A;  3JPR A;  2HVH A;  3NVW A;  4LZG A;  3E58 A;  1S76 D;  1SV0 C;  3ALR A;  2WF5 A;  1L3V A;  9ICC A;  8ICJ A;  2LKY A;  4M9H A;  1P7D A;  1B4F A;  2MA1 A;  3T5J A;  4J9P A;  2NRW A;  4B6J A;  1SL1 A;  4A8E A;  1WWU A;  2KK0 A;  3KHL A;  5J2D A;  1J97 A;  5J2K A;  1Q3U A;  2FMS A; 
#chains in the Genus database with same CATH homology
 2MRL A;  2WB1 F;  3LVV A;  3E0F A;  3H0L B;  2RHF A;  3N7R C;  4FZL A;  4NV0 A;  4P0Q B;  2WB1 C;  1YT3 A;  2VJ5 A;  2RP5 A;  4KX5 A;  2W04 A;  4QJF B;  2F2A B;  2OXO A;  2KD1 A;  2DQN B;  1Z19 A;  2GH1 A;  3C28 A;  4P0Q A;  5A0L A;  3KZX A;  4OJ5 A;  2NV3 A;  3ONN A;  1XNS A;  2G5H B;  2KV2 A;  2XI9 A;  2HOQ A;  4OO1 J;  2DGZ A;  2JH1 A;  2K8B B;  1XO0 A;  3AQF A;  1D8B A;  2WAQ F;  3D2S A;  3D2N A;  2G09 A;  4BJQ A;  2W7P A;  2XID A;  3M6Z A;  2KHV A;  4KMO B;  3PZP A;  1CRX A;  2WAQ C;  3ICX A;  3PSI A;  3CRX A;  2DF4 B;  4P0P A;  2RRD A;  2KJ9 A;  3L3F X;  2K8C B;  4FZM A;  2F77 X;  2LHT A;  1ED1 A;  2H3Q A;  2OYY A;  3K1Z A;  5HR7 A;  4NWI A;  3RFA A;  4BUG A;  3M6K A;  2LYA A;  3IP4 B;  3OPX A;  1A0P A;  4OJP A;  3LYS A;  2KVC A;  1Q3V A;  3SMV A;  2ZG6 A;  3NUQ A;  2ZIV B;  4NLB A;  1UPH A;  2HOF A;  2BDU A;  4FE3 A;  3F2D A;  2E1F A;  1F44 A;  2JH7 A;  2KHQ A;  2KIC A;  2KIW A;  2VKQ A;  4ICA A;  5CRX A;  2ZXI A;  3F2B A;  3VCB A;  2KJ5 A;  2KOB A;  5T14 A;  2K4I A;  3GZF A;  1ECW A;  2H3Z A;  2YB1 A;  4JMU A;  1T94 A;  1URJ A;  2ZIV A;  3IN5 A;  2ZIU B;  3O0F A;  2CRX A;  2JMG A;  5HR6 A;  2JHD A;  2ZIW B;  1SZH A;  3IG8 A;  2KKV A;  3NRW A;  2GOL A;  5C0Y A;  2CPR A;  2XIC A;  4WJ3 B;  3HKZ F;  2LYB A;  1GO3 F;  2HBK A;  3SAH A;  2K8A A;  2OH2 A;  3HKZ C;  1MA7 A;  3N7S C;  2ZIU A;  2F76 X;  4IC9 A;  1PVR A;  2JGA A;  3H0M B;  3RF9 A;  3T79 A;  2KJ8 A;  2KKP A;  2VIX A;  2KNJ A;  2A3V A;  4BX9 C;  1PVP A;  3IG5 A;  1L6N A;  2XVT A;  4PL2 A;  3D2Q A;  4KX3 A;  4AYB F;  4GFJ A;  4U6P A;  2W7O A;  4AYB C;  1TAM A;  1ZQ1 C;  3F53 A;  1IIP A;  4OJ6 A;  2HOI A;  3SAF A;  2VJ4 A;  2H3V A;  1NZB A;  1PVQ A;  1DRG A;  1OUQ A;  4ACO A;  2HBL A;  2ZXH A;  3F2C A;  2Q4T A;  3DEE A;  4FZN A;  4PL1 A;  2G07 A;  3KFU F;  2K4H A;  4U7C A;  2ZIX B;  2G5I B;  2F8L A;  2H3F A;  3M7D A;  4CGZ A;  3VC8 A;  1Z1B A;  3F5E A;  3N7P D;  3H0R B;  2G06 A;  2N1R A;  2K4E A;  2W03 A;  1HIW A;  3SAG A;  1A6S A;  2ZIW A;  2PMZ F;  2R18 A;  3ALR A;  4O3M A;  2ZIX A;  3AQE A;  2D6F C;  2E1E A;  3F5A A;  2Y0S F;  4NLC A;  2E5S A;  2PMZ C;  2YX8 A;  2LBO A;  1HEK A;  4P0P B;  2Y0S C;  2LKY A;  4QIW F;  3PST A;  1WUD A;  4OJL A;  3PSF A;  1P7D A;  3LVW A;  3MGV A;  2MA1 A;  4CDG A;  4QIW C;  3CP8 A;  2K89 A;  4C0Z A;  3PSP A;  2H3I A;  3CYM A;  2OM6 A;  5KL8 B;  4OJO A;  2G0A A;  3C29 A;  4A8E A;  4CRX A;  2HBJ A;  2M0N A;  3GU3 A;  4QNL A;  2G08 A;  1KBU A;  2Z7J A;  2YB4 A;  3SQI A;  1Q3U A;  2HMX A;  3AL0 B;  2KEY A;  2HBM A;  2CN1 A;  5KL1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...