2KL4A

Nmr structure of the protein nb7804a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
GSHMEVFAEYLKGIDHPDHRDRTEEILSWVAATFPNLEPQMKWNTPMFSNQGTFIIGFSTSKHHLSVSPEEIGISQFADAIAQAGYSATKGLFRIPWNDPVHYELLKQMIEFNIQDKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH2032 protein
publication title Solution structure of the protein NB7804A from Bacillus Halodurans
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 22
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08818 DUF1801 Domain of unknown function (DU1801)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kl4A00
2KL4A 2OC6A 2I8DA
chains in the Genus database with same CATH superfamily
1R58A 4KUMA 5HS7A 1R49A 1O7FA 1R23A 1ZQ3P 3HRSA 5M5XJ 2BY1A 2DK8A 1GXPA 4E4HA 3K1PA 2JK3A 2RNJA 2DJNA 3C3WA 2RVCA 3QPTA 3GW2A 1B6AA 3JRHA 4IKFA 1V5EA 1STZA 5E1WA 1YHQI 3PQKA 3L2VA 2O8XA 3BQZA 1OYIA 1PDNC 4B44A 4Q4ZF 5FRNA 1QNTA 2CUEA 3E5QA 2TRTA 5D8LB 1ETQA 4JX5A 2JVHA 4RAYA 4WK8F 3PQJA 3S1NJ 1YTYA 4RGUA 4ESBA 3CJTB 2PG4A 1OLTA 3LL7A 3FXKA 3KP6A 2DFFA 2ZMEC 3AL0B 2IA1A 1QU3A 2ZJRF 3PFYA 3DKXA 1TW2A 1U5TB 5EJCA 1D5VA 2YS9A 4CCOA 5ICEA 1POGA 3A1YA 3QPSA 1MNMC 2VBZA 1ZLKA 1OMIA 4LMYA 5JVTA 1WZ2A 2CQKA 2ZB9A 3A4CA 1ZG1A 4W97A 1A35A 3NARA 1R4MB 2LY2A 1FBQA 3DV8A 1F9NA 5HLIA 4WXHA 2BW3A 2BVMA 2K3PA 2C6YA 1J2XA 4JYKA 1I50J 3FKJA 5DTDA 2JA5J 2A61A 5CVJA 2YU3A 1YE9A 2H8RA 2ETHA 3RJPA 1RR7A 4HLYA 5GPCA 1IRFA 2IS1A 3DKYA 1HOMA 4I0BA 3FISA 3FMQA 1WJAA 1NG6A 4BU2A 5K7HA 2AQEA 4HPQA 2F5VA 4J19A 2HGCA 2F6CA 2HNHA 4DNCA 2FU4A 1O4XA 1SD5A 2CW8A 5JR3A 2QWWA 3ZMZA 3G4SI 1R1VA 2HQAA 4I0AA 3HOUJ 3WTTC 2K3FA 2M34A 5LD2C 2IP2A 2IA0A 4CYDA 2L02A 4EM1A 3SFIA 1HKSA 2EJRA 2M7BA 3F3XA 3LSPA 2NS0A 4KMUX 5BS6A 4BS9A 1XDUA 2LVSA 3I71A 4PCQA 3H5NA 3FXOA 3QODA 1LB2A 2Z9OA 3RCOA 2ME6A 2ID3A 1KU7A 3ABMH 5DYMA 1RESA 1ONVA 1LDJA 4IZZA 1FYMA 1FY7A 3GFIA 1ZRDA 2O9LA 2HPIA 2K40A 2K9LA 3WTSC 5ILSA 2VKHA 5M5WJ 3JSPA 3H9JA 3ZPLA 2MH9A 2FE3A 2WAQA 4DOZA 2VUMJ 1TQIA 2IGNA 3HSFA 4C3IJ 3ASNH 3S2DJ 1T98A 5DEQA 3B6CA 1X58A 3V7SA 3P9CA 4GRIA 2LG4A 3KP4A 2W25A 4ESFA 1VQPI 5JLWA 1FTZA 3COAC 4PJNA 1ACIA 1VQMI 2ELJA 4RGXA 4Y7NJ 4LD5A 4CDGA 3WTWC 3OSFA 2X0LA 3LAPA 3A01A 2IS6A 1FT9A 3LSJA 3HBLA 5DUIA 3CF5F 4E7IA 1KONA 4M6VA 2Y31A 3J7ZI 2OZUA 4O5VA 4PDKA 3SJMA 1YW8A 2RNGA 2UXXA 3R0AA 2KMUA 5B1AH 3RTRA 4DZPA 4HNUA 3G1MA 3PNYA 2JWTA 1LVAA 1I6XA 2ME0A 1H0MA 2I10A 3JRDA 3S1RJ 4Y4RA 1VQ7I 4MHGA 1JKPC 3LNQA 5E17F 2JA8J 3MN2A 1S6LA 3IP4B 3VSKA 3WGGA 5H6QA 4P9FA 3CDIA 3W2WA 1OKRA 4EJTA 2X1CA 1IF1A 1T08B 1S72I 1VQ6I 1BI3A 1YRNB 3BCAA 4HF2A 2M5WA 3EQLF 2K5CA 3ZN1A 1IN6A 4A12A 2FBKA 2CRGA 2YR2A 4KA4A 3CC4I 2DBBA 4ZC3A 3FXRA 1Y1VJ 3FXMA 4C30A 4AWXB 4KN7X 5J4VA 2V9VA 4AIDA 3P9IA 2VI6A 2F4MB 3O8GA 1HW2A 4OU0A 3WTVC 4L0ZB 1GXQA 4BE1A 1FOXA 4LOCA 5FD6A 1MBJA 2E1NA 2RC4A 2VE8A 1N75A 1AHDP 1TWAJ 3SZGA 1V4RA 2L4AA 3BR6A 5EYRA 3BG5A 1GHCA 3GTGJ 3W6KB 3GMEA 1JKQC 1E17A 3G1OA 5HDNA 1BIAA 2A5YB 1KQ9A 2NNYA 1FOYA 1R9TJ 3GTOJ 2CO5A 2H6BA 4R79A 2LBFB 1K78A 3N4MA 3W2VA 4MTDA 1D0ZA 2V26A 2ACJA 2FD5A 2CMPA 2Z1DA 2P81A 3GTQJ 2RREA 2Y30A 3DBLB 2MBFA 1ZH5A 4N0BA 1B59A 5E79C 2VE9A 2VODA 3U1DA 4XL9A 3FZVA 3E6CC 1W36C 4A3GJ 1NG7A 4D7MA 4IQJA 1IUFA 2QUFA 2XGDA 5E18F 3BOQA 3OS2A 5E8IA 2XV4S 2R5YB 5IP9J 1XCBA 3IWFA 1MBGA 4L18B 1T6SA 1ZGJA 3ZP5A 3J81Z 5DS9A 1XC5A 4XOPA 3IH4A 2VL8A 3E1SA 4HSTA 2JRMA 2KISA 1YYVA 3KP3A 4I98B 3O2PE 1YS6A 3VDXA 4G94A 5C44J 2P6SA 5E3LA 1MH3A 3CJQB 5ICGA 2XB0X 4HRIA 2A68F 2E35A 3CQZJ 4BEHA 3KZIC 1O7LA 5DCMA 3O6BB 4BXUA 2PMZA 3BC8A 4Y33A 2PX9A 3RZDJ 2EBIA 2E1OA 3H0GJ 2RAEA 4M71A 4DBRA 2DAOA 5F1JA 2CQXA 3QOPA 2ZXJA 1ZGWA 4KDPA 1F36A 4CUGA 2WAEA 4A0YA 3VSLA 1RKTA 1UG2A 1OR7A 4B1RA 3HUGB 2LKPA 3H3VK 2KJCA 3K4KA 1Y1WJ 3AG2H 5HLTA 2H94A 1XSVA 1H9GA 4B3XA 2JSCA 2HOEA 4XIDA 4BJ5C 3FMRA 4F3QA 2OA4A 1ZK8A 3S3NA 1JXSA 1WJ5A 1HSTA 2EA2A 3HRTA 2HVRA 2HXOA 3CF2A 5E8GA 1IN7A 5M3FJ 2JT1A 3GZ6A 3R6SA 2HFHA 3CLQA 2DA6A 3PUFA 2P7CB 2M4GA 1LJ9A 3LFKA 4D0PA 2XROA 2NRAC 3VB2A 3ZQFA 1TBXA 3ZMUA 4HF1A 3C2HA 5IYBJ 3AAFA 1JUPA 3KPHA 4IXAA 3A0BC 1YS7A 3C2BA 4J00A 4YIRX 1M1EB 5D5VB 1FZPB 3GTMJ 2GAUA 2JA6J 2PMHA 2P8TA 1ETKA 1V55H 4C3JJ 3HOXJ 2YSRA 2EH3A 3ABUA 4G8XA 3WE2A 5FLXK 1Y56A 2NNNA 5BMZA 1SAUA 4IX7A 5J1RA 3GLXA 3RYPA 3M3YJ 2L7MP 2JN6A 3T8TA 1RETA 2IGOA 2DA3A 2WTEA 4M6XA 3J81K 1X1AA 3LA2A 2VBYA 3E6DA 1J75A 2ZXHA 1HXDA 2ZSHB 1EV7A 2AXLA 3CD6I 1DP3A 3ZR8X 4RAZA 3NQOA 1Z6TA 2E7XA 4XRSG 4LIUA 5D5UB 3GFMA 5C3EJ 4XQFA 3U1KA 1BI0A 1MKMA 2VQCA 2JPBA 1V5GA 3I5UA 2D1VA 1PUFA 3OYHA 2Q0OA 3HKZN 1I27A 4LB5A 2FEZA 2DOEA 2JA7J 3I53A 4S0HB 1FIAA 4HBLA 5DM6F 3F6OA 2VJ4A 3I56I 3P7NA 1Z1DA 2K27A 3OIOA 5GAHJ 3OYCA 4FCYA 3NWSA 1X1PA 1S8NA 3K4JA 3F21A 4NC7A 2X6YA 1GVJA 2XASA 1Z6RA 2Z99A 1IAWA 4KIBA 3OYNA 4B8XA 2NYXA 2L01A 3CCLI 2AS5F 4CYCA 2GOXB 1ZR2A 4A0ZA 5FB2A 2QZ8A 1DPRA 4P9UA 2HKXA 4FE4A 3UKGA 1W7PA 5CVRA 2CFOA 2K02A 4FISA 2AXTC 3TKYA 9ANTA 2COMA 3DLLF 4BBRJ 2L4MA 2AO9A 2E36A 2K9QA 3V4GA 2WWYA 2KIQA 3L2QA 2WB1N 3ECOA 4CCKA 3HXLA 1HW5A 4FTHA 3R60A 1OISA 3KP7A 2FMYA 2KT0A 3HB9A 2B7EA 4GGGA 3IL2A 2TCTA 2E2JJ 4XSXF 3IHUA 1I5ZA 2A3SA 3W2AA 4A6EA 3HOYJ 4RS8A 3ERMA 3M7GA 2H27A 3RSNA 2HQ5A 4G12A 2CG4A 3HGYA 1LEAA 2EQRA 1ZGAA 5LHGA 5E3NA 5ED4A 2E5NA 3BR0A 5GADJ 4KFCA 2JSPA 2L2OA 3HSEA 4M9XA 5FO5A 2HTSA 2RDPA 5HDKA 3BR3A 3GF2A 1RZ4A 4OINF 4IQ4A 3QYBA 2M7AA 5DUKA 1WVRA 2DA1A 3J80K 4XN0A 1JHFA 1G2HA 2ZNZA 3S1MJ 3FXJA 4F93B 2GQQA 3O3KA 1N25A 3KIOA 4ZDPA 4CCJA 1A5JA 1X4OA 5LRRA 1E3PA 4ENKA 1W5CC 4AYBA 1IW7F 3KFWX 3E6BA 1LUJB 3DP7A 5F27A 1ETXA 2PJPA 4GO1A 2M8EA 2BHZA 5KK1A 2W24A 4HV5A 1L3LA 2DQLA 2W4SA 3TO9A 2IPQX 1B9MA 1O3TA 1G6NA 4E7JA 1YX5A 2BYVE 2DTZA 1E3HA 4E7HA 3CUQA 2ZXWH 4U0YA 3CDLA 4L5JA 1MMGA 3K4MA 1W0TA 3C18A 4L5IA 3OYBA 4MQ9F 4HEA2 1K83J 5BOXA 2DQRA 4XLNF 4XOTA 3TO7A 1BI1A 5K5QA 3GYHX 4Q47A 4HSRA 4MNUA 4KIFA 5L3CA 2IBDA 2MG4A 4XLAA 1DUXC 3S15J 1R5GA 2B0LA 3N97A 1XMKA 1T0FA 3WU2C 3OWTA 3S14J 1TQPA 5ILVA 4XRMA 4AVZA 1R5HA 2VJJA 2KRFA 5E20A 2EZHA 2HDCA 4BY1J 1HSJA 4HX4A 1K61A 1N77A 3H35A 4GYIA 1MIJA 3I4PA 2XRNA 3S3MA 3PNTA 3I54A 4YELA 1U9OA 1E2XA 3HHGA 2ZC2A 5BPIA 5KHDA 4XRFA 4UV8A 5J8CA 3MAJA 4HX7A 1D1CA 3D5RC 4YFKF 2K85A 4A3EJ 4QWQA 2P5VA 1VQ4I 2VONA 1ERDA 2ZMEA 4ON0A 4WCGA 3GZNB 4F52A 2ZFWA 4L9NA 5BNGA 4CCLA 2NVXJ 4M3EA 1J7KA 1IXRC 1RC9A 2Y48A 1W36D 1YJWI 1B72A 2NVUB 5LGTA 5TGTA 3GWZA 1LFUP 4CICA 5LEKA 1H8AC 3BPXA 1D0YA 5FFXA 1P4XA 2CH0A 1MD0A 4JX4A 1LNWA 5EEGA 2YU9J 2F4OB 2OUMA 2JJ7A 2R4GA 1QVTA 5HVQC 1DU6A 4AIHA 1RR8C 4HV6A 2FNAA 2HQNA 1F4KA 3MZHA 2QBYA 1FPQA 5FGMA 1Z77A 4XKCA 2ZCWA 2ECBA 3ZMDA 1LVKA 1SVMA 2RQPA 3DTIA 2WAQN 2V1DA 5IOZA 3TOAA 3HJEA 2Z33A 3TBIA 2ZJPF 4PGHA 5TJJA 2D5VA 2DK5A 4V19K 2VN2A 2XVCA 1J5YA 4YIFA 2MSYA 2QM3A 3HRUA 5FFZA 2F5EA 2FOKA 3S32A 1NTCA 1UMQA 2IVMA 1X4PA 3RQIA 3M1CA 4ABZA 2E7WA 3DCFA 1V54H 4I99C 1TWFJ 3OL3A 3WE3A 1A36A 3IC7A 1T39A 1PP8F 1AKHA 4C3HJ 3R0JA 2E71A 2BW3B 2IEKA 2XPUA 3CJNA 2BGCA 4OAYA 3SXYA 2DPUA 2DJIA 1XGMA 1JE8A 5F6FA 2DW4A 3LSGA 2A69F 2JUGA 2Y2ZA 3ECHA 3G2BA 1BJZA 5E3OA 1T0FC 2Y9YA 4YG2F 4Y13A 3JR9A 2GZWA 1ZHFA 1HLVA 2LFBA 3RKWA 4YEJA 2VQHA 5LGUA 4LK1F 3I64A 2OD5A 4Y17A 1WKMA 1UCRA 2IA2A 3BG9A 5D6FA 2EFWA 1VFCA 2R3SA 2VXZA 2LY9A 1MGTA 2JUCA 3WTXC 1EH8A 2H8WA 4S04A 2Y0SN 3H5RA 4M6YA 1BW5A 3A2KA 1VQ9I 2GBYA 2P5KA 4P55A 3OYEA 1HKQA 1G3SA 2HKOA 1P9QC 2XHKA 5FJ8J 1ZYRF 4A3JJ 3PO3J 2FQ3A 1DQUA 3CDHA 3I9V2 4RLFA 4E7SA 1LE8A 1IGNA 2BOLA 2R7UA 2EV0A 1MBKA 1IO2A 2CQ7A 1HDPA 3FK7A 4AD9A 3G6EI 3MFKA 1UHWA 4ZYAA 2CW7A 1SVLA 4LG0A 1WJEA 1U9NA 4C2UA 3OYJA 2W48A 3I55I 1KGSA 2R7TA 1WJFA 2QGUA 1Z21A 1S7OA 1Z05A 1V5FA 2EIMH 1MDMA 3D5SC 4LB6B 4CHUA 1YQAA 1OCTC 4A3KJ 1FSEA 4IRIA 5LHIA 5A2QZ 2I8DA 2VQLA 2PN6A 4XLPF 3A01B 1FLIA 5GTIC 3A03A 3FF5A 3MZYA 4F55A 2LKSA 3GVAA 2ZBKA 4LG3A 3DKWA 3GLLA 3WODF 1JUSA 1BR4A 1IDZA 3T8RA 3T5XA 1JI8A 1XSXA 2OQRA 4L5EA 3CCRI 3BR1A 3JRIA 3G73A 1LEBA 4KNYA 5LLQA 3I58A 5EDNA 2E1MC 4HDVA 2VKVA 1YI2I 2N8GA 3TO6A 4XKWA 3L2WA 1I3QJ 4DBQA 3BROA 3OL4A 1HW1A 5FRMA 2FBHA 4W1UA 3ZGKA 2YX7A 2XRLA 1FYKA 1P2FA 3F8NA 1WQ2A 1MMSA 1YJ9I 3H9QA 1HCRA 2CQQA 5ICFA 3OY9A 5IY5H 3CO7C 2QSGX 4M3GA 3LSRA 1I3AA 1BA5A 2PMZN 1BR2A 4U0VA 2I5UA 3K7AJ 4OMZA 4B3AA 4PJJA 3IKVA 1QZZA 2F5CA 4BQQA 4KMFA 1Z3XA 2BZTA 3VFZA 3OYIA 3BG6A 1S7EA 4BAYA 4G6TB 4UUSA 5C4XJ 1USTA 2LSOA 2DMQA 4FHTA 1D1BA 1UG0A 4IOCF 5B3SH 4CSWA 3OYFA 3QYEA 5F0FA 2DMPA 2STTA 4RAGA 4DZJA 4UVBA 3IRQA 4UY8I 4BGDA 1KU9A 5EEHA 1H9TA 4MEXF 3G3ZA 1T2KA 3K6GA 4QPOA 5H20A 3CUOA 4E7KA 4DIQA 4B09A 1K78B 1WCMJ 3ZQLA 1BI2A 5J1UA 3V7CA 2E34A 2ICWG 3OMYA 2X6XA 3IKTA 4XM3A 3ROUA 3FK6A 3FHNA 1YIOA 4NQWA 5IPAA 5A2QK 3OS1A 2DXIA 3CCJI 2J5PA 4FASD 3Q9SA 4BH9A 1BOAA 4XKBA 2VOPA 4IEJA 3W3CA 2Y0SA 2HOSA 1NK2P 1RRJA 1DU0A 1UJ8A 4ZTFA 4D7NA 3IH3A 2VJ5A 3PL8A 2HPMA 1MBFA 2ESNA 2WA0A 4LIVA 3H3UA 3R4KA 2Y75A 2ECCA 3LSKA 4BKXA 2XGCA 2L7ZA 2V1UA 4UUVA 2E2IJ 3L09A 2A5WA 3TMOA 1PYVA 4A0XA 4YFNF 1KU3A 2E5ZA 4I09A 3WHCA 1J9IA 2X6WA 3GXOA 1VQKI 1VZ0A 4BEHB 4DYCA 2F5DA 5DCMB 3ZQHA 2VASA 1BN5A 2XF7A 3T0YA 3QWLA 2KP6A 1QO0D 4EJUA 1GV5A 4XNFA 2R7OA 2XAHA 4OOIA 3R61A 3CP8A 2QVOA 1WJDA 2A6TA 1TT5B 2CJJA 2FMLA 2OBPA 1W7PD 3SZTA 4X1EA 1GT0C 2DT7B 3JRAA 4G7HF 3KP2A 1D8KA 1KQ0A 3WTUC 2V1XA 3MKLA 4IHXA 3PJRA 2CWEA 4U7DA 1HA8A 2K4JA 1P7IA 3F6VA 5IYDJ 2HYGD 4J01A 3K1MA 4E7ZA 2MLGA 3FM5A 2DU9A 2HWVA 4HQMA 1MZBA 2FNPA 2XF6A 2R5ZA 4A3CJ 4II3A 5FLXZ 4O6JA 3AL0C 3KE2A 4ENMA 4UHTA 2HQRA 1R4NB 2R92J 2BXZA 3VPRA 2QSHX 4M3BA 2PJRA 2HZTA 3LQQA 5D8KB 4P1WA 2NOJB 4RBOA 2M45A 1EH6A 3H1CA 1H88C 4GDFA 4AU7A 1XGSA 5L3GA 2DT6A 5GAEJ 2QQ8A 1IRGA 2QYOA 3PFIA 5B5EC 4UB8C 3HEFA 2UZKA 3H5AA 2VBWA 3OIQA 2IXSA 2L0KA 2IAIA 4PFPA 1NH3A 1Q1HA 3EYIA 1KYWA 1OCCH 2R0QC 4RAFA 2HDDA 2DCEA 2HYFA 3ELKA 1JGSA 3NRVA 3HC7A 4RA2A 1W4MA 4PJ0C 4I76A 4U87A 3FHZA 1RKWA 3GTLJ 2EZIA 3WU1B 2BHYA 2A6EF 5CQEA 1QZEA 3TW7A 4EVIA 1D5YA 2FOWA 2JTVA 1E3OC 5IT3A 3JW4A 4XLHA 3IH2A 4IPAA 2O61A 3TP3A 1PUFB 3FMSA 1BR1A 2GXGA 4CO8A 3BP8A 3HHHA 3LWFA 3E7LA 3VEPA 3MVPA 1R7JA 1KZHA 5FLMJ 3SEZA 6PAXA 4IHVA 4N9HA 4IL6C 2Z16A 4AYBN 2X4HA 1T8IA 1ZARA 3EUKL 3K4NA 4XMYA 1IXSB 2LKXA 1BW6A 1ZKGA 4OIQF 5L3EA 1ZG3A 2VT3A 2IS2A 3E0JB 3W6VA 1HF0A 4P96A 2CV0A 3Q0VA 1CF7A 4BE0A 2ID6A 3PM1A 3OR2C 4BDYA 3M9AA 4M72A 2LR8A 4CYCB 1JJ6C 1YW7A 1ZR4A 3ML6A 3FBNB 1FP1D 2DMTA 2MH2A 1IN5A 1JTYA 1GVDA 4RMNA 4BJ6C 1W7PB 3CCMI 4XN3A 3WGIA 4UVAA 2PMUA 4DGWB 3QP5A 3CMMA 4MFDA 3ZMVA 2E60A 4LLGF 1NHAA 1QBJA 1ETYA 2MC4A 2MFZA 3ZMSA 1I1SA 3L2RA 4FX0A 2B9SA 5E1ZB 3EPZA 1G3TA 3J80Z 3PSFA 1J0RA 3KYDB 2HVQA 4ETSA 1MJBA 3WG9A 2K9SA 3MKWB 3K10A 2LF8A 3C7JA 2EV5A 1G8XA 2LY1A 4B43A 1VF9A 2JPCA 1SD7A 1X2MA 5FKNA 4KISA 1X1DA 2M2EA 1A6QA 1LQ1A 1B4AA 3GEZA 3JCUC 3CCYA 3ABLH 4V2GA 4ENJA 4GFBA 5FKMA 1VQOI 1TT0A 2L5QA 1GLNA 3ZN0A 3SYTA 1MJ9A 4OIRF 1ZTRA 2L9VA 3Q0WA 3HOVJ 1WGXA 3C1DA 1TNTA 3OYAA 3PIPF 3MZ8A 3HDDA 1ZG5A 3H9GA 1ZRCA 3OOUA 1KYZA 4HQEA 1J09A 3VODA 1FOKA 3F8BA 4DJAA 3X2QH 4CH7A 2DOFA 5D6EA 2V1NA 1MJAA 5FD5A 4X0GA 3CO6C 3WHBA 1LFPA 1W1WE 2NOGA 2DI3A 3T1BA 4ZDOA 2EIKH 4FETA 5JI6A 3MCZA 2IGKA 5DD4A 4U88A 1VQNI 2PFBA 3ASOH 4HNVA 4CA0A 4QTRA 2XPWA 5B1BH 5KCMA 4HG2A 1IJWC 1ZRFA 2OTLI 3CUQB 3KYLA 2FXAA 1W0UA 4OIPF 4EV0A 3K1NA 2HEOA 3RQ4A 3K70C 2V9KA 2EA4A 1O3SA 5ERIA 1J59A 2ADUA 3EETA 1EJ9A 2XF5A 2X1EA 1S5LC 2LTPA 3HTUA 2CGPA 3VYUB 3ZRGA 4D9JA 1W5TA 3BLYA 4UNOA 1G3YA 4HNTA 3RIRA 1GV2A 5CVVA 1PP7U 4QIWN 2DO7A 3LSMA 1B8IA 3U2RA 4CCMA 3OYDA 3L2CA 3ERED 1I1GA 1YG2A 4XK4A 1QHHD 2BVLA 1BM9A 2KRHA 1U3EM 1XN7A 3HYIA 2TDXA 5FKOA 3BTCA 2OU2A 1YITI 4BNCA 4Y3OA 4LITA 4U0WA 4EMSA 2ELHA 1JKRC 3HGGA 1BBYA 3BCBA 2G9WA 3RZOJ 3DEWA 4LFUA 1ETOA 2HXIA 4U7BA 1HQCA 2HOAA 4XRSA 4A3MJ 2CUFA 1IZ1A 1T56A 2KKOA 2ZMEB 4ZJZA 3HOSA 3MKYB 1Z0XA 2L9NA 3WTZA 1FEXA 1IN4A 2JMWA 3KLNA 1B72B 2KDOA 1YJNI 2FUG2 1QPMA 2DN0A 1IN8A 1OCRH 2QQAA 1R22A 4B48A 1TLHB 3DU5A 5EGOA 3BTLA 2XPVA 4RGRA 5TISC 2YPRA 4I2OA 3E3VA 3F8MA 3JTGA 4MGRA 1OCOH 3GX4X 4BQOA 5AIQA 1XGOA 5LBQA 2RQQA 1DP7P 1SEUA 2BY2A 1U8BA 2X1DA 1JTXA 2QBYB 4Q5SF 3L00A 4KT5C 4KT6A 1R71A 2HI3A 3K2ZA 4UV9A 3FKIJ 1JUMA 5K1YA 3GBGA 1JJ8C 4IHSA 2FX0A 3CCUI 1IV8A 2QCOA 2EILH 3SDGA 4M3DA 5EG0A 2KPMA 4L9TA 2VXDA 5IOYA 4RDUA 2HDWA 1I6HJ 1FBUA 4A2UA 1SAXA 2Z5UA 4MEYF 2DA7A 1XMAA 2KZVA 3A0HC 4NBQA 1FIPA 4IHWA 2KL4A 3GTPJ 4HDUA 4XBFA 3M8FA 4ESJA 3S8PA 4KITB 3HOTA 2P4WA 2KLOA 3M8JA 2XC7A 5KVRA 2E1MB 2F2EA 3HPGA 4FX4A 2QKMB 2Q2EA 3AKZA 2LH9A 1AKHB 3B6AA 2GA2A 3PSIA 3A02A 4NUBA 3FIWA 2LRDA 4L9JA 1F5TA 4HYEA 1XPXA 4BHBA 1ZELA 3MWMA 2DYSH 5FKKA 1ENHA 3F8FA 1Z7UA 3SDBA 5HLHA 2W00A 2V79A 2X51A 5CKTA 3NWTA 5K7FA 4A3DJ 3CMEI 4B47A 2PEXA 4A3FJ 1UZCA 3QYFA 2VIXA 2R7WA 3QQAA 1YOVB 2DOAA 2K9MA 1XD7A 1FYLA 1ETWA 4OMYA 1QQIA 3H0DA 5JLXA 5CVUA 4WWCA 1ON1A 2CU7A 2FQ4A 5EZHA 4BY7J 3I0TA 1ORKA 4ANJA 3GZ5A 4PK4A 3ZQQA 2XB5A 4IO9F 1OFCX 5J4YA 5D5XB 2G0EA 4M73A 3I3LA 2QKLB 3DXJF 3I59A 3MKZA 2R7RA 1YIJI 2M4KA 1LE8B 1ITYA 1FP2A 3KLOA 4D5CA 5K5RA 2X6OA 1RI7A 4EJOA 4IRHA 1SANA 3WTYC 4LGWA 4Y15A 2F4IA 4BHPA 4LG0B 5DV5A 1F43A 2E19A 2ZFUA 1FBSA 5H2FC 5C4JJ 1Q1VA 3K4CA 4PUSA 2D1HA 4Z2YA 3M1EA 3HOZJ 1MDMB 3U21A 4JK1X 2KIUA 4AIJA 2ZNYA 1VTNC 1WJBA 1X3WB 1U6GA 3P9KA 3OYLA 5JVGF 4LK0F 1P92A 1SFOJ 1HDDC 2AQFA 2MYSA 3QU6A 1R6RA 4XONA 2LK2A 2XKPA 4Y52J 4F92B 2EFPA 3LQRA 3ZQ7A 2DFIA 3ONQA 3ABKH 3MQ0A 2O8KA 3HPHA 1C0WA 2A05A 1P7JA 2L54A 2VPLA 1S29A 3L2UA 3JRBA 1Y0UA 4C2MJ 4I6ZA 3QAHA 2GM4A 1XX5A 1SD6A 2ESHA 5CLSA 3H36A 3E6MA 3WGHA 1O3RA 4BL0B 2MGQA 1FMVA 3IRRA 2QF7A 3GCMA 3DTEA 3S93A 3IWZA 1Z67A 4KIGA 1EH7A 4BXFA 1SFUA 3IAM2 2XAUA 4JP0A 3Q0UA 3RPUD 4UXNA 3QPLA 2NXNB 2W1OA 3KYCB 3J7AO 1IXCA 4RM2A 5BQTA 1SMTA 1XB4A 1MW7A 2EFNA 3ZQIA 2V7FA 2IRFG 4A6DA 2L7FP 2HTJA 3DPTA 4UB6C 5JHFA 1TWHJ 3OIPA 4XLEA 2BEOA 2XAJA 1MSFC 3LA7A 3D1NI 3VYRB 4GXOA 4G7OF 4XSZF 5FLVA 2PQ8A 4D5FA 4MTEA 2M87A 1XS9A 3OYKA 4UUSB 1X2NA 2BY3A 3HL2A 1RPWA 2NAZA 1FWZA 2MA3A 2VQGA 3BR5A 1K6YA 4HOBA 5EZGA 1Y39A 1S3JA 3JAMZ 1ULYA 1XTAA 2CFXA 3FBIB 4MO7A 3S3OA 2W7NA 1O3QA 1OCZH 2LREA 3LOCA 3EUHC 3WG7H 3ESWB 2M9HA 1TZLA 4HZFA 2XSDC 2JRTA 3BR2A 4CXFA 3CCSI 2XAFA 3TW6A 2QQBA 3JREA 1H89C 3C2GA 2H6CA 5IP6A 1SMYF 5F0HA 2CUZA 2V9PA 2BE5F 4BBSJ 2O3FA 1FMWA 4ITVA 3F72A 2QEXI 1K7AA 3KZZA 5HNHA 4MLOA 2NS8A 2LD5A 4NQWB 2ZO4A 2KJBA 3CCEI 2R93J 2R7FA 1TWGJ 3Q5FA 4HW0A 3ZQCA 1IUYA 1TL8A 2ZSIB 2CW0F 1IC8A 4IF4A 3GTKJ 3OSGA 2O7OA 3L9FA 1LFBA 3CLOA 4EQQA 4M9ZA 3CC2I 1I39A 2LOOA 2QLZA 3RKXA 1G59A 2JA2A 4NNJA 3TDZC 1SC7A 3L7WA 1ETVA 1FX7A 3K70D 2R7DA 1T33A 4ZDLA 1LPQA 5D4RA 2MC3A 2CQNA 2VPRA 4RB3C 4XKVA 1R36A 2E2HJ 2VB6A 3DFGA 1U78A 3SFZA 2WY7Q 4II2A 4BE2A 2OCCH 3H92A 2X48A 3BZ6A 3UR3C 3CZ6A 1U5TA 1USSA 3LMMA 2EIJH 3QU3A 5IYCJ 5FROA 1Y8RB 3NEUA 3FXQA 2RV8A 2Y69H 4R8HA 2IGMA 1DGWY 3ZQGA 5DCFA 2CYYA 3J7AY 2KQRA 2F5FA 2VOOA 2KZGA 2LC2A 5B66C 2DLLA 2KHMA 1IRXA 2W57A 3GO5A 5GAGJ 2VLAA 1A04A 2HR3A 2CV1A 4A5NA 2IT0A 1DPUA 4CZZA 5F04A 5TRDA 2RKHA 1X3UA 1YW9A 5LEJA 3BY6A 2EINH 2X9DA 1AU7A 1ZLJA 3M8EA 3F8CA 3CMAI 4N9IA 1QGPA 3SEQA 1Z7LA 3JAMK 3KP5A 4WXDA 3V8JA 3H3ZA 3K0LA 4P5OA 4WXCA 1VQ5I 4AM3A 2R5ZB 2NVQJ 4ZZDA 3HRMA 1U0JA 4PSWA 2R7XA 1A6IA 1XCVA 2P0WA 3DWLE 2IW5A 4PSXA 4A93J 1SVOA 3ZXSA 1MSEC 2EZKA 3BTIA 2HU9A 2PJRB 1YO5C 4HX8A 3RI4A 4B4CA 5LHHA 4NB5A 5F64A 3KETA 3ISPA 3SHFA 4BXXJ 5J8FA 1SFXA 5HS8A 3HM5A 1SFEA 3S17J 2B63J 2QQ9A 3DLAA 4ZTJA 4JQFA 2XKOA 5CPRB 1G4DA 2RN7A 4EJWA 4EJVA 1JGGA 4KN4X 2ISYA 5DM7F 5DDGA 2L9SA 1FNNA 1YX3A 2L7KA 5CJ9A 4M74A 1VNDA 2VKEA 3FDYA 1HC8A 5JFRA 3B73A 5IT9Z 1EF4A 2VKDA 5CYVA 3V8LA 4BJTA 5K5OA 2D2WA 4BQAA 1U2WA 2H1LA 2OV7A 1B1BA 5AONA 2DTRA 2M0MA 4A5MA 5EF6A 2UXNA 1WJCA 3E5UA 3GFJA 4ENNA 1UELB 1Y6IA 3BTJA 3OOPA 3RPUA 4RGSA 4C2TA 1QRYA 1CGPA 1S7AA 3FX3A 4EGZA 1GDTA 1AA7A 1G3WA 2MD0A 4WX9A 2ZJQF 1RIOH 1JHHA 3CCQI 1FOWA 1HKTA 2LF7A 4L0YB 4QSHA 2DFHA 1WPKA 3BQYA 4YFXF 1FTTA 2Q8KA 2XSJC 4ZH4F 4UVCA 1MH4A 2GIZA 2GOMA 2VJIA 3KCCA 4I02A 4RM3A 1W5SA 4N4NB 4RB1A 1SD4A 4JX6A 4OWRB 3LAJA 4DYRA 3DQVC 4YRVA 3DF8A 2Y0MA 1QVUA 1P6RA 1U5TC 4OIOF 2KRCA 4H4KC 5HLGA 1WH7A 1XDSA 2FSWA 4HA8A 2F48A 5J47A 1UFMA 2CS3A 1CF7B 1MNEA 4AUXA 1CQTA 2R7QA 3F23A 2L3DA 3VYSB 2JZYA 4HLXA 1BC7C 2OAZA 3TDUC 2OC6A 5KNLA 3K69A 1YRNA 3GFLA 1REPC 3JRFA 3IUOA 3CMYA 1TTYA 2GXBA 5D5WB 3HG9A 2W84A 5AIPA 1Z9CA 2EFQA 2LDUA 3FXUA 3RKQA 2UWMA 2HVSA 1R1UA 4V2FA 3SQNA 1IG7A 1UB9A 3QPHA 3TL4X 4A69C 2A07F 4A3LJ 1F1ZA 2WV1A 4BUPA 4IHYA 3FXLA 3LA3A 3HIFA 3J7YJ 3HTSB 4G6QA 2COBA 1K6OA 2M8GX 1VQLI 2DT5A 2OPTA 5IP7J 2HS5A 1TWCJ 4C9YA 3K2AA 2OTJI 1X1BA 2MD5A 3IV5A 2WV0A 1Z3YA 1L0OC 2VC1A 4Z6YA 1ZREA 5IT9K 2VC0A 4Q48A 3ZCOA 2LBFA 1RUNA 4A3BJ 3OV8A 3KEYA 1YFHA 1KU2A 2BXYA 1LDKB 3ABTA 3W6JB 3L1PA 2DPDA 1XG1A 4PJLA 2ZKZA 5CQGA 5J6XA 3DPLC 3AG1H 3S2HJ 1VI0A 1K4TA 1E0EA 3QOEA 2YX4A 4XR6A 5E1XA 5M5YJ 3TEDA 2ZJ2A 2VT2A 1X19A 3DPUA 2GIVA 2R5YA 2KIFA 3MD2A 2WADA 4PFOA 3DU6A 4DQ2A 1WWXA 1JT6A 1V3FA 5KAFC 2M0CA 1TQMA 3K4LA 1QZYA 4NC8A 3RDIA 1IDYA 1QHGA 2DA5A 2K7LA 1Y8QB 5KAIC 5L3DA 3KX2A 2XAQA 4EATA 4ZYHA 1OPCA 5LGNA 3BG7A 2J5OA 2RGVA 1WI3A 2XGEA 3ULQB 4KYWA 2EV6A 4OAZA 2FBIA 4XORA 2STWA 1NK3P 3GUDA 3PIOF 4K2EA 2EK5A 2FA5A 2CSOA 5LFAA 3EDPA 4G9YA 4M3FA 3S1QJ 3GTJJ 5FKLA 1OYYA 2PBIA 1TC3C 3F0CA 4HAMA 1UAAA 2OQGA 2R7SA 1B8IB 2FF4A 3HUGA 2Z2SB 3JSOA 2MW8A 3BZKA 4EM0B 1Z91A 2EFOA 1SFKA 4IRGA 4F7ZA 1XMXA 1BIBA 2K4BA 3Q9VA 3FM3A 4XLCA 1R1TA 4L9VA 1IV6A 5H6RA 5ILUA 5L3FA 2UUZA 2DA2A 4S05A 5HS9A 2ZXIA 1FSHA 3CC7I 4IJAA 2JQ7A 4QPQA 3TGNA 4YIIA 1D0XA 3OR1C 3REOA 1WI9A 3DBHB 4RB0A 3DEUA 3RPQA 5F1RA 1BC8C 2QENA 3KEQA 1U8RA 1BL0A 1GUUA 4GYGA 1PVEA 2Y9ZA 2Q1ZB 2XAGA 3KEOA 4JOMA 4EEFG 1PUEE 1A31A 2K86A 1K4SA 3I4MJ 1D8JA 3BT9A 4PGGA 2BY0A 2XIGA 4WF2A 2LNBA 3V42A 1T95A 4JBAA 5CVIA 5EEAA 1ZAOA 2G7HA 1K79A 5J3LA 4H0EA 3HSRA 2GLOA 3M4OJ 3BDDA 1OR7C 1HBXG 2YUSA 3CCVI 1JKOC 5EGOB 2LP0A 1LDDA 2L9RA 2OZ6A 1OYWA 5F0CA 2O5RA 3UNGC 4I7HA 2P5LC 3BJAA 2MLKA 3RKYA 4BHCA 4AVPA 2IS4A 1KQ8A 4G7ZF 1PJRA 4KICA 3D0SA 1P4AA 3BPVA 1YLFA 2CUJA 3G1LA 1N78A 2G7UA 2OCEA 3QP6A 1ODDA 2D45A 2M3AA 3K4BA 3CTAA 2MABA 2VBXA 2P6TA 4D1QA 1RUOA 1X1CA 1BOBA 5EG0B 4DYQA 3IAS2 1TNSA 1MNDA 1XGNA 4FE7A 4RLQA 4ZYEA 5GTHC 3JRCA 5GP9A 2ELKA 5D4SA 4GCVA 4AC0A 2DMUA 2HYJA 3O8HA 3E5XA 3DBRB 1WRJA 3U9GA 5HODA 3PUBA 2WY8Q 2DYRH 2K9NA 2R7VA 2M30A 2W82A 4E7LA 1DGRM 2NVTJ 4ZYGA 4BQNA 2P7VB 1P4WA 2O6GE 2Q2EB 3LFUA 1MBEA 1EKEA 5JHUA 3PO2J 4X6AJ 2Z3YA 2LLKA 1OCPA 5ICCA 3MEXA 1FC3A 4O3MA 3DTKA 3N05A 4LLLA 1OQYA 2KIMA 5HNFA 3QRFF 2R7ZJ 3JTHA 1OJLA 1S9HA 3OYGA 2EZLA 1LKXA 3DEEA 2FRHA 3TOBA 3VWBA 2NVYJ 4ZYDA 4G6DA 1VQ8I 1WH5A 4N4OB 4AIKA 2LMDA 5J1YA 2KDZA 3G71I 5LRSA 3HOWJ 4DW6A 4IVNA 3VOEA 4E6KG 3VYTB 4CCNA 4EM2A 2PLYA 2V6EA 3BZCA 2XUBA 4KJZA 4CGZA 4PJMA 1IRZA 2DDAA 4NDLA 4BYYA 4F91B 1XSDA 3F9KA 4FQGA 2V4JC 4LLNA 3I59B 4M9SA 3K9TA 5HOOA 3ZOBA 3SZPA 1TP4A 4R1HA 1DDNA 2A6HF 5HDGA 2QA4I 4NHJA 5GPAA 1UHMA 4QLCU 3P5JA 1T38A 3BJ6A 3I4NJ 1AOYA 3LSHA 1MMAA 2X85A 3CESA 3LSTA 1B9NA 3E97A 1R00A 2H1KA 1Y0NA 3PNVA 2OJED 1WHUA 3NAUA 2ISZA 2BBYA 4UUTA 5J40A 3HKZA 3WU0A 3ZMTA 4NC6A 4XLFA 2EPFA 3TP0A 2H09A 2GWRA 2BV6A 1MMDA 2PI0A 3OYMA 2DDBA 5K7ZA 5BPDA 3RYRA 2OF7A 2LYCA 3KZYA 1QPIA 1WFXA 4RB2C 1UHSA 1O57A 4HF0A 3V7RA 5E3MA 2DA4A 2M1BA 2UV1A 3CJRB 2XGXA 4FT8A 2DMNA 2AHQA 1D3YA 3JRGA 5F08A 2EWNA 4MFEA 2V6CA 2QSFX 1EA3A 2E1CA 2KFDA 4ASNA 2WC2A 2JVGA 5DD8A 1ON2A 1R5ID 4XICA 4EGYA 4BDZA 4E70A 3BG3A 3D5LA 3EUHA 4PZJA 3M07A 2CV2A 4I01A 1BJAA 2O0YA 3S16J 2HOTA 1X3ZB 4ZZLA 4LJZF 3V8KA 2GA1A 3F22A 2GXAA 2EB7A 2WB1A 3BJOA 3FWEA 1D1AA 3Q3SA 2IJLA 1TW3A 4MIMA 2XDVA 2WAFA 3CP2A 1APLC 1QA6A 1RNLA 4BACA 2FJ1A 3EUAA 3MMYB 1WSUA 4IOAF 3S2WA 4A3IJ 2O03A 2DODA 4MQVA 2HZDA 2DFEA 1FJLA 3AG3H 3LSIA 3B02A 1MMNA 2WBMA 3TQNA 3BWGA 3CUQC 3AFHA 2NS7A 1KA8A 1ZN2A 1JT0A 5L3BA 5M3MJ 4TV7A 3HZJA 4IHTA 4CZCA 3EYYA 2W85A 1AWCA 3AG4H 1MBHA 3OS0A
chains in the Genus database with same CATH topology
2Z16A 4ZDPA 4CCJA 1X4OA 3SEQA 1Z7LA 3EUKL 3K4NA 4XMYA 4E4HA 4AYBA 4P5OA 2IS2A 1U0JA 3E0JB 4PSWA 2R7XA 2P0WA 2CV0A 3DWLE 4IKFA 1V5EA 4BE0A 4PSXA 3OR2C 4BDYA 2PJRB 3ZXSA 2W4SA 2HU9A 3L2VA 3FBNB 4E7JA 1YX5A 4B44A 4E7HA 5FRNA 4RMNA 4BJ6C 1MMGA 3K4MA 4XN3A 3OYBA 3DLAA 4ZTJA 4HEA2 4JQFA 2JVHA 4DGWB 5CPRB 3CMMA 4XOTA 4HSRA 2E60A 2L9SA 2MC4A 2MFZA 1YX3A 1OLTA 4XLAA 2L7KA 3LL7A 3L2RA 3FDYA 3EPZA 3PSFA 2HVQA 3AL0B 2VKDA 4BJTA 3MKWB 3OWTA 3K10A 1QU3A 3PFYA 3DKXA 2OV7A 4CCOA 2LY1A 1G8XA 4AVZA 2VJJA 3A1YA 4B43A 2M0MA 1WJCA 1N77A 1UELB 1Y6IA 3H35A 4C2TA 4KISA 1X1DA 3S3MA 3PNTA 1AA7A 2MD0A 3A4CA 4YELA 1TT0A 2LY2A 2L5QA 1GLNA 2BW3A 5KHDA 2BVMA 2K3PA 3SYTA 2XSJC 3FKJA 1D1CA 3D5RC 2VJIA 4RM3A 2GOMA 3OYAA 4N4NB 1YE9A 4OWRB 3H9GA 3DQVC 4YRVA 2IS1A 3OOUA 1J09A 3DKYA 1ERDA 4DJAA 1WJAA 1NG6A 2KRCA 4H4KC 4BU2A 4CH7A 2AQEA 2V1NA 4HPQA 2F5VA 4F52A 4CCLA 2F6CA 2HNHA 2CW8A 1W36D 2CS3A 4X0GA 1MNEA 1LFPA 2R7QA 5TGTA 3VYSB 4ZDOA 4FETA 2HQAA 2IGKA 1D0YA 2OC6A 2CH0A 5KNLA 4CA0A 5KCMA 5LD2C 4HG2A 2OUMA 3IUOA 3KYLA 2M7BA 2R4GA 5HVQC 3HG9A 4BS9A 3H5NA 3QODA 3RQ4A 3RCOA 3K70C 2V9KA 2UWMA 2HVSA 4IZZA 4XKCA 3TL4X 1LVKA 2HPIA 2K9LA 2X1EA 2XF5A 2VKHA 3DTIA 4BUPA 3VYUB 3ZRGA 4D9JA 3TBIA 3BLYA 3H9JA 4HNTA 2WAQA 4DOZA 2IGNA 3LSMA 4C9YA 4GRIA 2LG4A 3S32A 1X1BA 4CCMA 3OYDA 1X4PA 3M1CA 1Z3YA 4PJNA 1QHHD 2BVLA 3OL3A 2KRHA 2ELJA 3ZCOA 2IS6A 2LBFA 4Y3OA 4LITA 4E7IA 1KONA 2BW3B 3KEYA 4OAYA 2DJIA 1LDKB 3LSGA 2RNGA 3BCBA 2JUGA 2KMUA 3G2BA 4U7BA 4PJLA 1T0FC 3RTRA 4HNUA 5CQGA 3PNYA 3DPLC 4ZJZA 3QOEA 1E0EA 4XR6A 4Y4RA 4YEJA 2VQHA 3HOSA 3MKYB 2L9NA 1X19A 2VXZA 3DPUA 3MD2A 2KDOA 2WADA 2FUG2 3IP4B 4PFOA 3VSKA 3DU6A 4B48A 3W2WA 3H5RA 3DU5A 3A2KA 2X1CA 3K4LA 3BCAA 3OYEA 4NC8A 1QHGA 2K5CA 4BQOA 2RQQA 1P9QC 2X1DA 1DQUA 3I9V2 3KX2A 4RLFA 4ZC3A 4EATA 4E7SA 2BOLA 2R7UA 4KT6A 3BG7A 4C30A 3GBGA 4OAZA 4XORA 4ZYAA 2CW7A 4BE1A 2KPMA 5LFAA 1WJEA 1N75A 2VXDA 4C2UA 3OYJA 2HDWA 3SZGA 1UAAA 2R7SA 2R7TA 1WJFA 1Z21A 2KZVA 1V5FA 2Z2SB 2KL4A 3D5SC 1SFKA 3S8PA 4KITB 3HOTA 2KLOA 3M8JA 2XC7A 2E1MB 4XLCA 3HPGA 2UUZA 4R79A 2I8DA 2VQLA 2LBFB 2QKMB 2ZXIA 3AKZA 2LH9A 4F55A 3PSIA 3W2VA 4NUBA 1D0ZA 2V26A 2LRDA 4QPQA 2CMPA 4LG3A 1D0XA 3OR1C 2Z1DA 1BR4A 2RREA 1ZELA 1JI8A 2Q1ZB 4JOMA 3SDBA 2W00A 2X51A 5CKTA 3NWTA 4XL9A 1W36C 4B47A 1NG7A 3V42A 4IQJA 3QYFA 1T95A 2VIXA 2R7WA 3OS2A 2E1MC 2DOAA 2K9MA 3L2WA 4XKWA 4DBQA 1OR7C 3OL4A 3H0DA 5FRMA 3ZGKA 4XOPA 4ANJA 2VL8A 3E1SA 4HSTA 4PK4A 3ZQQA 2O5RA 3UNGC 3H9QA 3VDXA 3OY9A 3I3LA 2QKLB 2IS4A 1PJRA 3MKZA 2R7RA 2M4KA 3CJQB 4HRIA 4BEHA 1BR2A 2CUJA 4PJJA 1N78A 2PMZA 4BQQA 1Z3XA 2M3AA 3BC8A 2F4IA 3K4BA 2MABA 4Y33A 3OYIA 4DBRA 4D1QA 1X1CA 1BOBA 3BG6A 3IAS2 4G6TB 2ZFUA 1MNDA 4RLQA 3K4CA 4PUSA 4CUGA 2WAEA 3VSLA 1D1BA 1UG0A 3OYFA 4CSWA 3QYEA 3HUGB 3U21A 3PUBA 2WY8Q 3K4KA 5HLTA 2R7VA 2W82A 4BGDA 4E7LA 1DGRM 1WJBA 4BQNA 4B3XA 3OYLA 3K6GA 4QPOA 4E7KA 4BJ5C 4DIQA 2Q2EB 3LFUA 2AQFA 2MYSA 4F3QA 1R6RA 4XONA 4F92B 3S3NA 1WJ5A 3OMYA 3ONQA 3DTKA 3N05A 3HPHA 2HVRA 2X6XA 3CF2A 4XM3A 2VPLA 3L2UA 5HNFA 3FHNA 1S9HA 3OS1A 2DXIA 3OYGA 1LKXA 3DEEA 4FASD 2M4GA 3VWBA 4BL0B 1FMVA 4XKBA 3DTEA 3W3CA 3S93A 2Y0SA 3C2HA 4N4OB 4BXFA 4ZTFA 3IAM2 2VJ5A 3PL8A 2XAUA 4J00A 2HPMA 3RPUD 4E6KG 3VYTB 2WA0A 2W1OA 4LIVA 4CCNA 2V6EA 3LSKA 4KJZA 4RM2A 4PJMA 1MW7A 4F91B 2V7FA 3F9KA 1Y56A 2V4JC 2A5WA 1PYVA 3TMOA 3DPTA 1SAUA 4IX7A 5JHFA 3OIPA 4XLEA 2E5ZA 2X6WA 5HOOA 1VZ0A 2IGOA 4BEHB 1X1AA 3VYRB 2VASA 2XF7A 2KP6A 2ZXHA 2ZSHB 1DP3A 4XNFA 3LSHA 3ZR8X 3OYKA 2R7OA 1MMAA 2X85A 3HL2A 3CESA 2VQGA 3CP8A 1WJDA 2A6TA 4LIUA 1K6YA 3PNVA 4XQFA 2VQCA 1V5GA 3OYHA 2DT7B 3FBIB 3S3OA 3HKZA 2W7NA 3PJRA 1HA8A 2LREA 2VJ4A 3EUHC 1TZLA 4XLFA 3OYCA 3NWSA 1MMDA 3OYMA 4J01A 3K4JA 4NC7A 2X6YA 3C2GA 4E7ZA 2LYCA 2CUZA 1WFXA 1FMWA 2XF6A 4II3A 4ITVA 5HNHA 3CJRB 2UV1A 4MLOA 3AL0C 3OYNA 4NQWB 2PJRA 2GOXB 4P1WA 2NOJB 1EA3A 2ZSIB 2JVGA 4AU7A 2DT6A 3H5AA 2CFOA 4BDZA 3D5LA 2LOOA 3OIQA 2IXSA 2CV2A 1G59A 4PFPA 2JA2A 4NNJA 3K70D 2DCEA 3L2QA 4ZDLA 4CCKA 3HXLA 3HC7A 4XKVA 2VB6A 2WB1A 2WY7Q 1D1AA 4II2A 4BE2A 4U87A 3UR3C 3CZ6A 3LMMA 3W2AA 2XDVA 2WAFA 5FROA 3CP2A 5CQEA 4BACA 3EUAA 3MMYB 3RSNA 2IGMA 1DGWY 3J7AY 2KQRA 2HZDA 2E5NA 4XLHA 2LC2A 2JSPA 3LSIA 2L2OA 1MMNA 2WBMA 2KHMA 1BR1A 3AFHA 1IRXA 4IQ4A 3QYBA 2VLAA 2M7AA 2CV1A 4CZCA 4XN0A 3SEZA 4F93B 3OS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KL4 A;  2OC6 A;  2I8D A; 
#chains in the Genus database with same CATH topology
 1R58 A;  4KUM A;  5HS7 A;  1R49 A;  1O7F A;  1R23 A;  1ZQ3 P;  3HRS A;  5M5X J;  2BY1 A;  2DK8 A;  1GXP A;  4E4H A;  3K1P A;  2JK3 A;  2RNJ A;  2DJN A;  3C3W A;  2RVC A;  3QPT A;  3GW2 A;  1B6A A;  3JRH A;  4IKF A;  1V5E A;  1STZ A;  5E1W A;  1YHQ I;  3PQK A;  3L2V A;  2O8X A;  3BQZ A;  1OYI A;  1PDN C;  4B44 A;  4Q4Z F;  5FRN A;  1QNT A;  2CUE A;  3E5Q A;  2TRT A;  5D8L B;  1ETQ A;  4JX5 A;  2JVH A;  4RAY A;  4WK8 F;  3PQJ A;  3S1N J;  1YTY A;  4RGU A;  4ESB A;  3CJT B;  2PG4 A;  1OLT A;  3LL7 A;  3FXK A;  3KP6 A;  2DFF A;  2ZME C;  3AL0 B;  2IA1 A;  1QU3 A;  2ZJR F;  3PFY A;  3DKX A;  1TW2 A;  1U5T B;  5EJC A;  1D5V A;  2YS9 A;  4CCO A;  5ICE A;  1POG A;  3A1Y A;  3QPS A;  1MNM C;  2VBZ A;  1ZLK A;  1OMI A;  4LMY A;  5JVT A;  1WZ2 A;  2CQK A;  2ZB9 A;  3A4C A;  1ZG1 A;  4W97 A;  1A35 A;  3NAR A;  1R4M B;  2LY2 A;  1FBQ A;  3DV8 A;  1F9N A;  5HLI A;  4WXH A;  2BW3 A;  2BVM A;  2K3P A;  2C6Y A;  1J2X A;  4JYK A;  1I50 J;  3FKJ A;  5DTD A;  2JA5 J;  2A61 A;  5CVJ A;  2YU3 A;  1YE9 A;  2H8R A;  2ETH A;  3RJP A;  1RR7 A;  4HLY A;  5GPC A;  1IRF A;  2IS1 A;  3DKY A;  1HOM A;  4I0B A;  3FIS A;  3FMQ A;  1WJA A;  1NG6 A;  4BU2 A;  5K7H A;  2AQE A;  4HPQ A;  2F5V A;  4J19 A;  2HGC A;  2F6C A;  2HNH A;  4DNC A;  2FU4 A;  1O4X A;  1SD5 A;  2CW8 A;  5JR3 A;  2QWW A;  3ZMZ A;  3G4S I;  1R1V A;  2HQA A;  4I0A A;  3HOU J;  3WTT C;  2K3F A;  2M34 A;  5LD2 C;  2IP2 A;  2IA0 A;  4CYD A;  2L02 A;  4EM1 A;  3SFI A;  1HKS A;  2EJR A;  2M7B A;  3F3X A;  3LSP A;  2NS0 A;  4KMU X;  5BS6 A;  4BS9 A;  1XDU A;  2LVS A;  3I71 A;  4PCQ A;  3H5N A;  3FXO A;  3QOD A;  1LB2 A;  2Z9O A;  3RCO A;  2ME6 A;  2ID3 A;  1KU7 A;  3ABM H;  5DYM A;  1RES A;  1ONV A;  1LDJ A;  4IZZ A;  1FYM A;  1FY7 A;  3GFI A;  1ZRD A;  2O9L A;  2HPI A;  2K40 A;  2K9L A;  3WTS C;  5ILS A;  2VKH A;  5M5W J;  3JSP A;  3H9J A;  3ZPL A;  2MH9 A;  2FE3 A;  2WAQ A;  4DOZ A;  2VUM J;  1TQI A;  2IGN A;  3HSF A;  4C3I J;  3ASN H;  3S2D J;  1T98 A;  5DEQ A;  3B6C A;  1X58 A;  3V7S A;  3P9C A;  4GRI A;  2LG4 A;  3KP4 A;  2W25 A;  4ESF A;  1VQP I;  5JLW A;  1FTZ A;  3COA C;  4PJN A;  1ACI A;  1VQM I;  2ELJ A;  4RGX A;  4Y7N J;  4LD5 A;  4CDG A;  3WTW C;  3OSF A;  2X0L A;  3LAP A;  3A01 A;  2IS6 A;  1FT9 A;  3LSJ A;  3HBL A;  5DUI A;  3CF5 F;  4E7I A;  1KON A;  4M6V A;  2Y31 A;  3J7Z I;  2OZU A;  4O5V A;  4PDK A;  3SJM A;  1YW8 A;  2RNG A;  2UXX A;  3R0A A;  2KMU A;  5B1A H;  3RTR A;  4DZP A;  4HNU A;  3G1M A;  3PNY A;  2JWT A;  1LVA A;  1I6X A;  2ME0 A;  1H0M A;  2I10 A;  3JRD A;  3S1R J;  4Y4R A;  1VQ7 I;  4MHG A;  1JKP C;  3LNQ A;  5E17 F;  2JA8 J;  3MN2 A;  1S6L A;  3IP4 B;  3VSK A;  3WGG A;  5H6Q A;  4P9F A;  3CDI A;  3W2W A;  1OKR A;  4EJT A;  2X1C A;  1IF1 A;  1T08 B;  1S72 I;  1VQ6 I;  1BI3 A;  1YRN B;  3BCA A;  4HF2 A;  2M5W A;  3EQL F;  2K5C A;  3ZN1 A;  1IN6 A;  4A12 A;  2FBK A;  2CRG A;  2YR2 A;  4KA4 A;  3CC4 I;  2DBB A;  4ZC3 A;  3FXR A;  1Y1V J;  3FXM A;  4C30 A;  4AWX B;  4KN7 X;  5J4V A;  2V9V A;  4AID A;  3P9I A;  2VI6 A;  2F4M B;  3O8G A;  1HW2 A;  4OU0 A;  3WTV C;  4L0Z B;  1GXQ A;  4BE1 A;  1FOX A;  4LOC A;  5FD6 A;  1MBJ A;  2E1N A;  2RC4 A;  2VE8 A;  1N75 A;  1AHD P;  1TWA J;  3SZG A;  1V4R A;  2L4A A;  3BR6 A;  5EYR A;  3BG5 A;  1GHC A;  3GTG J;  3W6K B;  3GME A;  1JKQ C;  1E17 A;  3G1O A;  5HDN A;  1BIA A;  2A5Y B;  1KQ9 A;  2NNY A;  1FOY A;  1R9T J;  3GTO J;  2CO5 A;  2H6B A;  4R79 A;  2LBF B;  1K78 A;  3N4M A;  3W2V A;  4MTD A;  1D0Z A;  2V26 A;  2ACJ A;  2FD5 A;  2CMP A;  2Z1D A;  2P81 A;  3GTQ J;  2RRE A;  2Y30 A;  3DBL B;  2MBF A;  1ZH5 A;  4N0B A;  1B59 A;  5E79 C;  2VE9 A;  2VOD A;  3U1D A;  4XL9 A;  3FZV A;  3E6C C;  1W36 C;  4A3G J;  1NG7 A;  4D7M A;  4IQJ A;  1IUF A;  2QUF A;  2XGD A;  5E18 F;  3BOQ A;  3OS2 A;  5E8I A;  2XV4 S;  2R5Y B;  5IP9 J;  1XCB A;  3IWF A;  1MBG A;  4L18 B;  1T6S A;  1ZGJ A;  3ZP5 A;  3J81 Z;  5DS9 A;  1XC5 A;  4XOP A;  3IH4 A;  2VL8 A;  3E1S A;  4HST A;  2JRM A;  2KIS A;  1YYV A;  3KP3 A;  4I98 B;  3O2P E;  1YS6 A;  3VDX A;  4G94 A;  5C44 J;  2P6S A;  5E3L A;  1MH3 A;  3CJQ B;  5ICG A;  2XB0 X;  4HRI A;  2A68 F;  2E35 A;  3CQZ J;  4BEH A;  3KZI C;  1O7L A;  5DCM A;  3O6B B;  4BXU A;  2PMZ A;  3BC8 A;  4Y33 A;  2PX9 A;  3RZD J;  2EBI A;  2E1O A;  3H0G J;  2RAE A;  4M71 A;  4DBR A;  2DAO A;  5F1J A;  2CQX A;  3QOP A;  2ZXJ A;  1ZGW A;  4KDP A;  1F36 A;  4CUG A;  2WAE A;  4A0Y A;  3VSL A;  1RKT A;  1UG2 A;  1OR7 A;  4B1R A;  3HUG B;  2LKP A;  3H3V K;  2KJC A;  3K4K A;  1Y1W J;  3AG2 H;  5HLT A;  2H94 A;  1XSV A;  1H9G A;  4B3X A;  2JSC A;  2HOE A;  4XID A;  4BJ5 C;  3FMR A;  4F3Q A;  2OA4 A;  1ZK8 A;  3S3N A;  1JXS A;  1WJ5 A;  1HST A;  2EA2 A;  3HRT A;  2HVR A;  2HXO A;  3CF2 A;  5E8G A;  1IN7 A;  5M3F J;  2JT1 A;  3GZ6 A;  3R6S A;  2HFH A;  3CLQ A;  2DA6 A;  3PUF A;  2P7C B;  2M4G A;  1LJ9 A;  3LFK A;  4D0P A;  2XRO A;  2NRA C;  3VB2 A;  3ZQF A;  1TBX A;  3ZMU A;  4HF1 A;  3C2H A;  5IYB J;  3AAF A;  1JUP A;  3KPH A;  4IXA A;  3A0B C;  1YS7 A;  3C2B A;  4J00 A;  4YIR X;  1M1E B;  5D5V B;  1FZP B;  3GTM J;  2GAU A;  2JA6 J;  2PMH A;  2P8T A;  1ETK A;  1V55 H;  4C3J J;  3HOX J;  2YSR A;  2EH3 A;  3ABU A;  4G8X A;  3WE2 A;  5FLX K;  1Y56 A;  2NNN A;  5BMZ A;  1SAU A;  4IX7 A;  5J1R A;  3GLX A;  3RYP A;  3M3Y J;  2L7M P;  2JN6 A;  3T8T A;  1RET A;  2IGO A;  2DA3 A;  2WTE A;  4M6X A;  3J81 K;  1X1A A;  3LA2 A;  2VBY A;  3E6D A;  1J75 A;  2ZXH A;  1HXD A;  2ZSH B;  1EV7 A;  2AXL A;  3CD6 I;  1DP3 A;  3ZR8 X;  4RAZ A;  3NQO A;  1Z6T A;  2E7X A;  4XRS G;  4LIU A;  5D5U B;  3GFM A;  5C3E J;  4XQF A;  3U1K A;  1BI0 A;  1MKM A;  2VQC A;  2JPB A;  1V5G A;  3I5U A;  2D1V A;  1PUF A;  3OYH A;  2Q0O A;  3HKZ N;  1I27 A;  4LB5 A;  2FEZ A;  2DOE A;  2JA7 J;  3I53 A;  4S0H B;  1FIA A;  4HBL A;  5DM6 F;  3F6O A;  2VJ4 A;  3I56 I;  3P7N A;  1Z1D A;  2K27 A;  3OIO A;  5GAH J;  3OYC A;  4FCY A;  3NWS A;  1X1P A;  1S8N A;  3K4J A;  3F21 A;  4NC7 A;  2X6Y A;  1GVJ A;  2XAS A;  1Z6R A;  2Z99 A;  1IAW A;  4KIB A;  3OYN A;  4B8X A;  2NYX A;  2L01 A;  3CCL I;  2AS5 F;  4CYC A;  2GOX B;  1ZR2 A;  4A0Z A;  5FB2 A;  2QZ8 A;  1DPR A;  4P9U A;  2HKX A;  4FE4 A;  3UKG A;  1W7P A;  5CVR A;  2CFO A;  2K02 A;  4FIS A;  2AXT C;  3TKY A;  9ANT A;  2COM A;  3DLL F;  4BBR J;  2L4M A;  2AO9 A;  2E36 A;  2K9Q A;  3V4G A;  2WWY A;  2KIQ A;  3L2Q A;  2WB1 N;  3ECO A;  4CCK A;  3HXL A;  1HW5 A;  4FTH A;  3R60 A;  1OIS A;  3KP7 A;  2FMY A;  2KT0 A;  3HB9 A;  2B7E A;  4GGG A;  3IL2 A;  2TCT A;  2E2J J;  4XSX F;  3IHU A;  1I5Z A;  2A3S A;  3W2A A;  4A6E A;  3HOY J;  4RS8 A;  3ERM A;  3M7G A;  2H27 A;  3RSN A;  2HQ5 A;  4G12 A;  2CG4 A;  3HGY A;  1LEA A;  2EQR A;  1ZGA A;  5LHG A;  5E3N A;  5ED4 A;  2E5N A;  3BR0 A;  5GAD J;  4KFC A;  2JSP A;  2L2O A;  3HSE A;  4M9X A;  5FO5 A;  2HTS A;  2RDP A;  5HDK A;  3BR3 A;  3GF2 A;  1RZ4 A;  4OIN F;  4IQ4 A;  3QYB A;  2M7A A;  5DUK A;  1WVR A;  2DA1 A;  3J80 K;  4XN0 A;  1JHF A;  1G2H A;  2ZNZ A;  3S1M J;  3FXJ A;  4F93 B;  2GQQ A;  3O3K A;  1N25 A;  3KIO A;  4ZDP A;  4CCJ A;  1A5J A;  1X4O A;  5LRR A;  1E3P A;  4ENK A;  1W5C C;  4AYB A;  1IW7 F;  3KFW X;  3E6B A;  1LUJ B;  3DP7 A;  5F27 A;  1ETX A;  2PJP A;  4GO1 A;  2M8E A;  2BHZ A;  5KK1 A;  2W24 A;  4HV5 A;  1L3L A;  2DQL A;  2W4S A;  3TO9 A;  2IPQ X;  1B9M A;  1O3T A;  1G6N A;  4E7J A;  1YX5 A;  2BYV E;  2DTZ A;  1E3H A;  4E7H A;  3CUQ A;  2ZXW H;  4U0Y A;  3CDL A;  4L5J A;  1MMG A;  3K4M A;  1W0T A;  3C18 A;  4L5I A;  3OYB A;  4MQ9 F;  4HEA 2;  1K83 J;  5BOX A;  2DQR A;  4XLN F;  4XOT A;  3TO7 A;  1BI1 A;  5K5Q A;  3GYH X;  4Q47 A;  4HSR A;  4MNU A;  4KIF A;  5L3C A;  2IBD A;  2MG4 A;  4XLA A;  1DUX C;  3S15 J;  1R5G A;  2B0L A;  3N97 A;  1XMK A;  1T0F A;  3WU2 C;  3OWT A;  3S14 J;  1TQP A;  5ILV A;  4XRM A;  4AVZ A;  1R5H A;  2VJJ A;  2KRF A;  5E20 A;  2EZH A;  2HDC A;  4BY1 J;  1HSJ A;  4HX4 A;  1K61 A;  1N77 A;  3H35 A;  4GYI A;  1MIJ A;  3I4P A;  2XRN A;  3S3M A;  3PNT A;  3I54 A;  4YEL A;  1U9O A;  1E2X A;  3HHG A;  2ZC2 A;  5BPI A;  5KHD A;  4XRF A;  4UV8 A;  5J8C A;  3MAJ A;  4HX7 A;  1D1C A;  3D5R C;  4YFK F;  2K85 A;  4A3E J;  4QWQ A;  2P5V A;  1VQ4 I;  2VON A;  1ERD A;  2ZME A;  4ON0 A;  4WCG A;  3GZN B;  4F52 A;  2ZFW A;  4L9N A;  5BNG A;  4CCL A;  2NVX J;  4M3E A;  1J7K A;  1IXR C;  1RC9 A;  2Y48 A;  1W36 D;  1YJW I;  1B72 A;  2NVU B;  5LGT A;  5TGT A;  3GWZ A;  1LFU P;  4CIC A;  5LEK A;  1H8A C;  3BPX A;  1D0Y A;  5FFX A;  1P4X A;  2CH0 A;  1MD0 A;  4JX4 A;  1LNW A;  5EEG A;  2YU9 J;  2F4O B;  2OUM A;  2JJ7 A;  2R4G A;  1QVT A;  5HVQ C;  1DU6 A;  4AIH A;  1RR8 C;  4HV6 A;  2FNA A;  2HQN A;  1F4K A;  3MZH A;  2QBY A;  1FPQ A;  5FGM A;  1Z77 A;  4XKC A;  2ZCW A;  2ECB A;  3ZMD A;  1LVK A;  1SVM A;  2RQP A;  3DTI A;  2WAQ N;  2V1D A;  5IOZ A;  3TOA A;  3HJE A;  2Z33 A;  3TBI A;  2ZJP F;  4PGH A;  5TJJ A;  2D5V A;  2DK5 A;  4V19 K;  2VN2 A;  2XVC A;  1J5Y A;  4YIF A;  2MSY A;  2QM3 A;  3HRU A;  5FFZ A;  2F5E A;  2FOK A;  3S32 A;  1NTC A;  1UMQ A;  2IVM A;  1X4P A;  3RQI A;  3M1C A;  4ABZ A;  2E7W A;  3DCF A;  1V54 H;  4I99 C;  1TWF J;  3OL3 A;  3WE3 A;  1A36 A;  3IC7 A;  1T39 A;  1PP8 F;  1AKH A;  4C3H J;  3R0J A;  2E71 A;  2BW3 B;  2IEK A;  2XPU A;  3CJN A;  2BGC A;  4OAY A;  3SXY A;  2DPU A;  2DJI A;  1XGM A;  1JE8 A;  5F6F A;  2DW4 A;  3LSG A;  2A69 F;  2JUG A;  2Y2Z A;  3ECH A;  3G2B A;  1BJZ A;  5E3O A;  1T0F C;  2Y9Y A;  4YG2 F;  4Y13 A;  3JR9 A;  2GZW A;  1ZHF A;  1HLV A;  2LFB A;  3RKW A;  4YEJ A;  2VQH A;  5LGU A;  4LK1 F;  3I64 A;  2OD5 A;  4Y17 A;  1WKM A;  1UCR A;  2IA2 A;  3BG9 A;  5D6F A;  2EFW A;  1VFC A;  2R3S A;  2VXZ A;  2LY9 A;  1MGT A;  2JUC A;  3WTX C;  1EH8 A;  2H8W A;  4S04 A;  2Y0S N;  3H5R A;  4M6Y A;  1BW5 A;  3A2K A;  1VQ9 I;  2GBY A;  2P5K A;  4P55 A;  3OYE A;  1HKQ A;  1G3S A;  2HKO A;  1P9Q C;  2XHK A;  5FJ8 J;  1ZYR F;  4A3J J;  3PO3 J;  2FQ3 A;  1DQU A;  3CDH A;  3I9V 2;  4RLF A;  4E7S A;  1LE8 A;  1IGN A;  2BOL A;  2R7U A;  2EV0 A;  1MBK A;  1IO2 A;  2CQ7 A;  1HDP A;  3FK7 A;  4AD9 A;  3G6E I;  3MFK A;  1UHW A;  4ZYA A;  2CW7 A;  1SVL A;  4LG0 A;  1WJE A;  1U9N A;  4C2U A;  3OYJ A;  2W48 A;  3I55 I;  1KGS A;  2R7T A;  1WJF A;  2QGU A;  1Z21 A;  1S7O A;  1Z05 A;  1V5F A;  2EIM H;  1MDM A;  3D5S C;  4LB6 B;  4CHU A;  1YQA A;  1OCT C;  4A3K J;  1FSE A;  4IRI A;  5LHI A;  5A2Q Z;  2I8D A;  2VQL A;  2PN6 A;  4XLP F;  3A01 B;  1FLI A;  5GTI C;  3A03 A;  3FF5 A;  3MZY A;  4F55 A;  2LKS A;  3GVA A;  2ZBK A;  4LG3 A;  3DKW A;  3GLL A;  3WOD F;  1JUS A;  1BR4 A;  1IDZ A;  3T8R A;  3T5X A;  1JI8 A;  1XSX A;  2OQR A;  4L5E A;  3CCR I;  3BR1 A;  3JRI A;  3G73 A;  1LEB A;  4KNY A;  5LLQ A;  3I58 A;  5EDN A;  2E1M C;  4HDV A;  2VKV A;  1YI2 I;  2N8G A;  3TO6 A;  4XKW A;  3L2W A;  1I3Q J;  4DBQ A;  3BRO A;  3OL4 A;  1HW1 A;  5FRM A;  2FBH A;  4W1U A;  3ZGK A;  2YX7 A;  2XRL A;  1FYK A;  1P2F A;  3F8N A;  1WQ2 A;  1MMS A;  1YJ9 I;  3H9Q A;  1HCR A;  2CQQ A;  5ICF A;  3OY9 A;  5IY5 H;  3CO7 C;  2QSG X;  4M3G A;  3LSR A;  1I3A A;  1BA5 A;  2PMZ N;  1BR2 A;  4U0V A;  2I5U A;  3K7A J;  4OMZ A;  4B3A A;  4PJJ A;  3IKV A;  1QZZ A;  2F5C A;  4BQQ A;  4KMF A;  1Z3X A;  2BZT A;  3VFZ A;  3OYI A;  3BG6 A;  1S7E A;  4BAY A;  4G6T B;  4UUS A;  5C4X J;  1UST A;  2LSO A;  2DMQ A;  4FHT A;  1D1B A;  1UG0 A;  4IOC F;  5B3S H;  4CSW A;  3OYF A;  3QYE A;  5F0F A;  2DMP A;  2STT A;  4RAG A;  4DZJ A;  4UVB A;  3IRQ A;  4UY8 I;  4BGD A;  1KU9 A;  5EEH A;  1H9T A;  4MEX F;  3G3Z A;  1T2K A;  3K6G A;  4QPO A;  5H20 A;  3CUO A;  4E7K A;  4DIQ A;  4B09 A;  1K78 B;  1WCM J;  3ZQL A;  1BI2 A;  5J1U A;  3V7C A;  2E34 A;  2ICW G;  3OMY A;  2X6X A;  3IKT A;  4XM3 A;  3ROU A;  3FK6 A;  3FHN A;  1YIO A;  4NQW A;  5IPA A;  5A2Q K;  3OS1 A;  2DXI A;  3CCJ I;  2J5P A;  4FAS D;  3Q9S A;  4BH9 A;  1BOA A;  4XKB A;  2VOP A;  4IEJ A;  3W3C A;  2Y0S A;  2HOS A;  1NK2 P;  1RRJ A;  1DU0 A;  1UJ8 A;  4ZTF A;  4D7N A;  3IH3 A;  2VJ5 A;  3PL8 A;  2HPM A;  1MBF A;  2ESN A;  2WA0 A;  4LIV A;  3H3U A;  3R4K A;  2Y75 A;  2ECC A;  3LSK A;  4BKX A;  2XGC A;  2L7Z A;  2V1U A;  4UUV A;  2E2I J;  3L09 A;  2A5W A;  3TMO A;  1PYV A;  4A0X A;  4YFN F;  1KU3 A;  2E5Z A;  4I09 A;  3WHC A;  1J9I A;  2X6W A;  3GXO A;  1VQK I;  1VZ0 A;  4BEH B;  4DYC A;  2F5D A;  5DCM B;  3ZQH A;  2VAS A;  1BN5 A;  2XF7 A;  3T0Y A;  3QWL A;  2KP6 A;  1QO0 D;  4EJU A;  1GV5 A;  4XNF A;  2R7O A;  2XAH A;  4OOI A;  3R61 A;  3CP8 A;  2QVO A;  1WJD A;  2A6T A;  1TT5 B;  2CJJ A;  2FML A;  2OBP A;  1W7P D;  3SZT A;  4X1E A;  1GT0 C;  2DT7 B;  3JRA A;  4G7H F;  3KP2 A;  1D8K A;  1KQ0 A;  3WTU C;  2V1X A;  3MKL A;  4IHX A;  3PJR A;  2CWE A;  4U7D A;  1HA8 A;  2K4J A;  1P7I A;  3F6V A;  5IYD J;  2HYG D;  4J01 A;  3K1M A;  4E7Z A;  2MLG A;  3FM5 A;  2DU9 A;  2HWV A;  4HQM A;  1MZB A;  2FNP A;  2XF6 A;  2R5Z A;  4A3C J;  4II3 A;  5FLX Z;  4O6J A;  3AL0 C;  3KE2 A;  4ENM A;  4UHT A;  2HQR A;  1R4N B;  2R92 J;  2BXZ A;  3VPR A;  2QSH X;  4M3B A;  2PJR A;  2HZT A;  3LQQ A;  5D8K B;  4P1W A;  2NOJ B;  4RBO A;  2M45 A;  1EH6 A;  3H1C A;  1H88 C;  4GDF A;  4AU7 A;  1XGS A;  5L3G A;  2DT6 A;  5GAE J;  2QQ8 A;  1IRG A;  2QYO A;  3PFI A;  5B5E C;  4UB8 C;  3HEF A;  2UZK A;  3H5A A;  2VBW A;  3OIQ A;  2IXS A;  2L0K A;  2IAI A;  4PFP A;  1NH3 A;  1Q1H A;  3EYI A;  1KYW A;  1OCC H;  2R0Q C;  4RAF A;  2HDD A;  2DCE A;  2HYF A;  3ELK A;  1JGS A;  3NRV A;  3HC7 A;  4RA2 A;  1W4M A;  4PJ0 C;  4I76 A;  4U87 A;  3FHZ A;  1RKW A;  3GTL J;  2EZI A;  3WU1 B;  2BHY A;  2A6E F;  5CQE A;  1QZE A;  3TW7 A;  4EVI A;  1D5Y A;  2FOW A;  2JTV A;  1E3O C;  5IT3 A;  3JW4 A;  4XLH A;  3IH2 A;  4IPA A;  2O61 A;  3TP3 A;  1PUF B;  3FMS A;  1BR1 A;  2GXG A;  4CO8 A;  3BP8 A;  3HHH A;  3LWF A;  3E7L A;  3VEP A;  3MVP A;  1R7J A;  1KZH A;  5FLM J;  3SEZ A;  6PAX A;  4IHV A;  4N9H A;  4IL6 C;  2Z16 A;  4AYB N;  2X4H A;  1T8I A;  1ZAR A;  3EUK L;  3K4N A;  4XMY A;  1IXS B;  2LKX A;  1BW6 A;  1ZKG A;  4OIQ F;  5L3E A;  1ZG3 A;  2VT3 A;  2IS2 A;  3E0J B;  3W6V A;  1HF0 A;  4P96 A;  2CV0 A;  3Q0V A;  1CF7 A;  4BE0 A;  2ID6 A;  3PM1 A;  3OR2 C;  4BDY A;  3M9A A;  4M72 A;  2LR8 A;  4CYC B;  1JJ6 C;  1YW7 A;  1ZR4 A;  3ML6 A;  3FBN B;  1FP1 D;  2DMT A;  2MH2 A;  1IN5 A;  1JTY A;  1GVD A;  4RMN A;  4BJ6 C;  1W7P B;  3CCM I;  4XN3 A;  3WGI A;  4UVA A;  2PMU A;  4DGW B;  3QP5 A;  3CMM A;  4MFD A;  3ZMV A;  2E60 A;  4LLG F;  1NHA A;  1QBJ A;  1ETY A;  2MC4 A;  2MFZ A;  3ZMS A;  1I1S A;  3L2R A;  4FX0 A;  2B9S A;  5E1Z B;  3EPZ A;  1G3T A;  3J80 Z;  3PSF A;  1J0R A;  3KYD B;  2HVQ A;  4ETS A;  1MJB A;  3WG9 A;  2K9S A;  3MKW B;  3K10 A;  2LF8 A;  3C7J A;  2EV5 A;  1G8X A;  2LY1 A;  4B43 A;  1VF9 A;  2JPC A;  1SD7 A;  1X2M A;  5FKN A;  4KIS A;  1X1D A;  2M2E A;  1A6Q A;  1LQ1 A;  1B4A A;  3GEZ A;  3JCU C;  3CCY A;  3ABL H;  4V2G A;  4ENJ A;  4GFB A;  5FKM A;  1VQO I;  1TT0 A;  2L5Q A;  1GLN A;  3ZN0 A;  3SYT A;  1MJ9 A;  4OIR F;  1ZTR A;  2L9V A;  3Q0W A;  3HOV J;  1WGX A;  3C1D A;  1TNT A;  3OYA A;  3PIP F;  3MZ8 A;  3HDD A;  1ZG5 A;  3H9G A;  1ZRC A;  3OOU A;  1KYZ A;  4HQE A;  1J09 A;  3VOD A;  1FOK A;  3F8B A;  4DJA A;  3X2Q H;  4CH7 A;  2DOF A;  5D6E A;  2V1N A;  1MJA A;  5FD5 A;  4X0G A;  3CO6 C;  3WHB A;  1LFP A;  1W1W E;  2NOG A;  2DI3 A;  3T1B A;  4ZDO A;  2EIK H;  4FET A;  5JI6 A;  3MCZ A;  2IGK A;  5DD4 A;  4U88 A;  1VQN I;  2PFB A;  3ASO H;  4HNV A;  4CA0 A;  4QTR A;  2XPW A;  5B1B H;  5KCM A;  4HG2 A;  1IJW C;  1ZRF A;  2OTL I;  3CUQ B;  3KYL A;  2FXA A;  1W0U A;  4OIP F;  4EV0 A;  3K1N A;  2HEO A;  3RQ4 A;  3K70 C;  2V9K A;  2EA4 A;  1O3S A;  5ERI A;  1J59 A;  2ADU A;  3EET A;  1EJ9 A;  2XF5 A;  2X1E A;  1S5L C;  2LTP A;  3HTU A;  2CGP A;  3VYU B;  3ZRG A;  4D9J A;  1W5T A;  3BLY A;  4UNO A;  1G3Y A;  4HNT A;  3RIR A;  1GV2 A;  5CVV A;  1PP7 U;  4QIW N;  2DO7 A;  3LSM A;  1B8I A;  3U2R A;  4CCM A;  3OYD A;  3L2C A;  3ERE D;  1I1G A;  1YG2 A;  4XK4 A;  1QHH D;  2BVL A;  1BM9 A;  2KRH A;  1U3E M;  1XN7 A;  3HYI A;  2TDX A;  5FKO A;  3BTC A;  2OU2 A;  1YIT I;  4BNC A;  4Y3O A;  4LIT A;  4U0W A;  4EMS A;  2ELH A;  1JKR C;  3HGG A;  1BBY A;  3BCB A;  2G9W A;  3RZO J;  3DEW A;  4LFU A;  1ETO A;  2HXI A;  4U7B A;  1HQC A;  2HOA A;  4XRS A;  4A3M J;  2CUF A;  1IZ1 A;  1T56 A;  2KKO A;  2ZME B;  4ZJZ A;  3HOS A;  3MKY B;  1Z0X A;  2L9N A;  3WTZ A;  1FEX A;  1IN4 A;  2JMW A;  3KLN A;  1B72 B;  2KDO A;  1YJN I;  2FUG 2;  1QPM A;  2DN0 A;  1IN8 A;  1OCR H;  2QQA A;  1R22 A;  4B48 A;  1TLH B;  3DU5 A;  5EGO A;  3BTL A;  2XPV A;  4RGR A;  5TIS C;  2YPR A;  4I2O A;  3E3V A;  3F8M A;  3JTG A;  4MGR A;  1OCO H;  3GX4 X;  4BQO A;  5AIQ A;  1XGO A;  5LBQ A;  2RQQ A;  1DP7 P;  1SEU A;  2BY2 A;  1U8B A;  2X1D A;  1JTX A;  2QBY B;  4Q5S F;  3L00 A;  4KT5 C;  4KT6 A;  1R71 A;  2HI3 A;  3K2Z A;  4UV9 A;  3FKI J;  1JUM A;  5K1Y A;  3GBG A;  1JJ8 C;  4IHS A;  2FX0 A;  3CCU I;  1IV8 A;  2QCO A;  2EIL H;  3SDG A;  4M3D A;  5EG0 A;  2KPM A;  4L9T A;  2VXD A;  5IOY A;  4RDU A;  2HDW A;  1I6H J;  1FBU A;  4A2U A;  1SAX A;  2Z5U A;  4MEY F;  2DA7 A;  1XMA A;  2KZV A;  3A0H C;  4NBQ A;  1FIP A;  4IHW A;  2KL4 A;  3GTP J;  4HDU A;  4XBF A;  3M8F A;  4ESJ A;  3S8P A;  4KIT B;  3HOT A;  2P4W A;  2KLO A;  3M8J A;  2XC7 A;  5KVR A;  2E1M B;  2F2E A;  3HPG A;  4FX4 A;  2QKM B;  2Q2E A;  3AKZ A;  2LH9 A;  1AKH B;  3B6A A;  2GA2 A;  3PSI A;  3A02 A;  4NUB A;  3FIW A;  2LRD A;  4L9J A;  1F5T A;  4HYE A;  1XPX A;  4BHB A;  1ZEL A;  3MWM A;  2DYS H;  5FKK A;  1ENH A;  3F8F A;  1Z7U A;  3SDB A;  5HLH A;  2W00 A;  2V79 A;  2X51 A;  5CKT A;  3NWT A;  5K7F A;  4A3D J;  3CME I;  4B47 A;  2PEX A;  4A3F J;  1UZC A;  3QYF A;  2VIX A;  2R7W A;  3QQA A;  1YOV B;  2DOA A;  2K9M A;  1XD7 A;  1FYL A;  1ETW A;  4OMY A;  1QQI A;  3H0D A;  5JLX A;  5CVU A;  4WWC A;  1ON1 A;  2CU7 A;  2FQ4 A;  5EZH A;  4BY7 J;  3I0T A;  1ORK A;  4ANJ A;  3GZ5 A;  4PK4 A;  3ZQQ A;  2XB5 A;  4IO9 F;  1OFC X;  5J4Y A;  5D5X B;  2G0E A;  4M73 A;  3I3L A;  2QKL B;  3DXJ F;  3I59 A;  3MKZ A;  2R7R A;  1YIJ I;  2M4K A;  1LE8 B;  1ITY A;  1FP2 A;  3KLO A;  4D5C A;  5K5R A;  2X6O A;  1RI7 A;  4EJO A;  4IRH A;  1SAN A;  3WTY C;  4LGW A;  4Y15 A;  2F4I A;  4BHP A;  4LG0 B;  5DV5 A;  1F43 A;  2E19 A;  2ZFU A;  1FBS A;  5H2F C;  5C4J J;  1Q1V A;  3K4C A;  4PUS A;  2D1H A;  4Z2Y A;  3M1E A;  3HOZ J;  1MDM B;  3U21 A;  4JK1 X;  2KIU A;  4AIJ A;  2ZNY A;  1VTN C;  1WJB A;  1X3W B;  1U6G A;  3P9K A;  3OYL A;  5JVG F;  4LK0 F;  1P92 A;  1SFO J;  1HDD C;  2AQF A;  2MYS A;  3QU6 A;  1R6R A;  4XON A;  2LK2 A;  2XKP A;  4Y52 J;  4F92 B;  2EFP A;  3LQR A;  3ZQ7 A;  2DFI A;  3ONQ A;  3ABK H;  3MQ0 A;  2O8K A;  3HPH A;  1C0W A;  2A05 A;  1P7J A;  2L54 A;  2VPL A;  1S29 A;  3L2U A;  3JRB A;  1Y0U A;  4C2M J;  4I6Z A;  3QAH A;  2GM4 A;  1XX5 A;  1SD6 A;  2ESH A;  5CLS A;  3H36 A;  3E6M A;  3WGH A;  1O3R A;  4BL0 B;  2MGQ A;  1FMV A;  3IRR A;  2QF7 A;  3GCM A;  3DTE A;  3S93 A;  3IWZ A;  1Z67 A;  4KIG A;  1EH7 A;  4BXF A;  1SFU A;  3IAM 2;  2XAU A;  4JP0 A;  3Q0U A;  3RPU D;  4UXN A;  3QPL A;  2NXN B;  2W1O A;  3KYC B;  3J7A O;  1IXC A;  4RM2 A;  5BQT A;  1SMT A;  1XB4 A;  1MW7 A;  2EFN A;  3ZQI A;  2V7F A;  2IRF G;  4A6D A;  2L7F P;  2HTJ A;  3DPT A;  4UB6 C;  5JHF A;  1TWH J;  3OIP A;  4XLE A;  2BEO A;  2XAJ A;  1MSF C;  3LA7 A;  3D1N I;  3VYR B;  4GXO A;  4G7O F;  4XSZ F;  5FLV A;  2PQ8 A;  4D5F A;  4MTE A;  2M87 A;  1XS9 A;  3OYK A;  4UUS B;  1X2N A;  2BY3 A;  3HL2 A;  1RPW A;  2NAZ A;  1FWZ A;  2MA3 A;  2VQG A;  3BR5 A;  1K6Y A;  4HOB A;  5EZG A;  1Y39 A;  1S3J A;  3JAM Z;  1ULY A;  1XTA A;  2CFX A;  3FBI B;  4MO7 A;  3S3O A;  2W7N A;  1O3Q A;  1OCZ H;  2LRE A;  3LOC A;  3EUH C;  3WG7 H;  3ESW B;  2M9H A;  1TZL A;  4HZF A;  2XSD C;  2JRT A;  3BR2 A;  4CXF A;  3CCS I;  2XAF A;  3TW6 A;  2QQB A;  3JRE A;  1H89 C;  3C2G A;  2H6C A;  5IP6 A;  1SMY F;  5F0H A;  2CUZ A;  2V9P A;  2BE5 F;  4BBS J;  2O3F A;  1FMW A;  4ITV A;  3F72 A;  2QEX I;  1K7A A;  3KZZ A;  5HNH A;  4MLO A;  2NS8 A;  2LD5 A;  4NQW B;  2ZO4 A;  2KJB A;  3CCE I;  2R93 J;  2R7F A;  1TWG J;  3Q5F A;  4HW0 A;  3ZQC A;  1IUY A;  1TL8 A;  2ZSI B;  2CW0 F;  1IC8 A;  4IF4 A;  3GTK J;  3OSG A;  2O7O A;  3L9F A;  1LFB A;  3CLO A;  4EQQ A;  4M9Z A;  3CC2 I;  1I39 A;  2LOO A;  2QLZ A;  3RKX A;  1G59 A;  2JA2 A;  4NNJ A;  3TDZ C;  1SC7 A;  3L7W A;  1ETV A;  1FX7 A;  3K70 D;  2R7D A;  1T33 A;  4ZDL A;  1LPQ A;  5D4R A;  2MC3 A;  2CQN A;  2VPR A;  4RB3 C;  4XKV A;  1R36 A;  2E2H J;  2VB6 A;  3DFG A;  1U78 A;  3SFZ A;  2WY7 Q;  4II2 A;  4BE2 A;  2OCC H;  3H92 A;  2X48 A;  3BZ6 A;  3UR3 C;  3CZ6 A;  1U5T A;  1USS A;  3LMM A;  2EIJ H;  3QU3 A;  5IYC J;  5FRO A;  1Y8R B;  3NEU A;  3FXQ A;  2RV8 A;  2Y69 H;  4R8H A;  2IGM A;  1DGW Y;  3ZQG A;  5DCF A;  2CYY A;  3J7A Y;  2KQR A;  2F5F A;  2VOO A;  2KZG A;  2LC2 A;  5B66 C;  2DLL A;  2KHM A;  1IRX A;  2W57 A;  3GO5 A;  5GAG J;  2VLA A;  1A04 A;  2HR3 A;  2CV1 A;  4A5N A;  2IT0 A;  1DPU A;  4CZZ A;  5F04 A;  5TRD A;  2RKH A;  1X3U A;  1YW9 A;  5LEJ A;  3BY6 A;  2EIN H;  2X9D A;  1AU7 A;  1ZLJ A;  3M8E A;  3F8C A;  3CMA I;  4N9I A;  1QGP A;  3SEQ A;  1Z7L A;  3JAM K;  3KP5 A;  4WXD A;  3V8J A;  3H3Z A;  3K0L A;  4P5O A;  4WXC A;  1VQ5 I;  4AM3 A;  2R5Z B;  2NVQ J;  4ZZD A;  3HRM A;  1U0J A;  4PSW A;  2R7X A;  1A6I A;  1XCV A;  2P0W A;  3DWL E;  2IW5 A;  4PSX A;  4A93 J;  1SVO A;  3ZXS A;  1MSE C;  2EZK A;  3BTI A;  2HU9 A;  2PJR B;  1YO5 C;  4HX8 A;  3RI4 A;  4B4C A;  5LHH A;  4NB5 A;  5F64 A;  3KET A;  3ISP A;  3SHF A;  4BXX J;  5J8F A;  1SFX A;  5HS8 A;  3HM5 A;  1SFE A;  3S17 J;  2B63 J;  2QQ9 A;  3DLA A;  4ZTJ A;  4JQF A;  2XKO A;  5CPR B;  1G4D A;  2RN7 A;  4EJW A;  4EJV A;  1JGG A;  4KN4 X;  2ISY A;  5DM7 F;  5DDG A;  2L9S A;  1FNN A;  1YX3 A;  2L7K A;  5CJ9 A;  4M74 A;  1VND A;  2VKE A;  3FDY A;  1HC8 A;  5JFR A;  3B73 A;  5IT9 Z;  1EF4 A;  2VKD A;  5CYV A;  3V8L A;  4BJT A;  5K5O A;  2D2W A;  4BQA A;  1U2W A;  2H1L A;  2OV7 A;  1B1B A;  5AON A;  2DTR A;  2M0M A;  4A5M A;  5EF6 A;  2UXN A;  1WJC A;  3E5U A;  3GFJ A;  4ENN A;  1UEL B;  1Y6I A;  3BTJ A;  3OOP A;  3RPU A;  4RGS A;  4C2T A;  1QRY A;  1CGP A;  1S7A A;  3FX3 A;  4EGZ A;  1GDT A;  1AA7 A;  1G3W A;  2MD0 A;  4WX9 A;  2ZJQ F;  1RIO H;  1JHH A;  3CCQ I;  1FOW A;  1HKT A;  2LF7 A;  4L0Y B;  4QSH A;  2DFH A;  1WPK A;  3BQY A;  4YFX F;  1FTT A;  2Q8K A;  2XSJ C;  4ZH4 F;  4UVC A;  1MH4 A;  2GIZ A;  2GOM A;  2VJI A;  3KCC A;  4I02 A;  4RM3 A;  1W5S A;  4N4N B;  4RB1 A;  1SD4 A;  4JX6 A;  4OWR B;  3LAJ A;  4DYR A;  3DQV C;  4YRV A;  3DF8 A;  2Y0M A;  1QVU A;  1P6R A;  1U5T C;  4OIO F;  2KRC A;  4H4K C;  5HLG A;  1WH7 A;  1XDS A;  2FSW A;  4HA8 A;  2F48 A;  5J47 A;  1UFM A;  2CS3 A;  1CF7 B;  1MNE A;  4AUX A;  1CQT A;  2R7Q A;  3F23 A;  2L3D A;  3VYS B;  2JZY A;  4HLX A;  1BC7 C;  2OAZ A;  3TDU C;  2OC6 A;  5KNL A;  3K69 A;  1YRN A;  3GFL A;  1REP C;  3JRF A;  3IUO A;  3CMY A;  1TTY A;  2GXB A;  5D5W B;  3HG9 A;  2W84 A;  5AIP A;  1Z9C A;  2EFQ A;  2LDU A;  3FXU A;  3RKQ A;  2UWM A;  2HVS A;  1R1U A;  4V2F A;  3SQN A;  1IG7 A;  1UB9 A;  3QPH A;  3TL4 X;  4A69 C;  2A07 F;  4A3L J;  1F1Z A;  2WV1 A;  4BUP A;  4IHY A;  3FXL A;  3LA3 A;  3HIF A;  3J7Y J;  3HTS B;  4G6Q A;  2COB A;  1K6O A;  2M8G X;  1VQL I;  2DT5 A;  2OPT A;  5IP7 J;  2HS5 A;  1TWC J;  4C9Y A;  3K2A A;  2OTJ I;  1X1B A;  2MD5 A;  3IV5 A;  2WV0 A;  1Z3Y A;  1L0O C;  2VC1 A;  4Z6Y A;  1ZRE A;  5IT9 K;  2VC0 A;  4Q48 A;  3ZCO A;  2LBF A;  1RUN A;  4A3B J;  3OV8 A;  3KEY A;  1YFH A;  1KU2 A;  2BXY A;  1LDK B;  3ABT A;  3W6J B;  3L1P A;  2DPD A;  1XG1 A;  4PJL A;  2ZKZ A;  5CQG A;  5J6X A;  3DPL C;  3AG1 H;  3S2H J;  1VI0 A;  1K4T A;  1E0E A;  3QOE A;  2YX4 A;  4XR6 A;  5E1X A;  5M5Y J;  3TED A;  2ZJ2 A;  2VT2 A;  1X19 A;  3DPU A;  2GIV A;  2R5Y A;  2KIF A;  3MD2 A;  2WAD A;  4PFO A;  3DU6 A;  4DQ2 A;  1WWX A;  1JT6 A;  1V3F A;  5KAF C;  2M0C A;  1TQM A;  3K4L A;  1QZY A;  4NC8 A;  3RDI A;  1IDY A;  1QHG A;  2DA5 A;  2K7L A;  1Y8Q B;  5KAI C;  5L3D A;  3KX2 A;  2XAQ A;  4EAT A;  4ZYH A;  1OPC A;  5LGN A;  3BG7 A;  2J5O A;  2RGV A;  1WI3 A;  2XGE A;  3ULQ B;  4KYW A;  2EV6 A;  4OAZ A;  2FBI A;  4XOR A;  2STW A;  1NK3 P;  3GUD A;  3PIO F;  4K2E A;  2EK5 A;  2FA5 A;  2CSO A;  5LFA A;  3EDP A;  4G9Y A;  4M3F A;  3S1Q J;  3GTJ J;  5FKL A;  1OYY A;  2PBI A;  1TC3 C;  3F0C A;  4HAM A;  1UAA A;  2OQG A;  2R7S A;  1B8I B;  2FF4 A;  3HUG A;  2Z2S B;  3JSO A;  2MW8 A;  3BZK A;  4EM0 B;  1Z91 A;  2EFO A;  1SFK A;  4IRG A;  4F7Z A;  1XMX A;  1BIB A;  2K4B A;  3Q9V A;  3FM3 A;  4XLC A;  1R1T A;  4L9V A;  1IV6 A;  5H6R A;  5ILU A;  5L3F A;  2UUZ A;  2DA2 A;  4S05 A;  5HS9 A;  2ZXI A;  1FSH A;  3CC7 I;  4IJA A;  2JQ7 A;  4QPQ A;  3TGN A;  4YII A;  1D0X A;  3OR1 C;  3REO A;  1WI9 A;  3DBH B;  4RB0 A;  3DEU A;  3RPQ A;  5F1R A;  1BC8 C;  2QEN A;  3KEQ A;  1U8R A;  1BL0 A;  1GUU A;  4GYG A;  1PVE A;  2Y9Z A;  2Q1Z B;  2XAG A;  3KEO A;  4JOM A;  4EEF G;  1PUE E;  1A31 A;  2K86 A;  1K4S A;  3I4M J;  1D8J A;  3BT9 A;  4PGG A;  2BY0 A;  2XIG A;  4WF2 A;  2LNB A;  3V42 A;  1T95 A;  4JBA A;  5CVI A;  5EEA A;  1ZAO A;  2G7H A;  1K79 A;  5J3L A;  4H0E A;  3HSR A;  2GLO A;  3M4O J;  3BDD A;  1OR7 C;  1HBX G;  2YUS A;  3CCV I;  1JKO C;  5EGO B;  2LP0 A;  1LDD A;  2L9R A;  2OZ6 A;  1OYW A;  5F0C A;  2O5R A;  3UNG C;  4I7H A;  2P5L C;  3BJA A;  2MLK A;  3RKY A;  4BHC A;  4AVP A;  2IS4 A;  1KQ8 A;  4G7Z F;  1PJR A;  4KIC A;  3D0S A;  1P4A A;  3BPV A;  1YLF A;  2CUJ A;  3G1L A;  1N78 A;  2G7U A;  2OCE A;  3QP6 A;  1ODD A;  2D45 A;  2M3A A;  3K4B A;  3CTA A;  2MAB A;  2VBX A;  2P6T A;  4D1Q A;  1RUO A;  1X1C A;  1BOB A;  5EG0 B;  4DYQ A;  3IAS 2;  1TNS A;  1MND A;  1XGN A;  4FE7 A;  4RLQ A;  4ZYE A;  5GTH C;  3JRC A;  5GP9 A;  2ELK A;  5D4S A;  4GCV A;  4AC0 A;  2DMU A;  2HYJ A;  3O8H A;  3E5X A;  3DBR B;  1WRJ A;  3U9G A;  5HOD A;  3PUB A;  2WY8 Q;  2DYR H;  2K9N A;  2R7V A;  2M30 A;  2W82 A;  4E7L A;  1DGR M;  2NVT J;  4ZYG A;  4BQN A;  2P7V B;  1P4W A;  2O6G E;  2Q2E B;  3LFU A;  1MBE A;  1EKE A;  5JHU A;  3PO2 J;  4X6A J;  2Z3Y A;  2LLK A;  1OCP A;  5ICC A;  3MEX A;  1FC3 A;  4O3M A;  3DTK A;  3N05 A;  4LLL A;  1OQY A;  2KIM A;  5HNF A;  3QRF F;  2R7Z J;  3JTH A;  1OJL A;  1S9H A;  3OYG A;  2EZL A;  1LKX A;  3DEE A;  2FRH A;  3TOB A;  3VWB A;  2NVY J;  4ZYD A;  4G6D A;  1VQ8 I;  1WH5 A;  4N4O B;  4AIK A;  2LMD A;  5J1Y A;  2KDZ A;  3G71 I;  5LRS A;  3HOW J;  4DW6 A;  4IVN A;  3VOE A;  4E6K G;  3VYT B;  4CCN A;  4EM2 A;  2PLY A;  2V6E A;  3BZC A;  2XUB A;  4KJZ A;  4CGZ A;  4PJM A;  1IRZ A;  2DDA A;  4NDL A;  4BYY A;  4F91 B;  1XSD A;  3F9K A;  4FQG A;  2V4J C;  4LLN A;  3I59 B;  4M9S A;  3K9T A;  5HOO A;  3ZOB A;  3SZP A;  1TP4 A;  4R1H A;  1DDN A;  2A6H F;  5HDG A;  2QA4 I;  4NHJ A;  5GPA A;  1UHM A;  4QLC U;  3P5J A;  1T38 A;  3BJ6 A;  3I4N J;  1AOY A;  3LSH A;  1MMA A;  2X85 A;  3CES A;  3LST A;  1B9N A;  3E97 A;  1R00 A;  2H1K A;  1Y0N A;  3PNV A;  2OJE D;  1WHU A;  3NAU A;  2ISZ A;  2BBY A;  4UUT A;  5J40 A;  3HKZ A;  3WU0 A;  3ZMT A;  4NC6 A;  4XLF A;  2EPF A;  3TP0 A;  2H09 A;  2GWR A;  2BV6 A;  1MMD A;  2PI0 A;  3OYM A;  2DDB A;  5K7Z A;  5BPD A;  3RYR A;  2OF7 A;  2LYC A;  3KZY A;  1QPI A;  1WFX A;  4RB2 C;  1UHS A;  1O57 A;  4HF0 A;  3V7R A;  5E3M A;  2DA4 A;  2M1B A;  2UV1 A;  3CJR B;  2XGX A;  4FT8 A;  2DMN A;  2AHQ A;  1D3Y A;  3JRG A;  5F08 A;  2EWN A;  4MFE A;  2V6C A;  2QSF X;  1EA3 A;  2E1C A;  2KFD A;  4ASN A;  2WC2 A;  2JVG A;  5DD8 A;  1ON2 A;  1R5I D;  4XIC A;  4EGY A;  4BDZ A;  4E70 A;  3BG3 A;  3D5L A;  3EUH A;  4PZJ A;  3M07 A;  2CV2 A;  4I01 A;  1BJA A;  2O0Y A;  3S16 J;  2HOT A;  1X3Z B;  4ZZL A;  4LJZ F;  3V8K A;  2GA1 A;  3F22 A;  2GXA A;  2EB7 A;  2WB1 A;  3BJO A;  3FWE A;  1D1A A;  3Q3S A;  2IJL A;  1TW3 A;  4MIM A;  2XDV A;  2WAF A;  3CP2 A;  1APL C;  1QA6 A;  1RNL A;  4BAC A;  2FJ1 A;  3EUA A;  3MMY B;  1WSU A;  4IOA F;  3S2W A;  4A3I J;  2O03 A;  2DOD A;  4MQV A;  2HZD A;  2DFE A;  1FJL A;  3AG3 H;  3LSI A;  3B02 A;  1MMN A;  2WBM A;  3TQN A;  3BWG A;  3CUQ C;  3AFH A;  2NS7 A;  1KA8 A;  1ZN2 A;  1JT0 A;  5L3B A;  5M3M J;  4TV7 A;  3HZJ A;  4IHT A;  4CZC A;  3EYY A;  2W85 A;  1AWC A;  3AG4 H;  1MBH A;  3OS0 A; 
#chains in the Genus database with same CATH homology
 2Z16 A;  4ZDP A;  4CCJ A;  1X4O A;  3SEQ A;  1Z7L A;  3EUK L;  3K4N A;  4XMY A;  4E4H A;  4AYB A;  4P5O A;  2IS2 A;  1U0J A;  3E0J B;  4PSW A;  2R7X A;  2P0W A;  2CV0 A;  3DWL E;  4IKF A;  1V5E A;  4BE0 A;  4PSX A;  3OR2 C;  4BDY A;  2PJR B;  3ZXS A;  2W4S A;  2HU9 A;  3L2V A;  3FBN B;  4E7J A;  1YX5 A;  4B44 A;  4E7H A;  5FRN A;  4RMN A;  4BJ6 C;  1MMG A;  3K4M A;  4XN3 A;  3OYB A;  3DLA A;  4ZTJ A;  4HEA 2;  4JQF A;  2JVH A;  4DGW B;  5CPR B;  3CMM A;  4XOT A;  4HSR A;  2E60 A;  2L9S A;  2MC4 A;  2MFZ A;  1YX3 A;  1OLT A;  4XLA A;  2L7K A;  3LL7 A;  3L2R A;  3FDY A;  3EPZ A;  3PSF A;  2HVQ A;  3AL0 B;  2VKD A;  4BJT A;  3MKW B;  3OWT A;  3K10 A;  1QU3 A;  3PFY A;  3DKX A;  2OV7 A;  4CCO A;  2LY1 A;  1G8X A;  4AVZ A;  2VJJ A;  3A1Y A;  4B43 A;  2M0M A;  1WJC A;  1N77 A;  1UEL B;  1Y6I A;  3H35 A;  4C2T A;  4KIS A;  1X1D A;  3S3M A;  3PNT A;  1AA7 A;  2MD0 A;  3A4C A;  4YEL A;  1TT0 A;  2LY2 A;  2L5Q A;  1GLN A;  2BW3 A;  5KHD A;  2BVM A;  2K3P A;  3SYT A;  2XSJ C;  3FKJ A;  1D1C A;  3D5R C;  2VJI A;  4RM3 A;  2GOM A;  3OYA A;  4N4N B;  1YE9 A;  4OWR B;  3H9G A;  3DQV C;  4YRV A;  2IS1 A;  3OOU A;  1J09 A;  3DKY A;  1ERD A;  4DJA A;  1WJA A;  1NG6 A;  2KRC A;  4H4K C;  4BU2 A;  4CH7 A;  2AQE A;  2V1N A;  4HPQ A;  2F5V A;  4F52 A;  4CCL A;  2F6C A;  2HNH A;  2CW8 A;  1W36 D;  2CS3 A;  4X0G A;  1MNE A;  1LFP A;  2R7Q A;  5TGT A;  3VYS B;  4ZDO A;  4FET A;  2HQA A;  2IGK A;  1D0Y A;  2OC6 A;  2CH0 A;  5KNL A;  4CA0 A;  5KCM A;  5LD2 C;  4HG2 A;  2OUM A;  3IUO A;  3KYL A;  2M7B A;  2R4G A;  5HVQ C;  3HG9 A;  4BS9 A;  3H5N A;  3QOD A;  3RQ4 A;  3RCO A;  3K70 C;  2V9K A;  2UWM A;  2HVS A;  4IZZ A;  4XKC A;  3TL4 X;  1LVK A;  2HPI A;  2K9L A;  2X1E A;  2XF5 A;  2VKH A;  3DTI A;  4BUP A;  3VYU B;  3ZRG A;  4D9J A;  3TBI A;  3BLY A;  3H9J A;  4HNT A;  2WAQ A;  4DOZ A;  2IGN A;  3LSM A;  4C9Y A;  4GRI A;  2LG4 A;  3S32 A;  1X1B A;  4CCM A;  3OYD A;  1X4P A;  3M1C A;  1Z3Y A;  4PJN A;  1QHH D;  2BVL A;  3OL3 A;  2KRH A;  2ELJ A;  3ZCO A;  2IS6 A;  2LBF A;  4Y3O A;  4LIT A;  4E7I A;  1KON A;  2BW3 B;  3KEY A;  4OAY A;  2DJI A;  1LDK B;  3LSG A;  2RNG A;  3BCB A;  2JUG A;  2KMU A;  3G2B A;  4U7B A;  4PJL A;  1T0F C;  3RTR A;  4HNU A;  5CQG A;  3PNY A;  3DPL C;  4ZJZ A;  3QOE A;  1E0E A;  4XR6 A;  4Y4R A;  4YEJ A;  2VQH A;  3HOS A;  3MKY B;  2L9N A;  1X19 A;  2VXZ A;  3DPU A;  3MD2 A;  2KDO A;  2WAD A;  2FUG 2;  3IP4 B;  4PFO A;  3VSK A;  3DU6 A;  4B48 A;  3W2W A;  3H5R A;  3DU5 A;  3A2K A;  2X1C A;  3K4L A;  3BCA A;  3OYE A;  4NC8 A;  1QHG A;  2K5C A;  4BQO A;  2RQQ A;  1P9Q C;  2X1D A;  1DQU A;  3I9V 2;  3KX2 A;  4RLF A;  4ZC3 A;  4EAT A;  4E7S A;  2BOL A;  2R7U A;  4KT6 A;  3BG7 A;  4C30 A;  3GBG A;  4OAZ A;  4XOR A;  4ZYA A;  2CW7 A;  4BE1 A;  2KPM A;  5LFA A;  1WJE A;  1N75 A;  2VXD A;  4C2U A;  3OYJ A;  2HDW A;  3SZG A;  1UAA A;  2R7S A;  2R7T A;  1WJF A;  1Z21 A;  2KZV A;  1V5F A;  2Z2S B;  2KL4 A;  3D5S C;  1SFK A;  3S8P A;  4KIT B;  3HOT A;  2KLO A;  3M8J A;  2XC7 A;  2E1M B;  4XLC A;  3HPG A;  2UUZ A;  4R79 A;  2I8D A;  2VQL A;  2LBF B;  2QKM B;  2ZXI A;  3AKZ A;  2LH9 A;  4F55 A;  3PSI A;  3W2V A;  4NUB A;  1D0Z A;  2V26 A;  2LRD A;  4QPQ A;  2CMP A;  4LG3 A;  1D0X A;  3OR1 C;  2Z1D A;  1BR4 A;  2RRE A;  1ZEL A;  1JI8 A;  2Q1Z B;  4JOM A;  3SDB A;  2W00 A;  2X51 A;  5CKT A;  3NWT A;  4XL9 A;  1W36 C;  4B47 A;  1NG7 A;  3V42 A;  4IQJ A;  3QYF A;  1T95 A;  2VIX A;  2R7W A;  3OS2 A;  2E1M C;  2DOA A;  2K9M A;  3L2W A;  4XKW A;  4DBQ A;  1OR7 C;  3OL4 A;  3H0D A;  5FRM A;  3ZGK A;  4XOP A;  4ANJ A;  2VL8 A;  3E1S A;  4HST A;  4PK4 A;  3ZQQ A;  2O5R A;  3UNG C;  3H9Q A;  3VDX A;  3OY9 A;  3I3L A;  2QKL B;  2IS4 A;  1PJR A;  3MKZ A;  2R7R A;  2M4K A;  3CJQ B;  4HRI A;  4BEH A;  1BR2 A;  2CUJ A;  4PJJ A;  1N78 A;  2PMZ A;  4BQQ A;  1Z3X A;  2M3A A;  3BC8 A;  2F4I A;  3K4B A;  2MAB A;  4Y33 A;  3OYI A;  4DBR A;  4D1Q A;  1X1C A;  1BOB A;  3BG6 A;  3IAS 2;  4G6T B;  2ZFU A;  1MND A;  4RLQ A;  3K4C A;  4PUS A;  4CUG A;  2WAE A;  3VSL A;  1D1B A;  1UG0 A;  3OYF A;  4CSW A;  3QYE A;  3HUG B;  3U21 A;  3PUB A;  2WY8 Q;  3K4K A;  5HLT A;  2R7V A;  2W82 A;  4BGD A;  4E7L A;  1DGR M;  1WJB A;  4BQN A;  4B3X A;  3OYL A;  3K6G A;  4QPO A;  4E7K A;  4BJ5 C;  4DIQ A;  2Q2E B;  3LFU A;  2AQF A;  2MYS A;  4F3Q A;  1R6R A;  4XON A;  4F92 B;  3S3N A;  1WJ5 A;  3OMY A;  3ONQ A;  3DTK A;  3N05 A;  3HPH A;  2HVR A;  2X6X A;  3CF2 A;  4XM3 A;  2VPL A;  3L2U A;  5HNF A;  3FHN A;  1S9H A;  3OS1 A;  2DXI A;  3OYG A;  1LKX A;  3DEE A;  4FAS D;  2M4G A;  3VWB A;  4BL0 B;  1FMV A;  4XKB A;  3DTE A;  3W3C A;  3S93 A;  2Y0S A;  3C2H A;  4N4O B;  4BXF A;  4ZTF A;  3IAM 2;  2VJ5 A;  3PL8 A;  2XAU A;  4J00 A;  2HPM A;  3RPU D;  4E6K G;  3VYT B;  2WA0 A;  2W1O A;  4LIV A;  4CCN A;  2V6E A;  3LSK A;  4KJZ A;  4RM2 A;  4PJM A;  1MW7 A;  4F91 B;  2V7F A;  3F9K A;  1Y56 A;  2V4J C;  2A5W A;  1PYV A;  3TMO A;  3DPT A;  1SAU A;  4IX7 A;  5JHF A;  3OIP A;  4XLE A;  2E5Z A;  2X6W A;  5HOO A;  1VZ0 A;  2IGO A;  4BEH B;  1X1A A;  3VYR B;  2VAS A;  2XF7 A;  2KP6 A;  2ZXH A;  2ZSH B;  1DP3 A;  4XNF A;  3LSH A;  3ZR8 X;  3OYK A;  2R7O A;  1MMA A;  2X85 A;  3HL2 A;  3CES A;  2VQG A;  3CP8 A;  1WJD A;  2A6T A;  4LIU A;  1K6Y A;  3PNV A;  4XQF A;  2VQC A;  1V5G A;  3OYH A;  2DT7 B;  3FBI B;  3S3O A;  3HKZ A;  2W7N A;  3PJR A;  1HA8 A;  2LRE A;  2VJ4 A;  3EUH C;  1TZL A;  4XLF A;  3OYC A;  3NWS A;  1MMD A;  3OYM A;  4J01 A;  3K4J A;  4NC7 A;  2X6Y A;  3C2G A;  4E7Z A;  2LYC A;  2CUZ A;  1WFX A;  1FMW A;  2XF6 A;  4II3 A;  4ITV A;  5HNH A;  3CJR B;  2UV1 A;  4MLO A;  3AL0 C;  3OYN A;  4NQW B;  2PJR A;  2GOX B;  4P1W A;  2NOJ B;  1EA3 A;  2ZSI B;  2JVG A;  4AU7 A;  2DT6 A;  3H5A A;  2CFO A;  4BDZ A;  3D5L A;  2LOO A;  3OIQ A;  2IXS A;  2CV2 A;  1G59 A;  4PFP A;  2JA2 A;  4NNJ A;  3K70 D;  2DCE A;  3L2Q A;  4ZDL A;  4CCK A;  3HXL A;  3HC7 A;  4XKV A;  2VB6 A;  2WB1 A;  2WY7 Q;  1D1A A;  4II2 A;  4BE2 A;  4U87 A;  3UR3 C;  3CZ6 A;  3LMM A;  3W2A A;  2XDV A;  2WAF A;  5FRO A;  3CP2 A;  5CQE A;  4BAC A;  3EUA A;  3MMY B;  3RSN A;  2IGM A;  1DGW Y;  3J7A Y;  2KQR A;  2HZD A;  2E5N A;  4XLH A;  2LC2 A;  2JSP A;  3LSI A;  2L2O A;  1MMN A;  2WBM A;  2KHM A;  1BR1 A;  3AFH A;  1IRX A;  4IQ4 A;  3QYB A;  2VLA A;  2M7A A;  2CV1 A;  4CZC A;  4XN0 A;  3SEZ A;  4F93 B;  3OS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...