2KL8A

Solution nmr structure of de novo designed ferredoxin-like fold protein, northeast structural genomics consortium target or15
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
MEMDIRFRGDDLEAFEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles for designing ideal protein structures.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords OR15
total genus 20
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2kl8A00
5LMNJ 1I94J 3JAMU 2MEWA 4NXNJ 5IT9U 2E5LJ 4LF4J 4JI4J 2UU9J 4DR4J 3J80U 1HNXJ 4OX9J 3J7AN 4X64J 4DV5J 5LMUJ 1N33J 4DV6J 4DR6J 2UUBJ 1HNWJ 4LF5J 4DV3J 4K0KJ 2VQFJ 3J81U 4DUYJ 1N32J 4DR5J 4KHPJ 2MQ8A 5BR8J 4GKKJ 4LFCJ 2UUAJ 4JV5J 4DV1J 4JI5J 4DV0J 3R2CJ 4LFBJ 4X62J 4DUZJ 3T1HJ 4LFAJ 4NEZA 2KVQE 4V1Ak 4DV4J 4AQYJ 4YHHJ 1N34J 1XNQJ 4KY3A 4YY3J 4B3RJ 3W1YC 1IBKJ 1XNRJ 2F4VJ 4B3TJ 1XMQJ 2ZM6J 4RJVA 5AJ3J 4DV2J 1IBMJ 4PWWA 4DR3J 4LF9J 3T1YJ 4X65J 4JI1J 2VQEJ 4NXMJ 4JI0J 4DR7J 1FJGJ 4X66J 2HHHJ 3IMQJ 5IWAJ 4NEYA 4LF8J 5FLXU 5LM7E 4JYAJ 4JI7J 2UUCJ 4JI6J 3R2DJ 3D3CJ 5A2QU 1IBLJ 2KL8A 4DR1J 1HR0J 1HNZJ 2MTLA 2UXBJ 4B3SJ 3D3BJ 1J5EJ 4JI8J 4HHUA 4LF7J 1XMOJ 2UXCJ 4KYZA 4JI3J 3OTOJ 4B3MJ 1N36J 2UXDJ 4DV7J 4JI2J 4DR2J 4GKJJ 4LF6J
chains in the Genus database with same CATH superfamily
1U0HA 1N34F 4F25A 1H7XA 1Q0NA 2JL9A 1WG1A 2YKOA 3O1LA 4OZ0A 4W4MA 1QTNB 2W2QP 4MAKA 4DBQA 2APOA 2UVRA 3HHLA 1HNIA 5KFQA 1S76D 2XYGB 3PIOQ 1S9GA 1L5UA 3TEHB 4BHQA 1NKBA 4PXDA 4WZQA 2RDIA 1NHVA 3Q24A 3PTWA 4MKBA 2ZEJA 4RO0A 3FZBA 2NQPA 1LW0B 3OUYB 4AL7A 1OYEA 2Y8WA 4OX9F 2B56A 3DDNA 4OIXA 2XMJA 1F5CA 1VGYA 3IWLA 1HD1A 3SSQA 4PUOA 3QPIA 4IQMA 4DR4J 1YJWS 2KFZA 1VCTA 4A8WA 1TAUA 1X4GA 2HYIB 1RWNB 2U2FA 1Q4RA 5BR8F 5ETRA 5IC4B 5L46A 2C2NA 3QGIA 2BJDA 2IRYA 1HBMA 4NPOA 6AT1B 4ECYA 3IN5A 1JXEA 2I38A 3W2WA 2K7JA 2QL9B 5KFXA 5DETA 3TVKA 2MZJA 1S7IA 2VG5B 1AUDA 1MMLA 1S1VB 1IBMF 2BKPA 2E9RX 4O4GA 4CH1A 1S99A 3ENVA 3K5OA 1L3VA 4LQ9A 3J81U 3BH6B 3N9UC 4QOTA 1VQ5S 5LMUF 1ZA2B 4FVMA 3ZZ0A 3MEEB 4DN9A 2UUCF 3RRGA 2YPZA 5EWFA 1RTDA 3MTKA 1EQ0A 1FT8A 4IO9Q 1F1BB 1RU2A 2QA2A 3H7HB 4DHVA 4C0HA 3MF5A 3Q83A 2CPZA 1C0UA 3LW5C 3LH2S 3QIPA 4NYOA 2W25A 3ENWA 4L73A 3ZFVA 3A13A 4OZ2A 4RR5A 4D3HA 5KFUA 2QLFB 3P3DA 3NP5A 3EE3A 4M1KA 3T1HJ 3HHDA 1LNQA 1WC6A 2CQHA 1KWMA 2ZVSA 4WYLA 4CNYA 2MQPA 4JI5F 4DSKA 2E44A 5IOLA 3PYEA 4PWDB 2AZ1A 2BJ3A 2IVMA 2V2QA 3M05A 4P7VA 3AD7C 5LMNF 1WTBA 1BWEA 2ZDPA 2AGPA 3EGVA 3PM9A 5LOQA 4YB5A 2FJAB 2DCUB 2QLBB 1U8WA 3DOMB 1UFLA 4W98A 4AL5A 2ZE2B 3M8PA 4AXIA 2VHGA 1DZ5A 2OTJS 1NJZA 3RBZA 2B0GA 3DRSA 3EXYA 4X4QA 3QT8A 3GSIA 1WSRA 4CI0B 4DL7A 2G2ZA 2JLEA 1H2VZ 1NK7A 3QJPA 1X31C 3LAKA 2F63A 3GJQB 4IH6A 3G6YA 2M52A 2OELA 1NJXA 1X5SA 3OPKA 3RAXA 2Z4PA 2QO3A 1DAXA 4F4AA 5E7OB 3IRXB 4A8SA 2BQRA 2RSQA 1EP4A 4ER8A 4O4GB 3DLKA 2XYPB 1XEZA 1L3KA 3HMJG 3BGUA 4R8UA 3ETOA 1WC1A 3RR8A 5AE3A 3IS9B 4LQ3A 2VBXA 3WZ0A 3D3CJ 1DBDA 4Q2LA 2NXJA 4OJ1A 4OI2A 4OX8A 3DYAA 2KL8A 1QDUB 3CJKB 3OR2B 3TO8A 3Q8YA 2IM1A 2UV8G 3NGTA 3IWXA 2GS8A 2C2RA 4IUFA 4DR7F 2UXBJ 2D74B 2MGZA 3IRWP 4FKXA 2L48A 3D1HA 1ZM2A 4MYTA 4UZCA 4F04B 4X4PA 1RADB 1NLKL 2MMYA 2PE8A 2XZTB 1WC0A 2F5GA 2VASA 4DFKA 1Q95G 2XMVA 2FJEB 3LA0A 1DTQA 4UOHA 5JJBA 1ZYQA 2K8GA 2CQPA 2RAQA 1J5OB 4B9VA 5A8RA 1BGXT 1QM9A 1D9FA 2IMOA 2K7KA 1Y10A 2AEFA 1BLUA 2N3OA 2XGQA 3HKZD 1OSDA 1Q7YT 1HBUB 4LF1A 4USTA 3GLJA 3A4TA 1U1KA 2LQ8A 1TELA 2HQDA 4BWMA 4L76A 2G0CA 2VG6A 3SZ2A 3H59A 3N4WA 3BQ2A 3WX4A 2J8SA 1LKZA 3TW0A 2E1AA 1J27A 4AXJA 1Z2LA 3AD8C 1JLEA 2XCAA 4CH0S 1C1CB 1N88A 1GMWD 5GAGU 2QV6A 3FJ2A 1QAXA 2WW4A 3K89A 4ID8A 4FF4A 4LRFA 2XY5A 1RT4B 5L1IA 3DI6B 1H98A 5KFOA 1N0VC 3S01A 3ET6A 4A47A 3M9NB 1WHYA 2HGNA 1UEUA 2N4CA 4R5PB 4EYIB 2C3PA 5I42A 3QRPA 2MKCA 5FD1A 2NR0A 1IBCB 4RW6A 2G0IA 1TUWA 4URQU 2PEHA 1ZM9A 3CDBA 1S6QB 4D3GA 1FXRA 3B54A 3KUGA 4ZVTB 5EDWA 4M95A 3NXZA 4DQRA 2JFDA 2FUG9 3MM9B 2NREA 4MK9A 3QQCD 3QYYA 4LBIA 4WE1A 3V6DB 4KO0B 5F41A 3PEJA 3DRXA 1RKIA 2MQ8A 4LUBA 2H5EA 1T3NA 2OAUA 2HW3A 5GMEA 1R0CB 1S49A 1ULRA 3OFEA 2NYIA 2PIIA 4DPYA 4MK8A 5CAAA 3VAGA 1RAGB 1SJQA 2HS4A 4GO7X 2HVIA 1N5YB 3EXCX 2KVIA 3UNGC 1SJ1A 3NAIA 1TUGB 1HBUA 1U0SA 3QMQA 4FYVB 4IG0B 1B4SA 1N5QA 2WB1D 4KQZA 4LBHA 4OI6A 4UZBA 2IDLA 2V34A 2YNGB 3DOKB 2F4FA 4DSLA 1HHQA 2J8AA 2QTWA 2OMLA 1S9GB 2XMKA 1UFKA 4C7QA 2BM0A 5KT6A 4NEZA 2BUNA 3AB2B 3DMJB 4WYWA 2ZM6F 1Y3KA 1FRMA 3LGHA 5J1PA 4QU6A 4BC7A 4YY3J 5K14B 5M2RA 3UPFA 5ITHA 3BN7A 2RH3A 3L7PA 3VZHA 3C2PA 3GFHA 5DDOC 3KLEB 2VH7A 2N4DA 2OHDA 1TKTB 4I2QA 5J2NB 2R3VA 4OZJA 1TVRA 4PWWA 3LQVA 5F8IA 3A3NB 2CQ2A 2E5GA 2IFXA 2V4JB 4WE1B 5E33A 1WWHA 2R8IA 4X4OA 3VAJA 4JI0J 2M9KA 3HZGA 1FNMA 3R27A 2IY5B 2YQ0A 4FF3A 2DGSA 1QE1A 3W5ZA 1FRIA 2C3MA 2D3UA 4P2MA 3TR5A 1HQUB 3ZXWA 1RBOB 3D67A 1NNDA 2XMWA 2Y1RI 4N41A 1UVLA 3TVZA 4JI7J 2ZNZA 3EWGA 1M5PC 2CNOB 1R6VA 4FS1A 2AEJA 1IKYB 1I3OB 2H9ZA 4WXWA 4XK8C 3QIDA 1UAWA 3BSAA 1GAOA 1MSWD 2VFSA 3UD4P 3QT6A 4WP3A 2QA4S 1S9EA 2EVZA 2HSEB 1SH3A 4NLRA 1M5KC 2RDDA 2MTLA 3HD1A 4K50A 2ZH9A 4EK2A 3C16A 3C15A 1T03B 3BO2A 2DHGA 2F65A 1YGYA 2OPRA 4M63A 2U1AA 4IG0A 4OYWA 3A8IA 1T9XA 2R4FA 2HMIA 1Q53A 4ZVGA 1YZ7A 3R5DA 1H74A 2OGUA 1NM2A 3T41A 5HMZA 4TQSA 1KLNA 4OV1A 4K5SA 3PRVA 1U47A 3OTDA 2XWXA 1UL3A 1TVRB 2JWNA 3I87A 1QVGR 5K14A 4J9NA 2FLOA 3IM9A 1XNRF 3IM8A 4ZVEA 5FDLA 4JI2J 1P1LA 3VTIA 3D6TB 3K5LA 1K8AT 7FD1A 5DDPC 2CJBA 4AUKA 3D0GE 4OYBA 3MMJA 1IJFB 2WCXA 4P2XA 5CH7B 4PKDB 1NKEA 4A4JA 2W2NP 3R7NB 4ED1A 2R7VA 1VIXA 2CWXA 2HRYA 2RU3A 1Y5LB 4DFPA 1WG4A 1NB2A 2W2MP 3V4IA 3GYNA 1BUXA 1FI4A 1MWQA 5CHCB 2FLNA 4OHVA 4RLEA 3CNQP 4JI4J 5IZHA 3FZ2A 4M5NA 2MZ1A 1FWPA 2KHCA 3HVAA 2M7SA 3MCMA 4FYYB 4S0MA 3OXGA 4K4XA 1REGX 5I42B 1R31A 4OX9J 2D1CA 4ZDNA 1U1LA 5EWGA 3QO9B 2QT7A 3GZ7A 3IAS9 1RAEB 4PYAA 1CQMA 1X4EA 1WEXA 3SYZA 2HMIB 4KHMA 3QZ7A 4F2SA 2LYVA 4CNZA 4ILLA 1HNZF 2PC6A 2UVWA 2V8VA 2EK1A 2YTCA 3W9JA 2BXJA 1P6TA 5J2QB 1LWFB 3F41A 2IHR1 4F7VA 1PBUA 3PHTA 4DL6A 3FQKA 2R8JA 4KPCA 1Q8IA 4PR6A 2DB1A 3FEYB 1V3SA 1RI7A 3FFIA 1NJYA 1DQ9A 3K59A 4EBDA 2HQIA 3UWTA 2PD1A 1NO8A 3MECA 3RB0A 4FF1A 2W4CA 1K0TA 3DFEA 2CVIA 1NK0A 3D9BA 3QGPA 2V8DA 5GMDA 2WONB 5KFAA 3NGUA 2Q6BA 3MEGB 5LXRA 4G1IA 2YX4A 4Z7CA 4B9TA 4ALZA 4JYAF 1X4AA 2YWFA 3MMAA 4LBPA 4O23A 2QLJB 4EEYA 2RDJA 4HH1A 2KXFA 3CIZA 2W24A 4NLDA 1H0HB 2OI2A 4USHA 1RTHB 1UMJA 3MM8A 4HLBA 2B9EA 3ADAC 2AP6A 3EVOA 4KY3A 2ZWOA 2VQFF 3GIMA 5T41A 4Y2MA 2G2YA 2MZTA 4FF2A 1A6LA 5EN1A 4DN0A 1LK5A 3BKUA 3NLCA 1K9MT 2FLLA 5A0YA 3UW1A 2DIUA 1IKVA 4NCGB 4QIGA 2QMWA 5KG0A 3ZZRA 2QFJA 3M8ZA 1AB8A 2ZUGA 4F0KA 8RUCA 3KK3B 4DR3J 2A6OA 1JLQA 5BXIA 3VZIA 1KSPA 1RWVB 1S12A 2VFVA 3BO4A 1Y5NB 4TLQA 3KYLA 2MKKA 2AJQA 1WORA 2EXUA 2MQQA 2HHHJ 1MWZA 2MYFA 3LP2B 1M5OC 1S7HA 4RNMA 2P2CB 1RT4A 1YVFA 4NRTA 5IWAJ 4F50A 2A2DA 1LWFA 2KFNA 4LSZB 3DHXA 3HFVA 1YJTA 2B7BB 2V2KA 2RS8A 1KLMA 3JSYA 4KGVB 3W8PA 1N54B 4I64A 2WSCC 3AD9C 1RU1A 1WF0A 2G13A 1ELOA 1CJVB 2PFDA 1NH8A 1UW9A 3LPEA 3M1VA 3GR0A 5KG3A 3ZZZA 2LQBA 5GADU 2LLZA 3DRYA 3R5GA 1KNZA 4QYZJ 2C3YA 4U7UK 3GIIA 3C66A 3HI9A 2BKNA 4QWCA 5IWAF 3R7BB 4LSLA 5C25A 3N6MA 4Y28C 4NLUA 1AFJA 1HA1A 3GIKA 2RRAA 4HACB 4DV0F 3WIVA 1IKWB 3M4XA 3PCOB 3RGIA 4F36A 4PABA 3RR7A 2VQEF 2WRMA 4FXWA 1FFGB 1X0FA 2BJ8A 3K0JA 3K2YA 5HANA 4ANEA 4KHRA 1NCLA 2EG1A 2DITA 3MOJB 3DLJA 2UUTA 5CD4A 3KK3A 4ED8A 2YH1A 5ETSA 2JC1A 3IG1A 2V2ZA 4BWJA 1D9DA 1RXOB 2OEKA 1TKZA 2CQGA 4MKAA 2GGPB 1BMQB 2OIHA 4GKJJ 5DRKA 3HHLD 2PDAA 4XTTA 2B7CB 4A48A 3F44A 3RTVA 3TAPA 1VLYA 4DEZA 4I68A 3MURP 4J9PA 1JKHB 1KC8T 4ZJLA 2F8MA 3VQTA 4AT1B 4X62F 2EW9A 2YXLA 2ZFHA 4W90B 2RJZA 3R6GB 1FXLA 1LOUA 2O3DA 4OI3A 4TLRA 5A6PA 2G0JA 3CCLS 1A9NB 2UU9J 2W8KA 1FDNA 1UKUA 2GQQA 2X3GA 2HRTA 2W8LA 2GAGC 3W2VB 5EWEA 3GG1A 3MPUB 5BYQA 5CXTA 1NHKL 1BHNA 4LSLB 1UETA 3O8WA 3QLHB 5C25B 1S10A 1KRPA 1FJCA 5F8MA 3M2RB 2FHOB 3HX9A 4O3QA 1N32F 3MR3A 4CIOA 4EO8A 2DO4A 1F2HA 2E5LF 4ZMMA 1R43A 2IAJB 3OT9A 3MXHP 3DDKA 1LQ9A 1JLFA 5A8KA 4DR1F 1FXDA 1SIWB 3VR1A 5DQGA 4QR1A 2VBYA 4ID5A 4K5RA 4NMXA 4WIQA 4EZ9A 1SJ3P 2IIHA 3U1MA 2CNNB 1VIOA 3HULA 2CNKB 3BPSP 2RD5C 3EUNA 4PPZA 2VFUA 4A8YA 4M8LA 2ZH1A 3PX6A 4B3RF 4DV1J 2DGVA 2W4PA 1TR0A 1SVDA 3HHLB 5F3ZA 2O5DA 2CXEA 1GT8A 5B09A 3DRRA 2DR9A 1FE0A 1T05B 1M5VC 1XIQA 1FX2A 1FNXH 2O1PA 4DV3F 1LW0A 3OUYA 3OR1A 5EUHA 3MEDB 3VGTA 2DNPA 3TZWA 4C0OC 2XY7A 2AYBA 2DPIA 3BGRB 1UZHA 1MWYA 1T9WA 4LFAJ 4F67A 1NUEA 4WK1A 3T19A 4DPXA 2XEXA 5AE1A 4YHHJ 4PQAA 1RQ0A 2CJQA 5M2UA 3J7Z5 4B3RJ 4RPFA 1X0PA 3GONA 5DM6Q 2YY3A 4AE5A 1MW7A 1HD0A 5AJ3J 2W9AA 3BGFA 3W2VA 3TQ1A 3MM5A 2ZH5A 4ZCMA 4RNNA 4YOEA 3LGMA 2V6AA 3QWUA 3SSRA 5CD4H 2CJ9A 2YWHA 3PW2A 1ZAVA 2LEPA 1AUSL 3E01B 3TP2A 2RUGA 5KOWA 4ANCA 5F8HA 1REVB 3SFGA 3FSIA 4NXMF 1HHSA 1FJGJ 1Y9OA 1I51B 4DX5A 2J7UA 2MKYA 4CO3A 2AYEA 5J2QA 1VQOS 1MG7A 1ICEB 3B8HA 3SI8A 2BV3A 4CWBA 5KG4A 1KQKA 1YITS 2DXEA 1S0OA 4WF9Q 2NXNA 4ANDA 2RNEA 2A0FB 4ZCKA 1NAQA 3MEEA 4NI2A 3HM9A 4NXNF 3DHWC 5F8NA 1CJKB 3MEKA 1XMBA 2P9EA 2GAHC 5ETVA 4H4OA 1NDPA 3ET6B 3RB3A 2BDPA 2ZVIA 2CPIA 2ZBCA 3QT7A 3NNHA 2YPYA 4B08A 3KLHA 2CPYA 3M32A 3D6HB 2BR0A 3H5XA 3MOZA 4USMA 3BJYA 2KG1A 2JDJA 5KFFA 2KG0A 3H4DA 3G86A 1RSCA 4DL2A 3SFUA 2B6AB 1YZ6A 3ILJA 3MR2A 1VISA 1AXQA 1SBRA 3G6VA 4JI3J 1TFWA 4PWDA 3HLUA 4LR8A 2M3DA 2RQCA 3BBBA 2HVEA 1S1XA 4OZ3A 5B0AA 1VJQA 2B5JB 2DGXA 3F73A 3JB9k 4KHPF 4GVBB 4Y00A 4OYAA 2IRUA 2FJXA 2UUWA 1F2GA 1GEHA 1VRQC 2M88A 3H98A 2D3OR 1L3UA 1QAJA 2R7QA 1Y5IB 2K06A 3DRSB 5KFYA 4R0EA 4ZPCA 3UR3C 3MUMP 2AX1A 2HVHA 1ROFA 3MUVP 4WU2A 4FNHA 1ZAWA 3W63A 2ZHAA 2JNJA 4ZCIA 1Y11A 3M8SA 4U7UD 5HMXA 3MUTP 4C97A 1U4BA 1U24A 3GSDA 5D0RA 5J1EB 4X64F 1VC0A 4G1QA 1B0VA 3TJ9A 1QLNA 5H9EJ 3PNIA 4KBIA 1QSSA 4L3KA 5A0YB 3I56S 2NLWA 1D0EA 3ENAA 1VOMA 1KLMB 1RT7A 2YNIA 3EZUA 5F0WA 2V4QA 4XPEA 1M0SA 2G4BA 1ZA1B 3M2VA 2QIFA 4NI2B 2CJAA 3GYXB 4TY8B 4C3KA 6FD1A 2WK4A 5HJYA 3CDAA 4NLOA 3V2UC 1U1RA 2FTRA 4PG8A 1UCNA 1BWVA 2XSJA 8AT1B 1PKUA 3IR7B 1WHWA 3MPYA 3POTA 2E9TA 2IYIA 2JHEA 1JJ2R 1WI6A 3EYZA 3K7RA 3AXKA 1G3OA 1JMTA 2WAQD 3R5AA 1TK0A 1F5AA 2E5HA 5CYJA 4PXEA 3MDFA 1U09A 2ZJPQ 2BBEA 3AA9A 3VQSA 1NJIT 1FDBA 2FHKA 3TWZA 1S1WB 4JI8F 3C6UA 5HO4A 2C3OA 4C3LA 1N52B 5EX0A 2RQKA 4ILRA 2CAJA 3CIMA 3GMGA 3MMCB 2JSXA 3MZIA 2EPIA 4ZPVR 1X9WA 5RUBA 2X7IA 3FQLA 2L9WA 1YQHA 3M8WA 3KHHA 4WFBQ 1Y00A 5J2PB 1JLEB 4DL0C 3D0HE 4BS2A 1RLCL 3H8YA 2A2CA 2ILYA 2GIQA 1WOSA 3O5TB 2LVWA 2FJDB 1RUSA 2M2BA 1I6JA 3CPWR 4OHYA 3DN9A 2GMLA 3EDRB 1ZM3A 2OPQB 4B3TJ 1NU4A 2OKQA 5HATA 2MPUA 4WXOA 3KLIA 1R7IA 4CYUA 5CABA 2YWGA 4B9SA 1GMVA 1GXUA 5AXKA 1GTHA 5ETTA 2WB4A 4ED4A 2Z8QA 2RRBA 4NOHA 4DQQA 3IR6B 4IRDA 1UWBA 2F9DA 4MT1A 1CJTB 4ZHRB 2KT2A 2C1EB 5LJ5Y 7FDRA 3GILA 3M6VA 4ZPTR 4NEYA 4DU8A 3MM9A 2FY8A 3PO5A 1YRTA 2FHJA 1URNA 1VQ4S 2XS7A 1IBLF 2ABYA 2AGQA 4O44B 2R7OA 4USWA 2BJ9A 1P1TA 1VJWA 2A18A 3GE9A 1FO1A 3NOCA 1HBMB 1WEZA 3NL0A 3RG6A 5KG1A 4U7CA 1XTZA 2HGLA 4ZVFA 5HVHA 4KJIA 4LJMA 2DNOA 4CM0A 1FJ7A 4CP5A 1WSVA 1RWPB 2OPSB 2H4WB 6FDRA 4PG4A 4DR2F 4OYOA 3QO9A 3ZTPA 4UQTA 2IA0A 3CC4S 1IWAA 3H2UB 4U8VA 3CUNA 3P5TL 2QMUB 2ZD1B 3L95X 2ZKUA 3W64A 2IJRA 3KLIB 2MHEA 4CYUB 2J6SA 3WDOA 1SI9A 4NA3A 4KYZA 2DGOA 1MMDA 2KYXA 1C0TA 3R5BA 3OTOJ 4X4NA 1E6VA 1VHFA 4NA2A 3O44A 5C2GA 2ZBQA 4DS5A 3PZPA 3HHEA 1CJTA 1U2CA 5LT5A 3MMBA 4G65A 5KFBA 1RT3A 2D69A 2ZBRA 3CCVS 5LMNJ 3KMQA 4ZN3A 1VDHA 4J9MA 2AT1B 2C2ZB 3AOBA 1ACMB 1EKSA 1M1GA 1TKXA 2MEWA 4H4KC 4UW2A 1HQUA 2HWIA 1TL7B 4UT4A 4LF9F 2B9YA 2LKZA 2RUSA 2K2PA 4PRFA 2C22A 4OJHA 3CJSA 4F4KA 4O3NA 4ECRA 4RZRA 4JV2A 4Y65A 2D9PA 3CJQA 2L08A 2ZH8A 4I6YA 2A3JA 2AJ0A 3CDUA 4QJVA 4ZA1A 4V19J 3PX4A 2YBVA 1R27B 2UZAA 2CUYA 3R5JB 4LVNP 1FK9A 1WDDA 2LXIA 4P2SA 3J80U 4OFZA 2WVDA 2C2MB 3RAQA 3IGVA 1VBYA 1S1UB 2KH9A 5HVGA 3KFWX 1LV5A 4RU9A 1HWJA 5LMUJ 2DNLA 2E66A 2RE1A 5CZXA 3AH6A 3ILLA 4JV0A 3KK1A 4DUYF 4FXDA 4HYKA 2LA6A 4I2PB 4WWSA 2GQCA 4U9RA 1RZMA 4RW9A 4CLPA 1S9EB 1AZSA 1IM4A 2IC3B 4DR6J 2HHTA 2VKRA 2WOMA 4OI1A 1FDDA 1S0VA 2CKWA 1V9OA 2F40A 4JB8B 3T5JA 2CDRB 3DLKB 3HP6A 3NMRA 1KOOA 2BEFA 1HMVB 2VPYB 3CO0P 4KR0B 5HMWA 3CULA 1XN9A 1RT6A 3ISZA 4H4MA 4WP9A 4PG5A 1RP5A 1CBKA 4LIWA 5BR8J 3VVTA 3V6HA 3FVYA 2AZ3A 1HI1A 3IBFB 3PO4A 1I5OB 4B3OB 3H40A 4USIA 3CSKA 1FVSA 2MZRA 3CWJA 3GJSB 3NGDA 3IAM9 4NLVA 3KJFB 3NNAA 5D3GB 5E3RA 2JJ4D 2EKYA 3M6UA 2ZOGA 4DUZJ 1HPZB 3PFEA 2KT5A 2DGWA 2WZ1A 3JQJA 1W2BR 2UUCJ 1B99A 3ZZYA 2DNMA 1JLBB 5KFPA 1SC3B 3DOLB 2EBEA 3PEHA 5D77A 3VCDA 4CLZA 3M7VA 5FLXY 4AQYJ 2C2DA 3P6YC 3C46A 3UE2A 2XTJP 4JP8A 5E3AA 3KDNA 2VPWB 3BKTA 3OTBA 5F0UA 3ZZOA 4DL5A 2LA4A 4RUHA 1U02A 3OXFA 1N36F 3EICA 4DX7A 1KQSR 2R7SA 3I4PA 2CFXA 3M30B 4A8MP 2B6AA 1S0MA 3VAKA 3RW7A 4PEOA 1SQGA 3CCTA 2NSBA 1RWOB 2UVVA 4X65J 4JI1J 1NPRA 4J5OA 4K4VA 3GP9A 3Q8RB 4HHJA 3OQ2A 4TNOA 4RUAA 4A8KA 1JWWA 2IBKA 3DLGA 1Z4UA 3N5FA 4HL9A 1U6BA 3N0VA 4LF8J 4QIEA 2CPHA 3F0NA 4ILMA 4C2MA 3QSIA 5LM7E 4EGLA 2H4YB 1FTCA 1RBAA 2YNFB 2M8HA 2EFVA 3SDEA 2AF6A 3I5CA 1X8DA 2Q43A 5D3GA 1OY9A 3QGGA 2EC2A 3MM6A 1FFWB 3U1NA 4DOZA 2GIRA 3W60A 2R7WA 1ZPVA 2FGOA 3I0SB 4C6AA 4Z2XA 4F8RA 2WONA 4CT9A 1EHWA 2GO8A 1T0TV 4Z7YA 1E6YA 5KTQA 5L39A 5GAEU 2BOAA 4LF7J 2IAJA 2DR8A 3PKMA 1UFWA 1WG5A 4M5DB 2L41A 3KWMA 3OFHA 1GXLA 4M5JA 1S1TA 5ETLA 1Z2ZA 3Q2TC 4N47A 4ZLLA 2RQMA 3NNCA 2YNHB 3CJ2A 3GV7B 1RA6A 2PGCA 3T6BA 4L6V3 1PAUB 3UR0A 1VQ9S 5KFRA 2VJUA 1N36J 3EVWA 4DV7J 4C98A 2QGFB 3TUPA 2G1HA 4ZVSB 3KMSA 2GMJA 2HK2A 4Y34A 1S6UA 1TUVA 2AW0A 3K5PA 4RW8B 4Y3CA 4AQYF 2KRRA 1LWXA 2ZDOA 5KG5A 1RWKB 3AT1B 4QWAA 4ED2A 4YP3A 3DKDA 4N56A 5IT9U 4GVLA 2I9SA 4XIUA 2E9ZA 1UPMB 1XJWB 2BVZA 4QQBA 4JI6F 4ZHRA 5I3UB 2JLGA 3OV7A 3MEDA 4LF4J 2VONA 1B64A 1RCXB 2OPQA 4Q7AA 2HHWA 4PXCA 2GC8A 3KK2A 4EWTA 2VB6A 2BQ3A 4P10A 1AW0A 2NPIA 3M8YA 4CTAB 2X1BA 3CMQA 3PYGA 4WKYA 2XCPA 4TU7A 2C2EA 1Y0HA 3KLGA 3THTA 3AY0A 5DLFA 1WOPA 5L9XA 5AXNA 3Q23A 2C2OB 4H54A 4EMDA 5LSRA 1U6ZA 3KHLA 3PXGa 3FKBA 3EPGA 1U1MA 1TK5A 5KT7A 1LK7A 2HS0A 1YRXA 5AJ3F 4DR6F 4V19X 2DNRA 2LP4A 3B78A 5G0RA 3TUJC 1HBOB 4DV3J 1SQEA 1E6YB 2AJ4A 5DG9A 3V6KA 3G82A 3NWRA 4AYBD 3DC2A 2GVZB 4DUYJ 1U1QA 1PO6A 2LQ5A 4CQ1A 1RYSA 2FVPA 5KFWA 1VQNS 1NZAA 1Y4ZB 4M5DA 4JV1A 5HBMA 1W25A 4USKA 2AV5A 4TU9A 2J0QD 4MFBB 1SH2A 3LP1A 2VG7B 4KKOB 2PFFB 4OJGA 2MY8A 1HYSA 1FRKA 1OQ3A 4AD6A 3DXSX 2HHQA 1JQGA 2LFVA 3Q8UA 3TOQA 4TYBA 1IKXB 2ZH3A 5J2MB 3OVAA 1TZ0A 4QYRA 4NCAA 2VJVA 1KVJA 1O0PA 4V1Ak 3CGIA 2WHOA 4DV4J 4C8LA 4CZCA 4DQPA 3BH7B 1TL1A 1IUJA 4Q44A 3GIJA 1KHWA 2PA3A 3KLGB 1N48A 1IBKJ 3GFZA 2VOOA 4G6VB 1FCAA 1HQ2A 2HRUA 1OY8A 1HQEA 4DV2J 1ZH5A 1JIHA 4PCQA 4WP8A 2ATCB 2HIQA 1F9HA 1SCJB 1EAYC 1U7LA 2C3UA 5D4PA 4RNOA 1S9FA 2OD4A 3DXBA 4DFJA 2CPEA 2WVEA 1T94A 3I0RA 4MIWA 1HW9A 5H9FJ 4GVBA 2R7TA 3DDIA 4RKUC 2AQ4A 4QPTA 3CC2S 3CCRS 2BABA 1SUQA 3PG9A 5BYRA 1MMNA 1R8AA 2HFSA 3N79A 5B0CA 5C2CA 3HF5A 2YVSA 2CPXA 3OXLA 2IYGA 4FNIA 4NX9A 1FK9B 4OLPA 3HSZA 5FLXU 2CYYA 3EX7B 1KN6A 1N5YA 1WACA 2R7RA 5HROA 4JYAJ 1N5TA 1RT6B 4H4MB 4QU7A 4J9LA 3HCXA 1KQGB 1BE4A 4N8OA 3PFOA 5HVFA 5HBMB 1FESA 2LEBA 1MLAA 1FWKA 1IBLJ 2V68A 3PDNA 1HNZJ 4C9DA 3CCZA 3JYTA 4WTOB 1PJ7A 4DSEA 3GCXP 3WBZA 3C3LA 3CB4A 1CEZA 2ZHOA 1RWUA 3LWMA 2CQ3A 5KFVA 2R7XA 1T9TA 4IH5A 4WFXA 1VLOA 3UO0A 3BKFA 3AAWB 2CJYB 4OZLA 1AZSB 2IC3A 5KG2A 2XMUA 4OHXA 2NSCA 3OTEA 1HKAA 3OHAA 2AU0A 4ED0A 2FVRA 4ZLJA 4OLOA 3KLFA 5LSLA 4LMZA 3QNWB 4ZVHA 1DJ0A 2CPDA 2V4JA 4EUVA 3MHYA 3IR5B 1C1BA 4J9RA 4O3RA 1LXJA 2Q6CA 5KFHA 3OJUA 2XO7A 3GV8B 1PCAA 3SMZA 2VA2A 4ZIWA 1JNRB 2GV1A 2CADA 1YBAA 1IWGA 4O0IA 1FTRA 1HNVB 2H3EB 3HT0A 2ZH2A 1I94F 1NHUA 2VBWA 4WFNQ 2MQMA 2IDEA 2VPXB 1XR6A 4J9UE 3LUYA 5L1KA 5GAEI 4A8QA 2XY6A 1R8CA 1VRTA 5HK4A 3PRBA 4KFBA 1UEKA 5D15A 4DPUA 3HPOA 2IJFA 1PYOB 1KEKA 1IJEB 3A8EA 1C4CA 2FVCA 2QYCA 3A12A 3W9IA 1K44A 1RTHA 2F9JA 2XMMA 2MJNA 5HROB 2CQDA 3M9OB 3RBDA 1PGZA 1SKRA 1X4CA 5H9FK 2VODA 2JC0A 3HXMA 3ETMA 1CG2A 2M4MA 2FDNA 4DPOA 4P71A 1NEEA 3BZQA 3CJKA 5DGAA 1S77D 2VL1A 3R8YA 3PV8A 4ZPWR 4UOGA 1VQ8S 2XC9A 2HQ3A 3P96A 4WIIA 3WC0A 2MGZB 1WHVA 3FDSA 4C48A 1IR0A 1R8HA 1WHXA 3ZTRA 3MFIA 3MAQA 5KT5A 3QJLA 2KXNB 3W61A 4OZNA 2UUAJ 3P4UB 4C3MA 1MU2B 4ZITA 4USJC 1CVJA 1SB6A 2YNHA 1MROB 2QEXS 3MGJA 5IV3A 1RAOA 1FWLA 4DCPB 3M2UB 4A8FA 1HLWA 2KJWA 3W65A 2EFQA 3R5CA 1RDRA 1HWLA 1U6FA 2GIFA 4JI0F 2KDOA 3CVKA 4AFFA 2DXFA 4K4TA 4LRCA 3CJ0A 3ISNC 3IWNC 3R2CJ 4LFBJ 2Y1IA 2B9WA 2DY9A 4CLLA 2HHSA 4HTJA 4WCEQ 4AL6A 2J5AA 3T5HA 1RHJB 3DI6A 5M2PA 2FJVA 4F02A 4ICLB 3MD3A 2N3LA 3SQGB 3X3UA 4U95A 4JV5F 2B8PA 2ILZA 4K4UA 3OFFA 4I7FB 4NASA 4F2RA 2EWHA 2YH0A 2FGCA 1RT1B 1OQ6A 4YDXA 5A2QY 2IMWP 3AOCA 2UP1A 2HBYB 4PZVA 5KT3A 4IR1A 2GGPA 5L1LA 3Q8VA 2ZM6J 2RVJA 2YKNA 1U1NA 1F3FA 5AT1B 2UXCF 5DQHA 3DLLQ 3NAHA 3FBBA 2GJFA 1S0NA 2DEJA 1JJHA 1WDTA 2PN6A 2OP5A 1RA7A 2V8HA 2RQ4A 4KGMA 2Y0SD 4KSEB 3SCLE 2AGOA 3I82A 3FFIB 5E2QA 4OYMA 4B9NA 2Y8YA 4CM2A 3IMQJ 2Q66A 2DHHA 1R8BA 2FZKB 3UDVA 2E7WA 1S6PB 3QATA 4DL3A 3UCZP 3R7SB 3GCWP 1SXLA 5DZ7A 4WZMA 4UTGA 2OFGX 1TU0B 1ZAXA 1HWUA 2J7WA 3B4MA 4KH0B 1Q86T 4BLGA 2XZDB 5BJRA 3D6FB 5C7PA 5A2QU 2MKJA 3TARA 1JLFB 3NKYA 4Y0FA 4Q43A 1S1VA 2E1RA 2MZSA 3C6UB 5B0FA 1R3NA 4PXBA 2BANB 1GMUA 1K1SA 1FJGF 4DZDA 3G82B 4DF4A 1VQYA 1V6HA 1YJVA 4B3SJ 2P9CA 4JI8J 3BYRA 2FPHX 1X4HA 3HFZB 3PYDA 3UN2A 3VVUA 3W2WB 4BC9A 2RU9A 3QWPA 1Q78A 5KFTA 4P75A 2DGQA 3SQGA 2WOMB 4MFBA 3ZNUA 2HEKA 5K8PA 1HBOA 1CLFA 1HMVA 2NUHA 4RWXA 4OYXA 2LEAA 2GVZA 4MYUA 1VK8A 1H6KX 1FKPA 2SXLA 2DH9A 1FRLA 2O01C 4IOCQ 1NDCA 2FIUA 2IM0A 1DURA 4CO2A 1QY7A 2CVEA 5CYMB 5HAOA 2ZH4A 3KUEA 1SL1A 4DJBA 1ZS6A 3LP1B 4FVCA 4DPWA 1XERA 4ELTA 3G9CA 2E5IA 3I0RB 3BB5A 3NBPB 4O4RA 2UVUA 2CZ9A 4JI7F 2XULA 1UP1A 2ALZA 3A1YG 1WKKA 1U49A 5B0EA 1JLBA 3L3CA 4J9QA 4KTQA 3DCAA 3MM5B 4FN5A 1D8YA 3TANA 2VZ9A 2HHXA 3AA8A 3TJ8A 2BKOA 2C42A 4DX6A 2BE2B 4HT7A 4LVOP 5AXLA 3HT3A 5SUHA 3R6LB 4FZVA 4Q5VA 2WBMA 4NL5A 4TVAB 8ATCB 2YKAA 2HFUA 2KT3A 3GG0A 2XB2D 4RNHA 3B4DA 4WBFA 4QYZK 1KONA 4HTIA 1K73T 2OPSA 3FBEA 1C0TB 2KO1A 3ITHB 4K0KJ 1E6VB 2GQ2A 3LPYA 1N32J 3PYFA 4UOFA 5HJXA 5HLFB 2JEJA 2Y9HA 2R2TA 4KHPJ 2VC0A 3EPIA 2AJ1A 3D68A 4JV5J 1FVQA 4JI3F 1UWAA 2BMBA 4A8XA 3OR2A 5E5NA 2UU9F 3UDCA 4I6AA 1KVKA 1OWXA 2OH2A 3IS9A 2OPRB 1HHTP 4UY8T 2ASYA 1CSJA 4CCHA 4X62J 3VF0B 1NSPA 5E3PA 3IBCB 2D7SA 4C8NA 3TNVA 3PKYA 3DLBA 1VC5A 4DPTA 1UA1A 1SPBP 1WKLA 2Z2ZA 1FD2A 3MPDA 3TYTA 3CW2C 5KFMA 4EO6A 2PEBA 4GKJF 4N7TA 4CLYA 3UD5A 3HKWA 3DGPB 4OX6A 2BW2A 4MKVA 1IVZA 1FD8A 2HHVA 1AFIA 2VG6B 1S72S 4NLWA 3T3FA 3UCUP 2LU2A 3GQCA 5GAHU 1FEEA 1HNVA 4X66F 3ITHA 3BBFA 2PMWA 3TA0A 2HG4A 1HARA 2F8HA 4C11A 3D1QA 5B08A 2VQEJ 3FNNA 5HLFA 1T7PA 1FHTA 3LF0A 5E0OA 5H9EK 3MAHA 2QX0A 2R8GA 3L7OA 3KNGA 3VGUA 4NZ7A 3WQPA 4ED3A 5K8MA 3H4BA 3TVYA 3MECB 2BW7A 3E51A 4KIAA 3AJ2A 1F3VA 2VDIA 4ZP6A 4CT8A 4F4ZA 2B4OA 2YNIB 4LRDA 1NRKA 4ES3A 3H25A 1T05A 3MEGA 2DNYA 1KP6A 4RU2A 4B9MA 3OR1B 5D0EA 4GC6A 3S7RA 1NK4A 4NZ0A 4M5LA 3PHEA 3VV2B 4YFUA 2ERRA 4USUA 4CLUA 2AKWB 1M5SA 3DLEA 3EGNA 3NS6A 3Q8SB 4CLFA 4UY85 2XSJB 3OVSA 1JLAA 1S6OA 1T9VA 2NXUA 4MMOA 3VGVA 2D3ZA 3CJ8A 2V5HG 4KO0A 3H5YA 3CMAS 3VGSA 1NKCA 2POKA 3J81j 4TY8A 2XYHB 3MMAB 2Y1LB 3CJ3A 2E1PA 4HHUA 4DLGA 1JJ4A 2HVDA 2GZOA 1NZ8A 3G8QA 4ECZA 5LSOA 1IN0A 3JS9A 4M5MA 4N8NA 3UFCX 2B4VA 2VFTA 3WIUA 1TTHB 1S4EA 2XBPA 1YSJA 1OS5A 1VFJA 2H54B 2MLXA 3WHIA 3EM1A 1VQKS 1SKSA 1S1WA 3FMWA 3MM7B 5T7LA 3N6LA 3PVXA 3DGPA 2NXEA 1CJUB 4URSA 5DGBA 3EZ5A 5DS7A 3DLGB 4HI1A 2ZBIA 3GB0A 4CO0A 2JEIA 2QMXA 4IO1A 3CDEA 4IKAA 3S1TA 3MPVA 3K8WA 3V81B 1XR7A 1UVIA 2XLKA 1XWLA 2E5LJ 2CIMA 4R0JA 1YK9A 2XI3A 1W2IA 4YEAA 3C8YA 3U02A 3AJDA 3LP2A 1IXKA 3OTCA 5GAGI 2YQ3A 3C6TB 3CCWA 4JUZA 4TQRA 2RIJA 3UCGA 2XG8A 1Y3JA 2F8EX 4I4BA 3DMJA 2H5IB 5EX3A 5KFLA 2BA9A 3H0PA 5D0HA 2R8KA 3J7AN 4J9SA 4DV5J 3M8QB 2CWKA 2G2OA 1C2PA 3LALA 2YX1A 4OMFG 1TAQA 2J9EA 3AQPA 3DU5A 3CD7A 2J7KA 1D1UA 4MTPA 3K5NA 1TL3A 2Z58B 2ZHBA 4YS2A 4J37A 1B7FA 3LO3A 4DV2F 5IT9Y 3NG8A 1RAAB 3ZTOA 3THPA 1VS3A 2F7VA 1NBEB 1SQFA 2GO9A 1IKWA 4F0HA 2DIVA 5LXYA 4KAIA 3UN5A 4ZLPA 1U1OA 4NYPA 3D4JA 3HK2A 4IFYB 2JH3A 2NCKL 4GKKJ 1U2FA 1VHIA 1KKHA 4P73A 4RW8A 1JLCB 1D3WA 2F3JA 1Q8BA 3G87A 3CF5Q 4JI5J 2DK2A 2R8HA 2DNHA 3G8TA 2H51B 3T1HF 2MQNA 1GH8A 2OD6A 4ENOA 3ZC4A 1CS4A 2Y3YA 4MKYA 1F60B 2JOQA 2EFPA 3FEZA 1GX6A 4OHZA 4IFVB 1YIJS 2BOPA 1DTTB 2KJVA 3T9NA 4FXVA 3KJQB 2O67A 3NS5A 4HDGA 3O3LA 4P2FA 3TJAA 4DLEA 1T95A 2QA1A 5B0DA 1ZTWA 5C42A 1GMWA 2OO4A 4ED7A 3IBWA 3C15B 3CE8A 3MI7X 2BANA 3IA0A 4HR2A 4NLSA 4PAAA 5MAOA 2AYGA 4B9LA 1XNQJ 1TL4A 3OLAA 3SV4A 1XNRJ 3IC1A 2HNYA 3GR1A 1IBMJ 1X5PA 1R0AB 1XR5A 1TKXB 5A8KB 1RKJA 3M6WA 4N77A 4FYXB 4CTAA 5A8WB 3KK2B 2BE2A 3ZZPA 3GV5B 2Z30B 1M1KT 2DJWA 1Q79A 3AXMA 3CO9A 4DQIA 1GK8A 3RRHA 3HO1A 1QSYA 5H1SV 2QE5A 3KOAA 1RE1B 2V67A 3DRPB 1KTVA 2MKHA 4ZPBA 3W5YA 1TMJA 2BRLA 4X66J 1TL3B 4DCJB 4K4ZA 3FK4A 4K2XA 1RT2B 3TI0A 4DR4F 2KKHA 1UA0A 3CTRA 3V6JA 1JXLA 2PA8D 3RJMB 2KTQA 2Q79A 5L9NA 4LFCF 1WNEA 1WF2A 3RBXA 2WVFA 3NCQA 2E1CA 4JI6J 3HHLC 4IH7A 4FYDA 4YN3B 2P5VA 2DD8S 4ZPDA 4I69A 2I5JA 2DHXA 1YBTA 3PW4A 4CH7A 3OJSA 2VKZG 3BGRA 4E8UA 4HI2A 2V8PA 2VPZB 5G4DA 5KFNA 4K7QA 1F5BA 3HJVA 4WTYA 4HT5A 1KS2A 4DV7F 3I32A 2MXYA 2ALYB 2Y0BB 4ITSA 1F9FA 3UVJA 4Q45A 3MCSA 3SCKE 2AIRB 2VDHA 1HQEB 2AJ2A 1ZOTA 2LCWA 2OSQA 3J7A1 3W9HA 1YJUA 3U1LA 1QUVA 3N28A 3MCOA 2Q3PA 4OHWA 2CRLA 1YJNS 1SKWA 3HVWA 4X4VA 3TA2A 4Q8EA 2VF3A 3EJMA 1L3TA 3T5LA 1BQNA 4MH8A 1UWBB 1V3ZA 2J6TA 2KZMA 3UD3P 4TU8A 2IBOA 1J2VA 3JAMU 2HHUA 1HI8A 2Z2LA 2DNGA 3QFHA 1B0PA 1NXIA 4C0BA 2QL5B 4KPYA 3FMBA 2K3IA 3FGVA 3D66A 3HZEA 4TY9A 1LXNA 1NSQA 2JEFA 1B0TA 2OEMA 3VHQA 4TN2A 5KFCA 5KT2A 4YR2A 3QAEA 5IQ6A 2CQ1A 1JNZB 5CCMA 2PSZA 3AOAA 1QE1B 2IVFB 2DHAA 3H5SA 1RT2A 2DO0A 1RHKB 2WW8A 3MAAA 2EFOA 1H2TZ 2RF2B 3FUYA 1XMOF 2HAFA 1Q5VA 3J80Y 1VBZA 4JI4F 2EI5A 5K9FA 5CQGA 1NK6A 1WI8A 3TUZC 5GADI 1TL5A 2V69A 4DCOB 7AT1B 1OPIA 2HFZA 2HNZA 3UVJB 2YKPA 2YKNB 1FRHA 4FBTA 2NXCA 2AWZA 2N7CA 2FVSA 1RTZA 1WKJA 4RNFA 2J76E 2HZVA 1T03A 1V5IB 1FJEB 3CCQS 2DRDA 1PG5B 3PJWA 4JI2F 3RAMA 4CLTA 5HSPA 2MQOA 3J7YI 1CULA 1N6QB 5KFGA 2ZZMA 2PI5A 1CJVA 3S8SA 1FA0A 3AJ1A 1UTAA 3NCPA 1LEOA 3DYAB 1JX4A 2XM3A 4DUZF 2OTLS 4IDKB 2KYZA 3KLVA 1SJ4P 4DFMA 2HURA 3MM7A 1JB0C 4F3OA 3TAMA 2HBZB 2ZBPA 3M32B 4F4YA 1DQ8A 2G1DA 3M1VB 1FKOA 2GFFA 3BV8A 1PSDA 3BR8A 1G4CA 1UEVA 4EU0A 3N01A 4ETXA 1H72C 1O6XA 3EGZA 2W4DA 4HVZA 1W26A 4DWIA 2EFGA 2ACYA 3DLHA 3CCJS 4RW4B 1S1UA 4XPCA 4IR9A 1QJHA 4FS2A 3IP0A 2PMZD 4QR0A 4LF6F 1ZM4A 3NS7B 2QRRA 3R3TA 1QAYA 2JX2A 3Q8QB 2XO6A 1HNWF 1NDKA 2W2PP 3ISND 1YKWA 2HAIA 1XMQJ 4TYAA 1F6TA 1JXVA 1U26A 2Z2MA 1UVNA 4GO5X 2BE9B 2LQJA 1VK3A 4PWUA 2HNDB 1RAIB 2MB0B 2Z56B 2OJ3A 3GFYA 2X1FA 4PQUB 1RT7B 1J5EF 3G6ES 2IM2A 1U0HB 1Q82T 4QW9A 4ELVA 4EBCA 3F56A 1M1HA 2WSFC 4PG7A 4QIWD 1RHRB 1X4FA 4XDDA 2JFKA 2M70A 4C8ZA 2ZZTA 3QLHA 1FRJA 4DR5F 2DGUA 3OD2A 3I9ZA 2KFYA 5DQIA 4YY3F 3PJXA 3D1OA 2GJIA 2BJ1A 2NS1B 2UUBF 3HJFA 1Q16B 4QPXA 2N7YA 3OL8A 3H2LA 1APSA 1RWMB 3H42A 3H20A 2WTFA 1UVJA 4QWEA 3THVA 3CJTA 3MM8B 2CPJA 2HLTA 2ZOMA 1RAFB 4KV8A 3V6DA 4LFBF 1RHMB 2FB0A 3O6QA 1FFSB 4DQSA 5KFEA 1BQXA 4UUWA 4M94A 3D3BJ 5HP1A 3OTOF 1S6QA 1J5EJ 3J7YU 3M30A 1FRXA 5JXSA 4DX8H 4ECWA 3K8VA 3S6EA 3KTQA 2R2SA 2YKMB 2HNDA 1GNKA 4YB6A 4YB1P 2GA7A 2GJ2A 2DGTA 4OYZA 5KG7A 3G6XA 5EHHA 4WU3A 1Q7LB 2GHVC 5ETPA 3KDOA 2IRXA 2BM1A 2F1FA 2QL7B 2RB7A 4IFVA 4P7TA 4LF6J 1JLCA 3TEGA 2W7OA 4RBTA 2PI4A 1JK9B 4E0DA 4FKYA 2XS5A 1SJRA 5HN0A 1YJRA 2R2RA 1VBKA 3OSPA 4FDFA 4O44A 3GFXA 2ASLA 3SSSA 3AODA 3NEKA 4X4UA 3TX0A 3GTYX 4NMLA 2XLJA 1F0XA 3P49B 5DZ6A 3SCJE 3PW7A 1X5OA 1DRZA 2R42A 4OZ1A 4CLKA 2HK3A 2DNQA 4U6PA 1NK9A 3GIRA 3LP0B 2G9OA 1HIYA 4B3SF 2XNQA 4KV8B 5DLGA 2HWTA 2K1RB 3I96A 5JMNA 3QSYB 2DPJA 3DOMA 2KHDA 2YX7A 2QA4G 2R2UA 2FLPA 2MLYA 2RHSB 1F9EB 1TKTA 1PC5A 2LDIA 5J2NA 1PIEA 2PMHA 1WOOA 3C16B 1EARA 3NMAA 3H90A 4ZP9A 4LT6A 3M8RA 2V8GA 4I67A 3LAMA 2I6WA 1XK8A 4NLGA 2CA9A 3IG1B 4X4RA 1VQ6S 2KM8B 1VBXA 1TKZB 2JZ5A 4DSIA 1WELA 3IRXA 5C5JA 4BDPA 4J90A 2HLUA 1GXTA 1UJ4A 1V5VA 1YRUA 3VALA 4I0WA 2FY1A 3JYTB 1FNOA 1N4LA 3I5AA 4HDHA 1LWEB 5KT4A 1IKYA 1KBRA 1MN7A 3L9ZA 3P8BB 3ILIA 5K8NA 5F9LA 3T5KA 1IQTA 2UXBF 3WX8A 3RW6A 3EDQB 5CYMA 4RW7A 2J9DA 3GPAA 2RMLA 4H4OB 4J9OA 1KVIA 2W1BA 3UDEA 4M5IA 3LP0A 4CDIA 1EX8A 3I6PA 4NZ6A 3BPDA 2W7PA 1N34J 4G3IA 3KLHB 5ETNA 1S1XB 1Q81T 2K1RA 3CEDA 4EFAC 3ZO7A 2W2OP 3FRYA 1NJWA 2BJEA 1EZZB 2VG5A 2HQGA 1X60A 3HHNB 2ZC4A 3KG1A 3R9LA 1BQNB 1RISA 3NOGA 1LFPA 1RB0A 3JTPA 3KG4A 4ZP8A 5T7LB 4C8MA 3OL6A 3KK1B 3I9V9 3N5BA 1SC6A 2FZGB 4I2PA 4L72B 4ECTA 2L9DA 3FEXB 4DR7J 2VC1A 1RT5A 5J1EA 1H3DA 1KDNA 1R89A 2DR6A 3BSCA 1NSAA 4RW9B 3TUIC 3PW5A 3TAQA 1VC6A 3JSRA 3ZTQA 1N56A 3L4BC 3CCUS 2R9LA 1U1PA 2RF2A 4HKQA 4F26A 3KJVA 2YWKA 4QCLA 5T14A 3A3PB 3V4MA 3D2WA 2CQ0A 2HBRB 2JVRA 1T3OA 2DCLA 3G2XA 3ONQA 4J9VA 4ZVRB 3RRKA 4YUDA 4P72A 2HNZB 1Y7PA 1S4FA 3PACA 1HPZA 1SIZA 3KHGA 2HGMA 3OVBA 3RUBL 3JSMA 2V9WA 1C0UB 5K5MA 1DFDA 3R1LA 2H48B 1PILA 1W7WA 3OFGA 4G1PA 2DBBA 1UPPA 5IT0A 1S57A 2DNKA 4JOUA 4UQGA 3G71S 4FBUA 3SBMA 1CC7A 3SCIE 4OI0A 3FBFA 3PR4A 2AHOB 1KQFB 2FHMA 3FSXA 1LW2B 2F4VF 1P27B 1FE4A 5CZVA 1NH7A 4DSFA 5C24B 4Q0BB 2YWEA 4I1TA 3SXLA 3TX8A 4F3QA 1I94J 3ENQA 1WD6A 2OSRA 1IKVB 4NCGA 3I4HX 2A10A 3M2UA 4NXNJ 1JLQB 5FJ4A 4IOBA 2BQUA 4F4XA 1AYEA 4USVA 1G1XA 4WK3A 5A6WA 1LFWA 2VFRA 3CC7S 1ZZFA 1XBWA 3UN3A 1EQMA 5E3CA 4URGA 3RB4A 2QZ8A 1X5TA 2VD3A 3CJRA 1Z1ZA 3Q2SC 4MIAA 3RYLA 3L09A 3GU0A 5DM7Q 4RW4A 3A8KA 5KFKA 4LF4F 2YNFA 3UI3A 1HBNB 1OO0B 4R8UB 4B9UA 4GKKF 5KFJA 1WUUA 1URRA 4C8KA 3T1YF 4QZVB 3VAHA 4DV6J 1PC4A 1WF1A 3W62A 1ZZNA 3I0SA 5IC6B 4K8RA 2RRNA 4OJ3A 1J5OA 3BEGB 1VQMS 5D4NA 5B7WA 1GTEA 1M5HA 1RWWB 3AFGA 3BQ0A 4PG6A 4LF5J 1PJ6A 2KRBA 1OYDA 5D4OA 4DMZA 3EVMA 2CG4A 4O3PA 5IT4A 1DHMA 4EBEA 1KFSA 1EIYB 2P8IA 3ELHA 1DTQB 2X3DA 4KC5A 5HI7A 5IM0A 4DL4A 1OPZA 4GC7A 4LFAF 1EETB 2I8EA 2IPOB 1S79A 2VOPA 2QSWA 3TZZA 1B70B 2B5JA 2CNLB 3BF4A 3NGSA 1RYRA 2OMOA 2PT0A 3CJ5A 3BDPA 3BYPA 1YTYA 3LOUA 2VA3A 2COLA 3CJ4A 1B3TA 4KH1B 2XGPA 5CCLA 2UV8A 2D3O1 2LQ9A 3KJNB 2J0XA 1PJ5A 2V2VA 3KNAA 4LF2A 4P9SA 1BQMA 3C14A 3UQSA 1N5VA 2OLWA 2VV5A 3QRRA 2YKMA 1VYAA 4ZVOB 4WFAQ 2E5JA 4HACA 2CZ4A 2QFIA 4ZS6A 4C8YA 2X1AA 1RHUB 1SV5B 5HP1B 3C6TA 2QJ3A 4DV4F 1DLOB 3BDEA 3CXCR 1R6YA 1G2EA 2YKQA 2XS2A 1HWKA 5AXMA 5DDQC 2NUUG 3Q89A 5L38A 4R5PA 5SZTA 3OL9A 3EZOA 5FDLB 1N33F 4IG3A 1RGVA 2I0XA 4DG1B 5ETKA 4LRAA 2LDYA 1M90T 5KFZA 4IFYA 5L1JA 1FERA 3HD2A 4Y6IA 3V5RA 1FDAA 1Q8LA 1ZETA 5GVQA 1H7WA 1OIAA 3NY0A 1HNIB 2CZVC 2XQCA 3TRGA 2FYXA 2ZC3A 3MTJA 2B4PA 2MLZA 3O2IA 4CLWA 2HFOA 1DQAA 3X1LB 5KG6A 4OI4A 3BS9A 5B0BA 1RTJB 3JTOA 2GHPA 1HR0J 4Y2CA 3MD1A 2KXHA 1BQMB 3C14B 2B3TB 3BSOA 4ERDA 1UZDA 4UUXA 5LL6d 1TKDA 5GMKa 4K4WA 3PJ9A 4I7FA 3JTNA 2DR5A 1S97A 3C19A 4ZJOA 4E98A 2XMTA 4KRWA 3TQEA 1XC9A 2ADCA 3CDWA 4PYDA 5D4LA 2R7UA 4WKRA 5J2MA 1RTDB 4Y2KA 2YQ1A 3H5UA 3P45B 5ETMA 1Q1KA 4ECQA 2ASDA 2J6UA 2AD9A 4B3OA 1D8ZA 3B6BA 3ZZUA 4B3MJ 3DRRB 2KZZA 2Y1JA 1HYSB 4KB7A 1PYSB 2ACMA 2DH8A 4IG3B 1ZTTA 4BCAA 3DRPA 2IVYA 3QJJA 1K1QA 2RILA 5I3QA 3OLBA 1GQEA 4LR7A 1N0UA 1O51A 1VRUB 3MR7A 4J91A 3FC9A 4IDKA 4RWWA 4ZOSA 5I3PA 5A8WA 5MLCV 3MR5A 2AMCB 1C4AA 2CQIA 1A7GE 1LWEA 2DNNA 2B8QA 2DISA 2GVDB 5ETOA 1FKOB 1HNXF 3HSGA 1RACB 2I5JB 2VU5A 2E1MC 4OQJA 3H2VE 3W5XA 3G4SS 1IR1A 4ZKAA 4XAKA 4LF7F 1GX5A 2EFNA 1NK5A 4B02A 4X84A 2OPPA 3OL7A 4ZK7M 1N33J 3JQMA 1D9AA 4C11B 3I31A 4DR3F 1REVA 3CD6S 4K0KF 2BX6A 4ATNA 2ZE2A 4LIRA 4KT0C 2OEJA 1SL0A 4NLPA 2Q1LA 4MIBA 4ETZA 4QBUA 4L74A 1ZBTA 5F8GA 5CA5A 4UOCA 3I5BA 1TP7A 3T1AA 3BN4A 2VQFJ 3QRQA 1RAJA 3SDEB 1VQ7S 1FKAF 1KTQA 4F4WA 3FSYA 2NYHA 5IXUA 2E7XA 4ECXA 3D7SB 2CQ4A 2FC9A 2NZCA 2ZD1A 3DM2A 3MM6B 4MK7A 1T9UA 2KB2A 2V94A 3OBIA 1SJFA 2MY7A 4LF8F 1SKUB 5J1NA 4QWBA 2CDQA 3SQOP 1TL7A 5U47A 1TMMA 1SC1B 3KJVB 4N5SA 4C8OA 2EEYA 2EC0A 3VWSA 1MNEA 3NBPA 2EK6A 2IJNA 4NA1A 1RT3B 2Z0GA 3BGLA 4LREA 3PRDA 4X65F 3PX0A 3PY8A 2GMHA 4JI1F 3Q86A 1JJCB 1RAHB 3AQOA 2MSSA 4ZIVA 5BYSA 3HSJA 5K20B 1DY3A 2VUGA 2DY1A 2EKNA 1B7YB 5EGYA 4PUOB 2B51A 3ZZTA 4YMEA 2X1GA 5A8RB 1T8EA 1PBAA 3IFEA 1R0BG 2MQLA 3U7JA 3NGRA 1N5SA 3CCES 3CD5A 3T6JA 4LF5F 2M8DB 1RJJA 2DTJA 3MWBA 1CJUA 2EG2A 1G7CB 4NE9C 5A76A 4RJVA 4PPDA 2DVIA 4X2BA 4KE5A 3K57A 3N6NA 1LW2A 3V81A 1TK8A 4OZ5A 1OMSA 2B4UA 1L3SA 3T1YJ 2OUGA 1G6BA 3KG0A 4W92B 1LWCA 1QUPA 5C24A 4Q0BA 2MZQA 4ECUA 2HS3A 1O5JA 2BE7D 3J7ZT 4X4SA 4G1QB 3OHBA 1NDLA 1CPZA 2C2KB 2L3MA 5FIIA 2W9CB 4L75A 3FRZA 4L3NA 1SH0A 1I1GA 4GRSA 3J81Y 4B3TF 1NB7A 2RS2A 2AEMA 1VQSA 4CO4A 4WPAA 4YDDB 9ATCB 2XSFA 3M2VB 3R2DJ 4ZJQA 2LXUA 3IO1A 3LTOA 3D28A 2DKOB 4ECSA 5CYQB 3MPWA 4TXSA 1YJ9S 4J7CA 3K17A 2QC3A 2CQBA 4M5KA 4RX6A 2HIYA 2KN4A 3KXDA 1R8PA 1SL2A 2QYGA 1NSKL 1YJ7A 2CJKA 3BM7A 2JVOA 3HVTB 3E2EA 2RHQB 2FJWA 2XLIA 1RK8A 1KHVA 2UXCJ 1AA1B 2HQFA 2MSTA 1EETA 1WC4A 2V63A 3DOLA 4BBYA 5J2PA 4O3OA 2DRAA 1XQIA 2XWYA 3OSNA 3D0IE 3POTB 1XNQF 2J9DE 2GW8A 1RT1A 1TV6A 1KR4A 4RBUA 3JQKA 4OYPA 4DI6A 3W8GA 4IRKA 1V3RA 2HPUA 1DLOA 3MMCA 4I56A 1DTTA 1OJ4A 3GJTB 4KGZB 1IR2A 3KKFA 1BC6A 1RWXB 2J0WA 1IKXA 1PYTA 2LXFA 2ZITA 1P9QC 2VG7A 4KKOA 3PIPQ 4Q8FA 4ICLA 3EMTA 5C42B 9RUBA 4ZCLA 4Y2IA 4DG1A 1TL1B 4DDFA 1IM6A 4OV6A 5I4MA 2N82B 1SV5A 2ZJRQ 3B82A 4P52A 2DH7A 4RW7B 2FQQB 5F3TA 1U45A 3QBCA 4LRBA 4J9KA 1S6PA 3KUHA 1R0AA 4N76A 1YDLA 2GNKA 4I2QB 3SIPB 1DARA 5IV4A 2ROEA 3T9ZA 3ZNJ1 1ZPWX 1UJ5A 1JLAB 3ZTSA 3RB6A 2YWWA 4X64J 1HI0P 2RKIA 2V9KA 4E2FB 4RL1A 1RTIB 2HQCA 4M5HA 4WFYA 2XHWA 2M5YA 2NPFA 1D09B 5DG8A 2DHSA 3CCSS 1EKRA 3KLEA 2ADBA 5CYQA 3FBCA 4FP9A 2W01A 2WVCA 3W7BA 4K4YA 3LANA 3ULHA 2UUBJ 1Q5YA 3EGWB 2AX0A 4UF4A 1KFDA 5JVGQ 2D9OA 3E01A 1H73A 5ADZA 3W3SA 2NZ4A 1JLGA 2ZJQQ 3QFWA 4DR5J 2BJ7A 4DF8A 1NK8A 2E7VA 2ZKTA 1UVKA 2DXDA 1YI2S 4F3MA 1OY6A 5D0GA 2MKSA 4ZP7A 1QTMA 4I6WA 5F8LA 3AHPA 3CT9A 4A46A 2A6MA 1OSCA 1TQLA 4IOAQ 4DU7A 5JUMA 1RHQB 3E3XA 1SC4B 1BXNA 2QN6B 1CC8A 2QSFA 3NGKA 4Y2AA 1C1CA 4NLQA 5THWA 2JEGA 1VQPS 3MMBB 4NLTA 2W9BA 5F8JA 5DO2A 1QAIA 1FEHA 1CJKA 5IFMA 4QWDA 3MR6A 3NRBA 1NMEB 1ITPA 1WEYA 3E8OA 2D41A 4RUBA 3BQ1A 3SV3A 1JKHA 3GYGA 3DGVA 3JSBA 2P6SA 3G8SA 3GJRB 4O0NA 3VAFA 3M6XA 3NCRA 2ZUAA 3CMES 5I3UA 1QD1A 2CQCA 3M8QA 4U8YA 1YHQS 2RKIB 1WTFA 2UXDJ 1C1BB 2GCFA 1YG0A 1KD1T 4B3MF 4WJBA 1NPPA 3QT5A 1X4BA 4ZVQB 3BBCA 3D54A 3QAUA 2KI2A 4QR2A 2FVQA 1CQNA 5D6GA 5K8OA 2H65B 4KGKA 3KLFB 4DSJA 4NWBA 4LF9J 1K47A 3LGNA 4IYQA 4MJKA 4EYHB 3UDLA 1RTIA 2ROPA 3A8JA 3W66A 5JVHQ 4NXMJ 3V4IB 2ROGA 4OYIA 4DUTA 1X7VA 4ES2A 1RBLA 5KFIA 4JBCA 4B17A 5IS2A 3K5MA 2B9XA 3BO3A 4R25A 2X51A 2Z57B 4LSNA 1RCOB 5GAHI 4H4KA 3Q0AA 3VAIA 1X4DA 2O66A 3I55S 3UNYA 4X4TA 2VIHA 2GVDA 1VRTB 2W9BB 1HL6A 2HFNA 2DEIA 3US5A 4Q2MA 4YHHF 4FPIA 1K0VA 2ZZNA 3BGOP 1EB0A 4NLXA 1GFWB 4K2JA 3ICLA 5LJ3Y 1U2RA 2OPPB 3KHRA 2MDAA 2P6TA 4HHHA 2HZCA 4OL8A 3GWCA 2BRKA 5B0GA 5KFSA 3R97A 2LMIA 3JXOA 2DR7A 1CULB 2IA6A 1HFEL 1HWIA 3DM2B 1S59A 1P8GA 3M8PB 1XMOJ 3FCWA 4ZVPB 4DV1F 4ZPAA 2XMAA 4IQXA 2VICA 3R1HA 2HHPA 3QIPB 2OFHX 1IBKF 3D6MB 2QLXA 3RZAA 4O3SA 1SUQB 3BR9A 4RBVA 3WC2A 1RT5B 5D8HB 2HFVA 1RABB 2VBZA 2ZOFA 2MKIA 2JRSA 1S5ZA 1EP4B 4KGXB 1HW8A 4GMKA 1KOHA 3IXQA 3BREA 2KU7A 4LSNB 2XZWA 3TAMB 2EBGA 4A8OA 3BSNA 4CLSA 2ZNYA 3QZ8A 3PW0A 3HSDA 1T02A 2WVBA 2MHNA 2Z2YB 2FJBB 3JAMY 2PO4A 4TKTA 2W9CA 2DNZA 3IGNA 3L7UA 4XDCA 2LU1A 4ZN1A 4ECVA 2E29A 3DLEB 4ZVUB 4DXLA 3CD0A 1HNXJ 2IM3A 5HL7Q 4F0MA 4YQWA 1VR6A 2WBRA 3FCVA 4NLYA 4QIVA 1AT1B 1LWCB 3ILOA 4ES1A 1EJ7L 3RBEA 2XNRA 2K3KA 4CO5A 5E41A 4ED5A 3JSMB 2H5JB 3U27A 2QG9B 3NWGA 1XMQF 2A1BA 1HNWJ 2H1YA 1H2UX 3D5MA 4DZ6A 3PR5B 4DV6F 2CPFA 2M0GB 1UW4A 4XO0A 2UUAF 2DYAA 1QVFR 1VQLS 4FPRA 4LFCJ 1AROP 3TZXA 4P74A 4QIFA 2V0NA 5HQLA 2W7AA 4U67Q 3G96A 1BD6A 4WFZA 1YWXA 1O8BA 1QSLA 2UXDF 1TV6B 2RT3A 4HEA9 3Q22A 2C28A 1T9YA 3P5BP 5DG7A 2DRBA 2HZAA 5AE2A 4DV0J 3LWLA 2FZCB 1YX2A 1TFYA 1BY9A 1RTJA 4DS4A 1P9YA 3HVTA 3MAAB 4EI2A 5DDRC 4P6QA 1HR0F 2GX8A 3Q8PB 2BACA 2FD2A 2GHWA 2CJXB 2KVQE 4K4SA 1T11A 2L9NA 5KFDA 2HHHF 1MN9A 2XHCA 3W1YC 1A0OB 5HQ8A 1Q8KA 4KFBB 4YR3A 3MFHA 3SEOA 1FKPB 2F4VJ 2B43A 1S1TB 3TA1A 4DR2J 2ZWPA 2FC8A 3DNCA 3K58A 1U48A 1H38A 4CRJA 1HBNA 3HHKA 1N8RT 5DJBA 4ZLNA 4OX7A 3A3OB 4RW6B 2I1RA 4IRCA 4U96A 5KOXA 1N6QA 3FCHA 1NPKA 2FHJD 1MU2A 4CO1A 1WJ9A 2P9GA 1VRUA 3HVRA 2XI2A 2WSEC 5E3QA 5G0RB 4Z37A 2BZ2A 1VI7A 3CCMS 1WC3A 4NRUA 2ZH7A 1U8SA 2LECA 2ATLA 5IM0B 1WC5A 2J9CA 5IQQA 3OW2R 4ED6A 4ELUA 2DT9A 1FX4A 2HVZA 2HBQB 1MROA 2YNGA 3DOKA 5ETQA 1IQZA 2HKEA 4DR1J 1X9MA 2J0SD 2BYCA 1CS4B 1FF2A 3M9MB 4ID5B 4QW8A 2ZH6A 4LR9A 1UVMA 3M2RA 3DU6A 4M5GA 3QGHA 3HFKA 4YB7A 5HMYA 2AJFE 5D78A 4YR0A 4DV5F 2HWHA 3VAMA 2ASJA 3HDSA 3MCNA 4NYZA 1VMBA 2MJUA 2V4RA 1X9SA 2QLWA 2AYMA 2CG8A 1S48A 5HQMA 4RUCA 3TZYA 2V50A 5F9NA 2KM8C 3RU0A 2I2YA 4PQUA 1PAEX 4FYWB 1RLDA 4C4WA 1U25A 1YLXA 3AB4B 5KAKA 1YBUA 1JLGB 2JLFA 4HH0A 4NCBA 5L8RC 4K59A 1UJ6A 4EZ6A 2HNYB
chains in the Genus database with same CATH topology
5LMNJ 1I94J 3JAMU 2MEWA 4NXNJ 5IT9U 2E5LJ 4LF4J 4JI4J 2UU9J 4DR4J 3J80U 1HNXJ 4OX9J 3J7AN 4X64J 4DV5J 5LMUJ 1N33J 4DV6J 4DR6J 2UUBJ 1HNWJ 4LF5J 4DV3J 4K0KJ 2VQFJ 3J81U 4DUYJ 1N32J 4DR5J 4KHPJ 2MQ8A 5BR8J 4GKKJ 4LFCJ 2UUAJ 4JV5J 4DV1J 4JI5J 4DV0J 3R2CJ 4LFBJ 4X62J 4DUZJ 3T1HJ 4LFAJ 4NEZA 2KVQE 4V1Ak 4DV4J 4AQYJ 4YHHJ 1N34J 1XNQJ 4KY3A 4YY3J 4B3RJ 3W1YC 1IBKJ 1XNRJ 2F4VJ 4B3TJ 1XMQJ 2ZM6J 4RJVA 5AJ3J 4DV2J 1IBMJ 4PWWA 4DR3J 4LF9J 3T1YJ 4X65J 4JI1J 2VQEJ 4NXMJ 4JI0J 4DR7J 1FJGJ 4X66J 2HHHJ 3IMQJ 5IWAJ 4NEYA 4LF8J 5FLXU 5LM7E 4JYAJ 4JI7J 2UUCJ 4JI6J 3R2DJ 3D3CJ 5A2QU 1IBLJ 2KL8A 4DR1J 1HR0J 1HNZJ 2MTLA 2UXBJ 4B3SJ 3D3BJ 1J5EJ 4JI8J 4HHUA 4LF7J 1XMOJ 2UXCJ 4KYZA 4JI3J 3OTOJ 4B3MJ 1N36J 2UXDJ 4DV7J 4JI2J 4DR2J 4GKJJ 4LF6J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN J;  1I94 J;  3JAM U;  2MEW A;  4NXN J;  5IT9 U;  2E5L J;  4LF4 J;  4JI4 J;  2UU9 J;  4DR4 J;  3J80 U;  1HNX J;  4OX9 J;  3J7A N;  4X64 J;  4DV5 J;  5LMU J;  1N33 J;  4DV6 J;  4DR6 J;  2UUB J;  1HNW J;  4LF5 J;  4DV3 J;  4K0K J;  2VQF J;  3J81 U;  4DUY J;  1N32 J;  4DR5 J;  4KHP J;  2MQ8 A;  5BR8 J;  4GKK J;  4LFC J;  2UUA J;  4JV5 J;  4DV1 J;  4JI5 J;  4DV0 J;  3R2C J;  4LFB J;  4X62 J;  4DUZ J;  3T1H J;  4LFA J;  4NEZ A;  2KVQ E;  4V1A k;  4DV4 J;  4AQY J;  4YHH J;  1N34 J;  1XNQ J;  4KY3 A;  4YY3 J;  4B3R J;  3W1Y C;  1IBK J;  1XNR J;  2F4V J;  4B3T J;  1XMQ J;  2ZM6 J;  4RJV A;  5AJ3 J;  4DV2 J;  1IBM J;  4PWW A;  4DR3 J;  4LF9 J;  3T1Y J;  4X65 J;  4JI1 J;  2VQE J;  4NXM J;  4JI0 J;  4DR7 J;  1FJG J;  4X66 J;  2HHH J;  3IMQ J;  5IWA J;  4NEY A;  4LF8 J;  5FLX U;  5LM7 E;  4JYA J;  4JI7 J;  2UUC J;  4JI6 J;  3R2D J;  3D3C J;  5A2Q U;  1IBL J;  2KL8 A;  4DR1 J;  1HR0 J;  1HNZ J;  2MTL A;  2UXB J;  4B3S J;  3D3B J;  1J5E J;  4JI8 J;  4HHU A;  4LF7 J;  1XMO J;  2UXC J;  4KYZ A;  4JI3 J;  3OTO J;  4B3M J;  1N36 J;  2UXD J;  4DV7 J;  4JI2 J;  4DR2 J;  4GKJ J;  4LF6 J; 
#chains in the Genus database with same CATH topology
 1U0H A;  1N34 F;  4F25 A;  1H7X A;  1Q0N A;  2JL9 A;  1WG1 A;  2YKO A;  3O1L A;  4OZ0 A;  4W4M A;  1QTN B;  2W2Q P;  4MAK A;  4DBQ A;  2APO A;  2UVR A;  3HHL A;  1HNI A;  5KFQ A;  1S76 D;  2XYG B;  3PIO Q;  1S9G A;  1L5U A;  3TEH B;  4BHQ A;  1NKB A;  4PXD A;  4WZQ A;  2RDI A;  1NHV A;  3Q24 A;  3PTW A;  4MKB A;  2ZEJ A;  4RO0 A;  3FZB A;  2NQP A;  1LW0 B;  3OUY B;  4AL7 A;  1OYE A;  2Y8W A;  4OX9 F;  2B56 A;  3DDN A;  4OIX A;  2XMJ A;  1F5C A;  1VGY A;  3IWL A;  1HD1 A;  3SSQ A;  4PUO A;  3QPI A;  4IQM A;  4DR4 J;  1YJW S;  2KFZ A;  1VCT A;  4A8W A;  1TAU A;  1X4G A;  2HYI B;  1RWN B;  2U2F A;  1Q4R A;  5BR8 F;  5ETR A;  5IC4 B;  5L46 A;  2C2N A;  3QGI A;  2BJD A;  2IRY A;  1HBM A;  4NPO A;  6AT1 B;  4ECY A;  3IN5 A;  1JXE A;  2I38 A;  3W2W A;  2K7J A;  2QL9 B;  5KFX A;  5DET A;  3TVK A;  2MZJ A;  1S7I A;  2VG5 B;  1AUD A;  1MML A;  1S1V B;  1IBM F;  2BKP A;  2E9R X;  4O4G A;  4CH1 A;  1S99 A;  3ENV A;  3K5O A;  1L3V A;  4LQ9 A;  3J81 U;  3BH6 B;  3N9U C;  4QOT A;  1VQ5 S;  5LMU F;  1ZA2 B;  4FVM A;  3ZZ0 A;  3MEE B;  4DN9 A;  2UUC F;  3RRG A;  2YPZ A;  5EWF A;  1RTD A;  3MTK A;  1EQ0 A;  1FT8 A;  4IO9 Q;  1F1B B;  1RU2 A;  2QA2 A;  3H7H B;  4DHV A;  4C0H A;  3MF5 A;  3Q83 A;  2CPZ A;  1C0U A;  3LW5 C;  3LH2 S;  3QIP A;  4NYO A;  2W25 A;  3ENW A;  4L73 A;  3ZFV A;  3A13 A;  4OZ2 A;  4RR5 A;  4D3H A;  5KFU A;  2QLF B;  3P3D A;  3NP5 A;  3EE3 A;  4M1K A;  3T1H J;  3HHD A;  1LNQ A;  1WC6 A;  2CQH A;  1KWM A;  2ZVS A;  4WYL A;  4CNY A;  2MQP A;  4JI5 F;  4DSK A;  2E44 A;  5IOL A;  3PYE A;  4PWD B;  2AZ1 A;  2BJ3 A;  2IVM A;  2V2Q A;  3M05 A;  4P7V A;  3AD7 C;  5LMN F;  1WTB A;  1BWE A;  2ZDP A;  2AGP A;  3EGV A;  3PM9 A;  5LOQ A;  4YB5 A;  2FJA B;  2DCU B;  2QLB B;  1U8W A;  3DOM B;  1UFL A;  4W98 A;  4AL5 A;  2ZE2 B;  3M8P A;  4AXI A;  2VHG A;  1DZ5 A;  2OTJ S;  1NJZ A;  3RBZ A;  2B0G A;  3DRS A;  3EXY A;  4X4Q A;  3QT8 A;  3GSI A;  1WSR A;  4CI0 B;  4DL7 A;  2G2Z A;  2JLE A;  1H2V Z;  1NK7 A;  3QJP A;  1X31 C;  3LAK A;  2F63 A;  3GJQ B;  4IH6 A;  3G6Y A;  2M52 A;  2OEL A;  1NJX A;  1X5S A;  3OPK A;  3RAX A;  2Z4P A;  2QO3 A;  1DAX A;  4F4A A;  5E7O B;  3IRX B;  4A8S A;  2BQR A;  2RSQ A;  1EP4 A;  4ER8 A;  4O4G B;  3DLK A;  2XYP B;  1XEZ A;  1L3K A;  3HMJ G;  3BGU A;  4R8U A;  3ETO A;  1WC1 A;  3RR8 A;  5AE3 A;  3IS9 B;  4LQ3 A;  2VBX A;  3WZ0 A;  3D3C J;  1DBD A;  4Q2L A;  2NXJ A;  4OJ1 A;  4OI2 A;  4OX8 A;  3DYA A;  2KL8 A;  1QDU B;  3CJK B;  3OR2 B;  3TO8 A;  3Q8Y A;  2IM1 A;  2UV8 G;  3NGT A;  3IWX A;  2GS8 A;  2C2R A;  4IUF A;  4DR7 F;  2UXB J;  2D74 B;  2MGZ A;  3IRW P;  4FKX A;  2L48 A;  3D1H A;  1ZM2 A;  4MYT A;  4UZC A;  4F04 B;  4X4P A;  1RAD B;  1NLK L;  2MMY A;  2PE8 A;  2XZT B;  1WC0 A;  2F5G A;  2VAS A;  4DFK A;  1Q95 G;  2XMV A;  2FJE B;  3LA0 A;  1DTQ A;  4UOH A;  5JJB A;  1ZYQ A;  2K8G A;  2CQP A;  2RAQ A;  1J5O B;  4B9V A;  5A8R A;  1BGX T;  1QM9 A;  1D9F A;  2IMO A;  2K7K A;  1Y10 A;  2AEF A;  1BLU A;  2N3O A;  2XGQ A;  3HKZ D;  1OSD A;  1Q7Y T;  1HBU B;  4LF1 A;  4UST A;  3GLJ A;  3A4T A;  1U1K A;  2LQ8 A;  1TEL A;  2HQD A;  4BWM A;  4L76 A;  2G0C A;  2VG6 A;  3SZ2 A;  3H59 A;  3N4W A;  3BQ2 A;  3WX4 A;  2J8S A;  1LKZ A;  3TW0 A;  2E1A A;  1J27 A;  4AXJ A;  1Z2L A;  3AD8 C;  1JLE A;  2XCA A;  4CH0 S;  1C1C B;  1N88 A;  1GMW D;  5GAG U;  2QV6 A;  3FJ2 A;  1QAX A;  2WW4 A;  3K89 A;  4ID8 A;  4FF4 A;  4LRF A;  2XY5 A;  1RT4 B;  5L1I A;  3DI6 B;  1H98 A;  5KFO A;  1N0V C;  3S01 A;  3ET6 A;  4A47 A;  3M9N B;  1WHY A;  2HGN A;  1UEU A;  2N4C A;  4R5P B;  4EYI B;  2C3P A;  5I42 A;  3QRP A;  2MKC A;  5FD1 A;  2NR0 A;  1IBC B;  4RW6 A;  2G0I A;  1TUW A;  4URQ U;  2PEH A;  1ZM9 A;  3CDB A;  1S6Q B;  4D3G A;  1FXR A;  3B54 A;  3KUG A;  4ZVT B;  5EDW A;  4M95 A;  3NXZ A;  4DQR A;  2JFD A;  2FUG 9;  3MM9 B;  2NRE A;  4MK9 A;  3QQC D;  3QYY A;  4LBI A;  4WE1 A;  3V6D B;  4KO0 B;  5F41 A;  3PEJ A;  3DRX A;  1RKI A;  2MQ8 A;  4LUB A;  2H5E A;  1T3N A;  2OAU A;  2HW3 A;  5GME A;  1R0C B;  1S49 A;  1ULR A;  3OFE A;  2NYI A;  2PII A;  4DPY A;  4MK8 A;  5CAA A;  3VAG A;  1RAG B;  1SJQ A;  2HS4 A;  4GO7 X;  2HVI A;  1N5Y B;  3EXC X;  2KVI A;  3UNG C;  1SJ1 A;  3NAI A;  1TUG B;  1HBU A;  1U0S A;  3QMQ A;  4FYV B;  4IG0 B;  1B4S A;  1N5Q A;  2WB1 D;  4KQZ A;  4LBH A;  4OI6 A;  4UZB A;  2IDL A;  2V34 A;  2YNG B;  3DOK B;  2F4F A;  4DSL A;  1HHQ A;  2J8A A;  2QTW A;  2OML A;  1S9G B;  2XMK A;  1UFK A;  4C7Q A;  2BM0 A;  5KT6 A;  4NEZ A;  2BUN A;  3AB2 B;  3DMJ B;  4WYW A;  2ZM6 F;  1Y3K A;  1FRM A;  3LGH A;  5J1P A;  4QU6 A;  4BC7 A;  4YY3 J;  5K14 B;  5M2R A;  3UPF A;  5ITH A;  3BN7 A;  2RH3 A;  3L7P A;  3VZH A;  3C2P A;  3GFH A;  5DDO C;  3KLE B;  2VH7 A;  2N4D A;  2OHD A;  1TKT B;  4I2Q A;  5J2N B;  2R3V A;  4OZJ A;  1TVR A;  4PWW A;  3LQV A;  5F8I A;  3A3N B;  2CQ2 A;  2E5G A;  2IFX A;  2V4J B;  4WE1 B;  5E33 A;  1WWH A;  2R8I A;  4X4O A;  3VAJ A;  4JI0 J;  2M9K A;  3HZG A;  1FNM A;  3R27 A;  2IY5 B;  2YQ0 A;  4FF3 A;  2DGS A;  1QE1 A;  3W5Z A;  1FRI A;  2C3M A;  2D3U A;  4P2M A;  3TR5 A;  1HQU B;  3ZXW A;  1RBO B;  3D67 A;  1NND A;  2XMW A;  2Y1R I;  4N41 A;  1UVL A;  3TVZ A;  4JI7 J;  2ZNZ A;  3EWG A;  1M5P C;  2CNO B;  1R6V A;  4FS1 A;  2AEJ A;  1IKY B;  1I3O B;  2H9Z A;  4WXW A;  4XK8 C;  3QID A;  1UAW A;  3BSA A;  1GAO A;  1MSW D;  2VFS A;  3UD4 P;  3QT6 A;  4WP3 A;  2QA4 S;  1S9E A;  2EVZ A;  2HSE B;  1SH3 A;  4NLR A;  1M5K C;  2RDD A;  2MTL A;  3HD1 A;  4K50 A;  2ZH9 A;  4EK2 A;  3C16 A;  3C15 A;  1T03 B;  3BO2 A;  2DHG A;  2F65 A;  1YGY A;  2OPR A;  4M63 A;  2U1A A;  4IG0 A;  4OYW A;  3A8I A;  1T9X A;  2R4F A;  2HMI A;  1Q53 A;  4ZVG A;  1YZ7 A;  3R5D A;  1H74 A;  2OGU A;  1NM2 A;  3T41 A;  5HMZ A;  4TQS A;  1KLN A;  4OV1 A;  4K5S A;  3PRV A;  1U47 A;  3OTD A;  2XWX A;  1UL3 A;  1TVR B;  2JWN A;  3I87 A;  1QVG R;  5K14 A;  4J9N A;  2FLO A;  3IM9 A;  1XNR F;  3IM8 A;  4ZVE A;  5FDL A;  4JI2 J;  1P1L A;  3VTI A;  3D6T B;  3K5L A;  1K8A T;  7FD1 A;  5DDP C;  2CJB A;  4AUK A;  3D0G E;  4OYB A;  3MMJ A;  1IJF B;  2WCX A;  4P2X A;  5CH7 B;  4PKD B;  1NKE A;  4A4J A;  2W2N P;  3R7N B;  4ED1 A;  2R7V A;  1VIX A;  2CWX A;  2HRY A;  2RU3 A;  1Y5L B;  4DFP A;  1WG4 A;  1NB2 A;  2W2M P;  3V4I A;  3GYN A;  1BUX A;  1FI4 A;  1MWQ A;  5CHC B;  2FLN A;  4OHV A;  4RLE A;  3CNQ P;  4JI4 J;  5IZH A;  3FZ2 A;  4M5N A;  2MZ1 A;  1FWP A;  2KHC A;  3HVA A;  2M7S A;  3MCM A;  4FYY B;  4S0M A;  3OXG A;  4K4X A;  1REG X;  5I42 B;  1R31 A;  4OX9 J;  2D1C A;  4ZDN A;  1U1L A;  5EWG A;  3QO9 B;  2QT7 A;  3GZ7 A;  3IAS 9;  1RAE B;  4PYA A;  1CQM A;  1X4E A;  1WEX A;  3SYZ A;  2HMI B;  4KHM A;  3QZ7 A;  4F2S A;  2LYV A;  4CNZ A;  4ILL A;  1HNZ F;  2PC6 A;  2UVW A;  2V8V A;  2EK1 A;  2YTC A;  3W9J A;  2BXJ A;  1P6T A;  5J2Q B;  1LWF B;  3F41 A;  2IHR 1;  4F7V A;  1PBU A;  3PHT A;  4DL6 A;  3FQK A;  2R8J A;  4KPC A;  1Q8I A;  4PR6 A;  2DB1 A;  3FEY B;  1V3S A;  1RI7 A;  3FFI A;  1NJY A;  1DQ9 A;  3K59 A;  4EBD A;  2HQI A;  3UWT A;  2PD1 A;  1NO8 A;  3MEC A;  3RB0 A;  4FF1 A;  2W4C A;  1K0T A;  3DFE A;  2CVI A;  1NK0 A;  3D9B A;  3QGP A;  2V8D A;  5GMD A;  2WON B;  5KFA A;  3NGU A;  2Q6B A;  3MEG B;  5LXR A;  4G1I A;  2YX4 A;  4Z7C A;  4B9T A;  4ALZ A;  4JYA F;  1X4A A;  2YWF A;  3MMA A;  4LBP A;  4O23 A;  2QLJ B;  4EEY A;  2RDJ A;  4HH1 A;  2KXF A;  3CIZ A;  2W24 A;  4NLD A;  1H0H B;  2OI2 A;  4USH A;  1RTH B;  1UMJ A;  3MM8 A;  4HLB A;  2B9E A;  3ADA C;  2AP6 A;  3EVO A;  4KY3 A;  2ZWO A;  2VQF F;  3GIM A;  5T41 A;  4Y2M A;  2G2Y A;  2MZT A;  4FF2 A;  1A6L A;  5EN1 A;  4DN0 A;  1LK5 A;  3BKU A;  3NLC A;  1K9M T;  2FLL A;  5A0Y A;  3UW1 A;  2DIU A;  1IKV A;  4NCG B;  4QIG A;  2QMW A;  5KG0 A;  3ZZR A;  2QFJ A;  3M8Z A;  1AB8 A;  2ZUG A;  4F0K A;  8RUC A;  3KK3 B;  4DR3 J;  2A6O A;  1JLQ A;  5BXI A;  3VZI A;  1KSP A;  1RWV B;  1S12 A;  2VFV A;  3BO4 A;  1Y5N B;  4TLQ A;  3KYL A;  2MKK A;  2AJQ A;  1WOR A;  2EXU A;  2MQQ A;  2HHH J;  1MWZ A;  2MYF A;  3LP2 B;  1M5O C;  1S7H A;  4RNM A;  2P2C B;  1RT4 A;  1YVF A;  4NRT A;  5IWA J;  4F50 A;  2A2D A;  1LWF A;  2KFN A;  4LSZ B;  3DHX A;  3HFV A;  1YJT A;  2B7B B;  2V2K A;  2RS8 A;  1KLM A;  3JSY A;  4KGV B;  3W8P A;  1N54 B;  4I64 A;  2WSC C;  3AD9 C;  1RU1 A;  1WF0 A;  2G13 A;  1ELO A;  1CJV B;  2PFD A;  1NH8 A;  1UW9 A;  3LPE A;  3M1V A;  3GR0 A;  5KG3 A;  3ZZZ A;  2LQB A;  5GAD U;  2LLZ A;  3DRY A;  3R5G A;  1KNZ A;  4QYZ J;  2C3Y A;  4U7U K;  3GII A;  3C66 A;  3HI9 A;  2BKN A;  4QWC A;  5IWA F;  3R7B B;  4LSL A;  5C25 A;  3N6M A;  4Y28 C;  4NLU A;  1AFJ A;  1HA1 A;  3GIK A;  2RRA A;  4HAC B;  4DV0 F;  3WIV A;  1IKW B;  3M4X A;  3PCO B;  3RGI A;  4F36 A;  4PAB A;  3RR7 A;  2VQE F;  2WRM A;  4FXW A;  1FFG B;  1X0F A;  2BJ8 A;  3K0J A;  3K2Y A;  5HAN A;  4ANE A;  4KHR A;  1NCL A;  2EG1 A;  2DIT A;  3MOJ B;  3DLJ A;  2UUT A;  5CD4 A;  3KK3 A;  4ED8 A;  2YH1 A;  5ETS A;  2JC1 A;  3IG1 A;  2V2Z A;  4BWJ A;  1D9D A;  1RXO B;  2OEK A;  1TKZ A;  2CQG A;  4MKA A;  2GGP B;  1BMQ B;  2OIH A;  4GKJ J;  5DRK A;  3HHL D;  2PDA A;  4XTT A;  2B7C B;  4A48 A;  3F44 A;  3RTV A;  3TAP A;  1VLY A;  4DEZ A;  4I68 A;  3MUR P;  4J9P A;  1JKH B;  1KC8 T;  4ZJL A;  2F8M A;  3VQT A;  4AT1 B;  4X62 F;  2EW9 A;  2YXL A;  2ZFH A;  4W90 B;  2RJZ A;  3R6G B;  1FXL A;  1LOU A;  2O3D A;  4OI3 A;  4TLR A;  5A6P A;  2G0J A;  3CCL S;  1A9N B;  2UU9 J;  2W8K A;  1FDN A;  1UKU A;  2GQQ A;  2X3G A;  2HRT A;  2W8L A;  2GAG C;  3W2V B;  5EWE A;  3GG1 A;  3MPU B;  5BYQ A;  5CXT A;  1NHK L;  1BHN A;  4LSL B;  1UET A;  3O8W A;  3QLH B;  5C25 B;  1S10 A;  1KRP A;  1FJC A;  5F8M A;  3M2R B;  2FHO B;  3HX9 A;  4O3Q A;  1N32 F;  3MR3 A;  4CIO A;  4EO8 A;  2DO4 A;  1F2H A;  2E5L F;  4ZMM A;  1R43 A;  2IAJ B;  3OT9 A;  3MXH P;  3DDK A;  1LQ9 A;  1JLF A;  5A8K A;  4DR1 F;  1FXD A;  1SIW B;  3VR1 A;  5DQG A;  4QR1 A;  2VBY A;  4ID5 A;  4K5R A;  4NMX A;  4WIQ A;  4EZ9 A;  1SJ3 P;  2IIH A;  3U1M A;  2CNN B;  1VIO A;  3HUL A;  2CNK B;  3BPS P;  2RD5 C;  3EUN A;  4PPZ A;  2VFU A;  4A8Y A;  4M8L A;  2ZH1 A;  3PX6 A;  4B3R F;  4DV1 J;  2DGV A;  2W4P A;  1TR0 A;  1SVD A;  3HHL B;  5F3Z A;  2O5D A;  2CXE A;  1GT8 A;  5B09 A;  3DRR A;  2DR9 A;  1FE0 A;  1T05 B;  1M5V C;  1XIQ A;  1FX2 A;  1FNX H;  2O1P A;  4DV3 F;  1LW0 A;  3OUY A;  3OR1 A;  5EUH A;  3MED B;  3VGT A;  2DNP A;  3TZW A;  4C0O C;  2XY7 A;  2AYB A;  2DPI A;  3BGR B;  1UZH A;  1MWY A;  1T9W A;  4LFA J;  4F67 A;  1NUE A;  4WK1 A;  3T19 A;  4DPX A;  2XEX A;  5AE1 A;  4YHH J;  4PQA A;  1RQ0 A;  2CJQ A;  5M2U A;  3J7Z 5;  4B3R J;  4RPF A;  1X0P A;  3GON A;  5DM6 Q;  2YY3 A;  4AE5 A;  1MW7 A;  1HD0 A;  5AJ3 J;  2W9A A;  3BGF A;  3W2V A;  3TQ1 A;  3MM5 A;  2ZH5 A;  4ZCM A;  4RNN A;  4YOE A;  3LGM A;  2V6A A;  3QWU A;  3SSR A;  5CD4 H;  2CJ9 A;  2YWH A;  3PW2 A;  1ZAV A;  2LEP A;  1AUS L;  3E01 B;  3TP2 A;  2RUG A;  5KOW A;  4ANC A;  5F8H A;  1REV B;  3SFG A;  3FSI A;  4NXM F;  1HHS A;  1FJG J;  1Y9O A;  1I51 B;  4DX5 A;  2J7U A;  2MKY A;  4CO3 A;  2AYE A;  5J2Q A;  1VQO S;  1MG7 A;  1ICE B;  3B8H A;  3SI8 A;  2BV3 A;  4CWB A;  5KG4 A;  1KQK A;  1YIT S;  2DXE A;  1S0O A;  4WF9 Q;  2NXN A;  4AND A;  2RNE A;  2A0F B;  4ZCK A;  1NAQ A;  3MEE A;  4NI2 A;  3HM9 A;  4NXN F;  3DHW C;  5F8N A;  1CJK B;  3MEK A;  1XMB A;  2P9E A;  2GAH C;  5ETV A;  4H4O A;  1NDP A;  3ET6 B;  3RB3 A;  2BDP A;  2ZVI A;  2CPI A;  2ZBC A;  3QT7 A;  3NNH A;  2YPY A;  4B08 A;  3KLH A;  2CPY A;  3M32 A;  3D6H B;  2BR0 A;  3H5X A;  3MOZ A;  4USM A;  3BJY A;  2KG1 A;  2JDJ A;  5KFF A;  2KG0 A;  3H4D A;  3G86 A;  1RSC A;  4DL2 A;  3SFU A;  2B6A B;  1YZ6 A;  3ILJ A;  3MR2 A;  1VIS A;  1AXQ A;  1SBR A;  3G6V A;  4JI3 J;  1TFW A;  4PWD A;  3HLU A;  4LR8 A;  2M3D A;  2RQC A;  3BBB A;  2HVE A;  1S1X A;  4OZ3 A;  5B0A A;  1VJQ A;  2B5J B;  2DGX A;  3F73 A;  3JB9 k;  4KHP F;  4GVB B;  4Y00 A;  4OYA A;  2IRU A;  2FJX A;  2UUW A;  1F2G A;  1GEH A;  1VRQ C;  2M88 A;  3H98 A;  2D3O R;  1L3U A;  1QAJ A;  2R7Q A;  1Y5I B;  2K06 A;  3DRS B;  5KFY A;  4R0E A;  4ZPC A;  3UR3 C;  3MUM P;  2AX1 A;  2HVH A;  1ROF A;  3MUV P;  4WU2 A;  4FNH A;  1ZAW A;  3W63 A;  2ZHA A;  2JNJ A;  4ZCI A;  1Y11 A;  3M8S A;  4U7U D;  5HMX A;  3MUT P;  4C97 A;  1U4B A;  1U24 A;  3GSD A;  5D0R A;  5J1E B;  4X64 F;  1VC0 A;  4G1Q A;  1B0V A;  3TJ9 A;  1QLN A;  5H9E J;  3PNI A;  4KBI A;  1QSS A;  4L3K A;  5A0Y B;  3I56 S;  2NLW A;  1D0E A;  3ENA A;  1VOM A;  1KLM B;  1RT7 A;  2YNI A;  3EZU A;  5F0W A;  2V4Q A;  4XPE A;  1M0S A;  2G4B A;  1ZA1 B;  3M2V A;  2QIF A;  4NI2 B;  2CJA A;  3GYX B;  4TY8 B;  4C3K A;  6FD1 A;  2WK4 A;  5HJY A;  3CDA A;  4NLO A;  3V2U C;  1U1R A;  2FTR A;  4PG8 A;  1UCN A;  1BWV A;  2XSJ A;  8AT1 B;  1PKU A;  3IR7 B;  1WHW A;  3MPY A;  3POT A;  2E9T A;  2IYI A;  2JHE A;  1JJ2 R;  1WI6 A;  3EYZ A;  3K7R A;  3AXK A;  1G3O A;  1JMT A;  2WAQ D;  3R5A A;  1TK0 A;  1F5A A;  2E5H A;  5CYJ A;  4PXE A;  3MDF A;  1U09 A;  2ZJP Q;  2BBE A;  3AA9 A;  3VQS A;  1NJI T;  1FDB A;  2FHK A;  3TWZ A;  1S1W B;  4JI8 F;  3C6U A;  5HO4 A;  2C3O A;  4C3L A;  1N52 B;  5EX0 A;  2RQK A;  4ILR A;  2CAJ A;  3CIM A;  3GMG A;  3MMC B;  2JSX A;  3MZI A;  2EPI A;  4ZPV R;  1X9W A;  5RUB A;  2X7I A;  3FQL A;  2L9W A;  1YQH A;  3M8W A;  3KHH A;  4WFB Q;  1Y00 A;  5J2P B;  1JLE B;  4DL0 C;  3D0H E;  4BS2 A;  1RLC L;  3H8Y A;  2A2C A;  2ILY A;  2GIQ A;  1WOS A;  3O5T B;  2LVW A;  2FJD B;  1RUS A;  2M2B A;  1I6J A;  3CPW R;  4OHY A;  3DN9 A;  2GML A;  3EDR B;  1ZM3 A;  2OPQ B;  4B3T J;  1NU4 A;  2OKQ A;  5HAT A;  2MPU A;  4WXO A;  3KLI A;  1R7I A;  4CYU A;  5CAB A;  2YWG A;  4B9S A;  1GMV A;  1GXU A;  5AXK A;  1GTH A;  5ETT A;  2WB4 A;  4ED4 A;  2Z8Q A;  2RRB A;  4NOH A;  4DQQ A;  3IR6 B;  4IRD A;  1UWB A;  2F9D A;  4MT1 A;  1CJT B;  4ZHR B;  2KT2 A;  2C1E B;  5LJ5 Y;  7FDR A;  3GIL A;  3M6V A;  4ZPT R;  4NEY A;  4DU8 A;  3MM9 A;  2FY8 A;  3PO5 A;  1YRT A;  2FHJ A;  1URN A;  1VQ4 S;  2XS7 A;  1IBL F;  2ABY A;  2AGQ A;  4O44 B;  2R7O A;  4USW A;  2BJ9 A;  1P1T A;  1VJW A;  2A18 A;  3GE9 A;  1FO1 A;  3NOC A;  1HBM B;  1WEZ A;  3NL0 A;  3RG6 A;  5KG1 A;  4U7C A;  1XTZ A;  2HGL A;  4ZVF A;  5HVH A;  4KJI A;  4LJM A;  2DNO A;  4CM0 A;  1FJ7 A;  4CP5 A;  1WSV A;  1RWP B;  2OPS B;  2H4W B;  6FDR A;  4PG4 A;  4DR2 F;  4OYO A;  3QO9 A;  3ZTP A;  4UQT A;  2IA0 A;  3CC4 S;  1IWA A;  3H2U B;  4U8V A;  3CUN A;  3P5T L;  2QMU B;  2ZD1 B;  3L95 X;  2ZKU A;  3W64 A;  2IJR A;  3KLI B;  2MHE A;  4CYU B;  2J6S A;  3WDO A;  1SI9 A;  4NA3 A;  4KYZ A;  2DGO A;  1MMD A;  2KYX A;  1C0T A;  3R5B A;  3OTO J;  4X4N A;  1E6V A;  1VHF A;  4NA2 A;  3O44 A;  5C2G A;  2ZBQ A;  4DS5 A;  3PZP A;  3HHE A;  1CJT A;  1U2C A;  5LT5 A;  3MMB A;  4G65 A;  5KFB A;  1RT3 A;  2D69 A;  2ZBR A;  3CCV S;  5LMN J;  3KMQ A;  4ZN3 A;  1VDH A;  4J9M A;  2AT1 B;  2C2Z B;  3AOB A;  1ACM B;  1EKS A;  1M1G A;  1TKX A;  2MEW A;  4H4K C;  4UW2 A;  1HQU A;  2HWI A;  1TL7 B;  4UT4 A;  4LF9 F;  2B9Y A;  2LKZ A;  2RUS A;  2K2P A;  4PRF A;  2C22 A;  4OJH A;  3CJS A;  4F4K A;  4O3N A;  4ECR A;  4RZR A;  4JV2 A;  4Y65 A;  2D9P A;  3CJQ A;  2L08 A;  2ZH8 A;  4I6Y A;  2A3J A;  2AJ0 A;  3CDU A;  4QJV A;  4ZA1 A;  4V19 J;  3PX4 A;  2YBV A;  1R27 B;  2UZA A;  2CUY A;  3R5J B;  4LVN P;  1FK9 A;  1WDD A;  2LXI A;  4P2S A;  3J80 U;  4OFZ A;  2WVD A;  2C2M B;  3RAQ A;  3IGV A;  1VBY A;  1S1U B;  2KH9 A;  5HVG A;  3KFW X;  1LV5 A;  4RU9 A;  1HWJ A;  5LMU J;  2DNL A;  2E66 A;  2RE1 A;  5CZX A;  3AH6 A;  3ILL A;  4JV0 A;  3KK1 A;  4DUY F;  4FXD A;  4HYK A;  2LA6 A;  4I2P B;  4WWS A;  2GQC A;  4U9R A;  1RZM A;  4RW9 A;  4CLP A;  1S9E B;  1AZS A;  1IM4 A;  2IC3 B;  4DR6 J;  2HHT A;  2VKR A;  2WOM A;  4OI1 A;  1FDD A;  1S0V A;  2CKW A;  1V9O A;  2F40 A;  4JB8 B;  3T5J A;  2CDR B;  3DLK B;  3HP6 A;  3NMR A;  1KOO A;  2BEF A;  1HMV B;  2VPY B;  3CO0 P;  4KR0 B;  5HMW A;  3CUL A;  1XN9 A;  1RT6 A;  3ISZ A;  4H4M A;  4WP9 A;  4PG5 A;  1RP5 A;  1CBK A;  4LIW A;  5BR8 J;  3VVT A;  3V6H A;  3FVY A;  2AZ3 A;  1HI1 A;  3IBF B;  3PO4 A;  1I5O B;  4B3O B;  3H40 A;  4USI A;  3CSK A;  1FVS A;  2MZR A;  3CWJ A;  3GJS B;  3NGD A;  3IAM 9;  4NLV A;  3KJF B;  3NNA A;  5D3G B;  5E3R A;  2JJ4 D;  2EKY A;  3M6U A;  2ZOG A;  4DUZ J;  1HPZ B;  3PFE A;  2KT5 A;  2DGW A;  2WZ1 A;  3JQJ A;  1W2B R;  2UUC J;  1B99 A;  3ZZY A;  2DNM A;  1JLB B;  5KFP A;  1SC3 B;  3DOL B;  2EBE A;  3PEH A;  5D77 A;  3VCD A;  4CLZ A;  3M7V A;  5FLX Y;  4AQY J;  2C2D A;  3P6Y C;  3C46 A;  3UE2 A;  2XTJ P;  4JP8 A;  5E3A A;  3KDN A;  2VPW B;  3BKT A;  3OTB A;  5F0U A;  3ZZO A;  4DL5 A;  2LA4 A;  4RUH A;  1U02 A;  3OXF A;  1N36 F;  3EIC A;  4DX7 A;  1KQS R;  2R7S A;  3I4P A;  2CFX A;  3M30 B;  4A8M P;  2B6A A;  1S0M A;  3VAK A;  3RW7 A;  4PEO A;  1SQG A;  3CCT A;  2NSB A;  1RWO B;  2UVV A;  4X65 J;  4JI1 J;  1NPR A;  4J5O A;  4K4V A;  3GP9 A;  3Q8R B;  4HHJ A;  3OQ2 A;  4TNO A;  4RUA A;  4A8K A;  1JWW A;  2IBK A;  3DLG A;  1Z4U A;  3N5F A;  4HL9 A;  1U6B A;  3N0V A;  4LF8 J;  4QIE A;  2CPH A;  3F0N A;  4ILM A;  4C2M A;  3QSI A;  5LM7 E;  4EGL A;  2H4Y B;  1FTC A;  1RBA A;  2YNF B;  2M8H A;  2EFV A;  3SDE A;  2AF6 A;  3I5C A;  1X8D A;  2Q43 A;  5D3G A;  1OY9 A;  3QGG A;  2EC2 A;  3MM6 A;  1FFW B;  3U1N A;  4DOZ A;  2GIR A;  3W60 A;  2R7W A;  1ZPV A;  2FGO A;  3I0S B;  4C6A A;  4Z2X A;  4F8R A;  2WON A;  4CT9 A;  1EHW A;  2GO8 A;  1T0T V;  4Z7Y A;  1E6Y A;  5KTQ A;  5L39 A;  5GAE U;  2BOA A;  4LF7 J;  2IAJ A;  2DR8 A;  3PKM A;  1UFW A;  1WG5 A;  4M5D B;  2L41 A;  3KWM A;  3OFH A;  1GXL A;  4M5J A;  1S1T A;  5ETL A;  1Z2Z A;  3Q2T C;  4N47 A;  4ZLL A;  2RQM A;  3NNC A;  2YNH B;  3CJ2 A;  3GV7 B;  1RA6 A;  2PGC A;  3T6B A;  4L6V 3;  1PAU B;  3UR0 A;  1VQ9 S;  5KFR A;  2VJU A;  1N36 J;  3EVW A;  4DV7 J;  4C98 A;  2QGF B;  3TUP A;  2G1H A;  4ZVS B;  3KMS A;  2GMJ A;  2HK2 A;  4Y34 A;  1S6U A;  1TUV A;  2AW0 A;  3K5P A;  4RW8 B;  4Y3C A;  4AQY F;  2KRR A;  1LWX A;  2ZDO A;  5KG5 A;  1RWK B;  3AT1 B;  4QWA A;  4ED2 A;  4YP3 A;  3DKD A;  4N56 A;  5IT9 U;  4GVL A;  2I9S A;  4XIU A;  2E9Z A;  1UPM B;  1XJW B;  2BVZ A;  4QQB A;  4JI6 F;  4ZHR A;  5I3U B;  2JLG A;  3OV7 A;  3MED A;  4LF4 J;  2VON A;  1B64 A;  1RCX B;  2OPQ A;  4Q7A A;  2HHW A;  4PXC A;  2GC8 A;  3KK2 A;  4EWT A;  2VB6 A;  2BQ3 A;  4P10 A;  1AW0 A;  2NPI A;  3M8Y A;  4CTA B;  2X1B A;  3CMQ A;  3PYG A;  4WKY A;  2XCP A;  4TU7 A;  2C2E A;  1Y0H A;  3KLG A;  3THT A;  3AY0 A;  5DLF A;  1WOP A;  5L9X A;  5AXN A;  3Q23 A;  2C2O B;  4H54 A;  4EMD A;  5LSR A;  1U6Z A;  3KHL A;  3PXG a;  3FKB A;  3EPG A;  1U1M A;  1TK5 A;  5KT7 A;  1LK7 A;  2HS0 A;  1YRX A;  5AJ3 F;  4DR6 F;  4V19 X;  2DNR A;  2LP4 A;  3B78 A;  5G0R A;  3TUJ C;  1HBO B;  4DV3 J;  1SQE A;  1E6Y B;  2AJ4 A;  5DG9 A;  3V6K A;  3G82 A;  3NWR A;  4AYB D;  3DC2 A;  2GVZ B;  4DUY J;  1U1Q A;  1PO6 A;  2LQ5 A;  4CQ1 A;  1RYS A;  2FVP A;  5KFW A;  1VQN S;  1NZA A;  1Y4Z B;  4M5D A;  4JV1 A;  5HBM A;  1W25 A;  4USK A;  2AV5 A;  4TU9 A;  2J0Q D;  4MFB B;  1SH2 A;  3LP1 A;  2VG7 B;  4KKO B;  2PFF B;  4OJG A;  2MY8 A;  1HYS A;  1FRK A;  1OQ3 A;  4AD6 A;  3DXS X;  2HHQ A;  1JQG A;  2LFV A;  3Q8U A;  3TOQ A;  4TYB A;  1IKX B;  2ZH3 A;  5J2M B;  3OVA A;  1TZ0 A;  4QYR A;  4NCA A;  2VJV A;  1KVJ A;  1O0P A;  4V1A k;  3CGI A;  2WHO A;  4DV4 J;  4C8L A;  4CZC A;  4DQP A;  3BH7 B;  1TL1 A;  1IUJ A;  4Q44 A;  3GIJ A;  1KHW A;  2PA3 A;  3KLG B;  1N48 A;  1IBK J;  3GFZ A;  2VOO A;  4G6V B;  1FCA A;  1HQ2 A;  2HRU A;  1OY8 A;  1HQE A;  4DV2 J;  1ZH5 A;  1JIH A;  4PCQ A;  4WP8 A;  2ATC B;  2HIQ A;  1F9H A;  1SCJ B;  1EAY C;  1U7L A;  2C3U A;  5D4P A;  4RNO A;  1S9F A;  2OD4 A;  3DXB A;  4DFJ A;  2CPE A;  2WVE A;  1T94 A;  3I0R A;  4MIW A;  1HW9 A;  5H9F J;  4GVB A;  2R7T A;  3DDI A;  4RKU C;  2AQ4 A;  4QPT A;  3CC2 S;  3CCR S;  2BAB A;  1SUQ A;  3PG9 A;  5BYR A;  1MMN A;  1R8A A;  2HFS A;  3N79 A;  5B0C A;  5C2C A;  3HF5 A;  2YVS A;  2CPX A;  3OXL A;  2IYG A;  4FNI A;  4NX9 A;  1FK9 B;  4OLP A;  3HSZ A;  5FLX U;  2CYY A;  3EX7 B;  1KN6 A;  1N5Y A;  1WAC A;  2R7R A;  5HRO A;  4JYA J;  1N5T A;  1RT6 B;  4H4M B;  4QU7 A;  4J9L A;  3HCX A;  1KQG B;  1BE4 A;  4N8O A;  3PFO A;  5HVF A;  5HBM B;  1FES A;  2LEB A;  1MLA A;  1FWK A;  1IBL J;  2V68 A;  3PDN A;  1HNZ J;  4C9D A;  3CCZ A;  3JYT A;  4WTO B;  1PJ7 A;  4DSE A;  3GCX P;  3WBZ A;  3C3L A;  3CB4 A;  1CEZ A;  2ZHO A;  1RWU A;  3LWM A;  2CQ3 A;  5KFV A;  2R7X A;  1T9T A;  4IH5 A;  4WFX A;  1VLO A;  3UO0 A;  3BKF A;  3AAW B;  2CJY B;  4OZL A;  1AZS B;  2IC3 A;  5KG2 A;  2XMU A;  4OHX A;  2NSC A;  3OTE A;  1HKA A;  3OHA A;  2AU0 A;  4ED0 A;  2FVR A;  4ZLJ A;  4OLO A;  3KLF A;  5LSL A;  4LMZ A;  3QNW B;  4ZVH A;  1DJ0 A;  2CPD A;  2V4J A;  4EUV A;  3MHY A;  3IR5 B;  1C1B A;  4J9R A;  4O3R A;  1LXJ A;  2Q6C A;  5KFH A;  3OJU A;  2XO7 A;  3GV8 B;  1PCA A;  3SMZ A;  2VA2 A;  4ZIW A;  1JNR B;  2GV1 A;  2CAD A;  1YBA A;  1IWG A;  4O0I A;  1FTR A;  1HNV B;  2H3E B;  3HT0 A;  2ZH2 A;  1I94 F;  1NHU A;  2VBW A;  4WFN Q;  2MQM A;  2IDE A;  2VPX B;  1XR6 A;  4J9U E;  3LUY A;  5L1K A;  5GAE I;  4A8Q A;  2XY6 A;  1R8C A;  1VRT A;  5HK4 A;  3PRB A;  4KFB A;  1UEK A;  5D15 A;  4DPU A;  3HPO A;  2IJF A;  1PYO B;  1KEK A;  1IJE B;  3A8E A;  1C4C A;  2FVC A;  2QYC A;  3A12 A;  3W9I A;  1K44 A;  1RTH A;  2F9J A;  2XMM A;  2MJN A;  5HRO B;  2CQD A;  3M9O B;  3RBD A;  1PGZ A;  1SKR A;  1X4C A;  5H9F K;  2VOD A;  2JC0 A;  3HXM A;  3ETM A;  1CG2 A;  2M4M A;  2FDN A;  4DPO A;  4P71 A;  1NEE A;  3BZQ A;  3CJK A;  5DGA A;  1S77 D;  2VL1 A;  3R8Y A;  3PV8 A;  4ZPW R;  4UOG A;  1VQ8 S;  2XC9 A;  2HQ3 A;  3P96 A;  4WII A;  3WC0 A;  2MGZ B;  1WHV A;  3FDS A;  4C48 A;  1IR0 A;  1R8H A;  1WHX A;  3ZTR A;  3MFI A;  3MAQ A;  5KT5 A;  3QJL A;  2KXN B;  3W61 A;  4OZN A;  2UUA J;  3P4U B;  4C3M A;  1MU2 B;  4ZIT A;  4USJ C;  1CVJ A;  1SB6 A;  2YNH A;  1MRO B;  2QEX S;  3MGJ A;  5IV3 A;  1RAO A;  1FWL A;  4DCP B;  3M2U B;  4A8F A;  1HLW A;  2KJW A;  3W65 A;  2EFQ A;  3R5C A;  1RDR A;  1HWL A;  1U6F A;  2GIF A;  4JI0 F;  2KDO A;  3CVK A;  4AFF A;  2DXF A;  4K4T A;  4LRC A;  3CJ0 A;  3ISN C;  3IWN C;  3R2C J;  4LFB J;  2Y1I A;  2B9W A;  2DY9 A;  4CLL A;  2HHS A;  4HTJ A;  4WCE Q;  4AL6 A;  2J5A A;  3T5H A;  1RHJ B;  3DI6 A;  5M2P A;  2FJV A;  4F02 A;  4ICL B;  3MD3 A;  2N3L A;  3SQG B;  3X3U A;  4U95 A;  4JV5 F;  2B8P A;  2ILZ A;  4K4U A;  3OFF A;  4I7F B;  4NAS A;  4F2R A;  2EWH A;  2YH0 A;  2FGC A;  1RT1 B;  1OQ6 A;  4YDX A;  5A2Q Y;  2IMW P;  3AOC A;  2UP1 A;  2HBY B;  4PZV A;  5KT3 A;  4IR1 A;  2GGP A;  5L1L A;  3Q8V A;  2ZM6 J;  2RVJ A;  2YKN A;  1U1N A;  1F3F A;  5AT1 B;  2UXC F;  5DQH A;  3DLL Q;  3NAH A;  3FBB A;  2GJF A;  1S0N A;  2DEJ A;  1JJH A;  1WDT A;  2PN6 A;  2OP5 A;  1RA7 A;  2V8H A;  2RQ4 A;  4KGM A;  2Y0S D;  4KSE B;  3SCL E;  2AGO A;  3I82 A;  3FFI B;  5E2Q A;  4OYM A;  4B9N A;  2Y8Y A;  4CM2 A;  3IMQ J;  2Q66 A;  2DHH A;  1R8B A;  2FZK B;  3UDV A;  2E7W A;  1S6P B;  3QAT A;  4DL3 A;  3UCZ P;  3R7S B;  3GCW P;  1SXL A;  5DZ7 A;  4WZM A;  4UTG A;  2OFG X;  1TU0 B;  1ZAX A;  1HWU A;  2J7W A;  3B4M A;  4KH0 B;  1Q86 T;  4BLG A;  2XZD B;  5BJR A;  3D6F B;  5C7P A;  5A2Q U;  2MKJ A;  3TAR A;  1JLF B;  3NKY A;  4Y0F A;  4Q43 A;  1S1V A;  2E1R A;  2MZS A;  3C6U B;  5B0F A;  1R3N A;  4PXB A;  2BAN B;  1GMU A;  1K1S A;  1FJG F;  4DZD A;  3G82 B;  4DF4 A;  1VQY A;  1V6H A;  1YJV A;  4B3S J;  2P9C A;  4JI8 J;  3BYR A;  2FPH X;  1X4H A;  3HFZ B;  3PYD A;  3UN2 A;  3VVU A;  3W2W B;  4BC9 A;  2RU9 A;  3QWP A;  1Q78 A;  5KFT A;  4P75 A;  2DGQ A;  3SQG A;  2WOM B;  4MFB A;  3ZNU A;  2HEK A;  5K8P A;  1HBO A;  1CLF A;  1HMV A;  2NUH A;  4RWX A;  4OYX A;  2LEA A;  2GVZ A;  4MYU A;  1VK8 A;  1H6K X;  1FKP A;  2SXL A;  2DH9 A;  1FRL A;  2O01 C;  4IOC Q;  1NDC A;  2FIU A;  2IM0 A;  1DUR A;  4CO2 A;  1QY7 A;  2CVE A;  5CYM B;  5HAO A;  2ZH4 A;  3KUE A;  1SL1 A;  4DJB A;  1ZS6 A;  3LP1 B;  4FVC A;  4DPW A;  1XER A;  4ELT A;  3G9C A;  2E5I A;  3I0R B;  3BB5 A;  3NBP B;  4O4R A;  2UVU A;  2CZ9 A;  4JI7 F;  2XUL A;  1UP1 A;  2ALZ A;  3A1Y G;  1WKK A;  1U49 A;  5B0E A;  1JLB A;  3L3C A;  4J9Q A;  4KTQ A;  3DCA A;  3MM5 B;  4FN5 A;  1D8Y A;  3TAN A;  2VZ9 A;  2HHX A;  3AA8 A;  3TJ8 A;  2BKO A;  2C42 A;  4DX6 A;  2BE2 B;  4HT7 A;  4LVO P;  5AXL A;  3HT3 A;  5SUH A;  3R6L B;  4FZV A;  4Q5V A;  2WBM A;  4NL5 A;  4TVA B;  8ATC B;  2YKA A;  2HFU A;  2KT3 A;  3GG0 A;  2XB2 D;  4RNH A;  3B4D A;  4WBF A;  4QYZ K;  1KON A;  4HTI A;  1K73 T;  2OPS A;  3FBE A;  1C0T B;  2KO1 A;  3ITH B;  4K0K J;  1E6V B;  2GQ2 A;  3LPY A;  1N32 J;  3PYF A;  4UOF A;  5HJX A;  5HLF B;  2JEJ A;  2Y9H A;  2R2T A;  4KHP J;  2VC0 A;  3EPI A;  2AJ1 A;  3D68 A;  4JV5 J;  1FVQ A;  4JI3 F;  1UWA A;  2BMB A;  4A8X A;  3OR2 A;  5E5N A;  2UU9 F;  3UDC A;  4I6A A;  1KVK A;  1OWX A;  2OH2 A;  3IS9 A;  2OPR B;  1HHT P;  4UY8 T;  2ASY A;  1CSJ A;  4CCH A;  4X62 J;  3VF0 B;  1NSP A;  5E3P A;  3IBC B;  2D7S A;  4C8N A;  3TNV A;  3PKY A;  3DLB A;  1VC5 A;  4DPT A;  1UA1 A;  1SPB P;  1WKL A;  2Z2Z A;  1FD2 A;  3MPD A;  3TYT A;  3CW2 C;  5KFM A;  4EO6 A;  2PEB A;  4GKJ F;  4N7T A;  4CLY A;  3UD5 A;  3HKW A;  3DGP B;  4OX6 A;  2BW2 A;  4MKV A;  1IVZ A;  1FD8 A;  2HHV A;  1AFI A;  2VG6 B;  1S72 S;  4NLW A;  3T3F A;  3UCU P;  2LU2 A;  3GQC A;  5GAH U;  1FEE A;  1HNV A;  4X66 F;  3ITH A;  3BBF A;  2PMW A;  3TA0 A;  2HG4 A;  1HAR A;  2F8H A;  4C11 A;  3D1Q A;  5B08 A;  2VQE J;  3FNN A;  5HLF A;  1T7P A;  1FHT A;  3LF0 A;  5E0O A;  5H9E K;  3MAH A;  2QX0 A;  2R8G A;  3L7O A;  3KNG A;  3VGU A;  4NZ7 A;  3WQP A;  4ED3 A;  5K8M A;  3H4B A;  3TVY A;  3MEC B;  2BW7 A;  3E51 A;  4KIA A;  3AJ2 A;  1F3V A;  2VDI A;  4ZP6 A;  4CT8 A;  4F4Z A;  2B4O A;  2YNI B;  4LRD A;  1NRK A;  4ES3 A;  3H25 A;  1T05 A;  3MEG A;  2DNY A;  1KP6 A;  4RU2 A;  4B9M A;  3OR1 B;  5D0E A;  4GC6 A;  3S7R A;  1NK4 A;  4NZ0 A;  4M5L A;  3PHE A;  3VV2 B;  4YFU A;  2ERR A;  4USU A;  4CLU A;  2AKW B;  1M5S A;  3DLE A;  3EGN A;  3NS6 A;  3Q8S B;  4CLF A;  4UY8 5;  2XSJ B;  3OVS A;  1JLA A;  1S6O A;  1T9V A;  2NXU A;  4MMO A;  3VGV A;  2D3Z A;  3CJ8 A;  2V5H G;  4KO0 A;  3H5Y A;  3CMA S;  3VGS A;  1NKC A;  2POK A;  3J81 j;  4TY8 A;  2XYH B;  3MMA B;  2Y1L B;  3CJ3 A;  2E1P A;  4HHU A;  4DLG A;  1JJ4 A;  2HVD A;  2GZO A;  1NZ8 A;  3G8Q A;  4ECZ A;  5LSO A;  1IN0 A;  3JS9 A;  4M5M A;  4N8N A;  3UFC X;  2B4V A;  2VFT A;  3WIU A;  1TTH B;  1S4E A;  2XBP A;  1YSJ A;  1OS5 A;  1VFJ A;  2H54 B;  2MLX A;  3WHI A;  3EM1 A;  1VQK S;  1SKS A;  1S1W A;  3FMW A;  3MM7 B;  5T7L A;  3N6L A;  3PVX A;  3DGP A;  2NXE A;  1CJU B;  4URS A;  5DGB A;  3EZ5 A;  5DS7 A;  3DLG B;  4HI1 A;  2ZBI A;  3GB0 A;  4CO0 A;  2JEI A;  2QMX A;  4IO1 A;  3CDE A;  4IKA A;  3S1T A;  3MPV A;  3K8W A;  3V81 B;  1XR7 A;  1UVI A;  2XLK A;  1XWL A;  2E5L J;  2CIM A;  4R0J A;  1YK9 A;  2XI3 A;  1W2I A;  4YEA A;  3C8Y A;  3U02 A;  3AJD A;  3LP2 A;  1IXK A;  3OTC A;  5GAG I;  2YQ3 A;  3C6T B;  3CCW A;  4JUZ A;  4TQR A;  2RIJ A;  3UCG A;  2XG8 A;  1Y3J A;  2F8E X;  4I4B A;  3DMJ A;  2H5I B;  5EX3 A;  5KFL A;  2BA9 A;  3H0P A;  5D0H A;  2R8K A;  3J7A N;  4J9S A;  4DV5 J;  3M8Q B;  2CWK A;  2G2O A;  1C2P A;  3LAL A;  2YX1 A;  4OMF G;  1TAQ A;  2J9E A;  3AQP A;  3DU5 A;  3CD7 A;  2J7K A;  1D1U A;  4MTP A;  3K5N A;  1TL3 A;  2Z58 B;  2ZHB A;  4YS2 A;  4J37 A;  1B7F A;  3LO3 A;  4DV2 F;  5IT9 Y;  3NG8 A;  1RAA B;  3ZTO A;  3THP A;  1VS3 A;  2F7V A;  1NBE B;  1SQF A;  2GO9 A;  1IKW A;  4F0H A;  2DIV A;  5LXY A;  4KAI A;  3UN5 A;  4ZLP A;  1U1O A;  4NYP A;  3D4J A;  3HK2 A;  4IFY B;  2JH3 A;  2NCK L;  4GKK J;  1U2F A;  1VHI A;  1KKH A;  4P73 A;  4RW8 A;  1JLC B;  1D3W A;  2F3J A;  1Q8B A;  3G87 A;  3CF5 Q;  4JI5 J;  2DK2 A;  2R8H A;  2DNH A;  3G8T A;  2H51 B;  3T1H F;  2MQN A;  1GH8 A;  2OD6 A;  4ENO A;  3ZC4 A;  1CS4 A;  2Y3Y A;  4MKY A;  1F60 B;  2JOQ A;  2EFP A;  3FEZ A;  1GX6 A;  4OHZ A;  4IFV B;  1YIJ S;  2BOP A;  1DTT B;  2KJV A;  3T9N A;  4FXV A;  3KJQ B;  2O67 A;  3NS5 A;  4HDG A;  3O3L A;  4P2F A;  3TJA A;  4DLE A;  1T95 A;  2QA1 A;  5B0D A;  1ZTW A;  5C42 A;  1GMW A;  2OO4 A;  4ED7 A;  3IBW A;  3C15 B;  3CE8 A;  3MI7 X;  2BAN A;  3IA0 A;  4HR2 A;  4NLS A;  4PAA A;  5MAO A;  2AYG A;  4B9L A;  1XNQ J;  1TL4 A;  3OLA A;  3SV4 A;  1XNR J;  3IC1 A;  2HNY A;  3GR1 A;  1IBM J;  1X5P A;  1R0A B;  1XR5 A;  1TKX B;  5A8K B;  1RKJ A;  3M6W A;  4N77 A;  4FYX B;  4CTA A;  5A8W B;  3KK2 B;  2BE2 A;  3ZZP A;  3GV5 B;  2Z30 B;  1M1K T;  2DJW A;  1Q79 A;  3AXM A;  3CO9 A;  4DQI A;  1GK8 A;  3RRH A;  3HO1 A;  1QSY A;  5H1S V;  2QE5 A;  3KOA A;  1RE1 B;  2V67 A;  3DRP B;  1KTV A;  2MKH A;  4ZPB A;  3W5Y A;  1TMJ A;  2BRL A;  4X66 J;  1TL3 B;  4DCJ B;  4K4Z A;  3FK4 A;  4K2X A;  1RT2 B;  3TI0 A;  4DR4 F;  2KKH A;  1UA0 A;  3CTR A;  3V6J A;  1JXL A;  2PA8 D;  3RJM B;  2KTQ A;  2Q79 A;  5L9N A;  4LFC F;  1WNE A;  1WF2 A;  3RBX A;  2WVF A;  3NCQ A;  2E1C A;  4JI6 J;  3HHL C;  4IH7 A;  4FYD A;  4YN3 B;  2P5V A;  2DD8 S;  4ZPD A;  4I69 A;  2I5J A;  2DHX A;  1YBT A;  3PW4 A;  4CH7 A;  3OJS A;  2VKZ G;  3BGR A;  4E8U A;  4HI2 A;  2V8P A;  2VPZ B;  5G4D A;  5KFN A;  4K7Q A;  1F5B A;  3HJV A;  4WTY A;  4HT5 A;  1KS2 A;  4DV7 F;  3I32 A;  2MXY A;  2ALY B;  2Y0B B;  4ITS A;  1F9F A;  3UVJ A;  4Q45 A;  3MCS A;  3SCK E;  2AIR B;  2VDH A;  1HQE B;  2AJ2 A;  1ZOT A;  2LCW A;  2OSQ A;  3J7A 1;  3W9H A;  1YJU A;  3U1L A;  1QUV A;  3N28 A;  3MCO A;  2Q3P A;  4OHW A;  2CRL A;  1YJN S;  1SKW A;  3HVW A;  4X4V A;  3TA2 A;  4Q8E A;  2VF3 A;  3EJM A;  1L3T A;  3T5L A;  1BQN A;  4MH8 A;  1UWB B;  1V3Z A;  2J6T A;  2KZM A;  3UD3 P;  4TU8 A;  2IBO A;  1J2V A;  3JAM U;  2HHU A;  1HI8 A;  2Z2L A;  2DNG A;  3QFH A;  1B0P A;  1NXI A;  4C0B A;  2QL5 B;  4KPY A;  3FMB A;  2K3I A;  3FGV A;  3D66 A;  3HZE A;  4TY9 A;  1LXN A;  1NSQ A;  2JEF A;  1B0T A;  2OEM A;  3VHQ A;  4TN2 A;  5KFC A;  5KT2 A;  4YR2 A;  3QAE A;  5IQ6 A;  2CQ1 A;  1JNZ B;  5CCM A;  2PSZ A;  3AOA A;  1QE1 B;  2IVF B;  2DHA A;  3H5S A;  1RT2 A;  2DO0 A;  1RHK B;  2WW8 A;  3MAA A;  2EFO A;  1H2T Z;  2RF2 B;  3FUY A;  1XMO F;  2HAF A;  1Q5V A;  3J80 Y;  1VBZ A;  4JI4 F;  2EI5 A;  5K9F A;  5CQG A;  1NK6 A;  1WI8 A;  3TUZ C;  5GAD I;  1TL5 A;  2V69 A;  4DCO B;  7AT1 B;  1OPI A;  2HFZ A;  2HNZ A;  3UVJ B;  2YKP A;  2YKN B;  1FRH A;  4FBT A;  2NXC A;  2AWZ A;  2N7C A;  2FVS A;  1RTZ A;  1WKJ A;  4RNF A;  2J76 E;  2HZV A;  1T03 A;  1V5I B;  1FJE B;  3CCQ S;  2DRD A;  1PG5 B;  3PJW A;  4JI2 F;  3RAM A;  4CLT A;  5HSP A;  2MQO A;  3J7Y I;  1CUL A;  1N6Q B;  5KFG A;  2ZZM A;  2PI5 A;  1CJV A;  3S8S A;  1FA0 A;  3AJ1 A;  1UTA A;  3NCP A;  1LEO A;  3DYA B;  1JX4 A;  2XM3 A;  4DUZ F;  2OTL S;  4IDK B;  2KYZ A;  3KLV A;  1SJ4 P;  4DFM A;  2HUR A;  3MM7 A;  1JB0 C;  4F3O A;  3TAM A;  2HBZ B;  2ZBP A;  3M32 B;  4F4Y A;  1DQ8 A;  2G1D A;  3M1V B;  1FKO A;  2GFF A;  3BV8 A;  1PSD A;  3BR8 A;  1G4C A;  1UEV A;  4EU0 A;  3N01 A;  4ETX A;  1H72 C;  1O6X A;  3EGZ A;  2W4D A;  4HVZ A;  1W26 A;  4DWI A;  2EFG A;  2ACY A;  3DLH A;  3CCJ S;  4RW4 B;  1S1U A;  4XPC A;  4IR9 A;  1QJH A;  4FS2 A;  3IP0 A;  2PMZ D;  4QR0 A;  4LF6 F;  1ZM4 A;  3NS7 B;  2QRR A;  3R3T A;  1QAY A;  2JX2 A;  3Q8Q B;  2XO6 A;  1HNW F;  1NDK A;  2W2P P;  3ISN D;  1YKW A;  2HAI A;  1XMQ J;  4TYA A;  1F6T A;  1JXV A;  1U26 A;  2Z2M A;  1UVN A;  4GO5 X;  2BE9 B;  2LQJ A;  1VK3 A;  4PWU A;  2HND B;  1RAI B;  2MB0 B;  2Z56 B;  2OJ3 A;  3GFY A;  2X1F A;  4PQU B;  1RT7 B;  1J5E F;  3G6E S;  2IM2 A;  1U0H B;  1Q82 T;  4QW9 A;  4ELV A;  4EBC A;  3F56 A;  1M1H A;  2WSF C;  4PG7 A;  4QIW D;  1RHR B;  1X4F A;  4XDD A;  2JFK A;  2M70 A;  4C8Z A;  2ZZT A;  3QLH A;  1FRJ A;  4DR5 F;  2DGU A;  3OD2 A;  3I9Z A;  2KFY A;  5DQI A;  4YY3 F;  3PJX A;  3D1O A;  2GJI A;  2BJ1 A;  2NS1 B;  2UUB F;  3HJF A;  1Q16 B;  4QPX A;  2N7Y A;  3OL8 A;  3H2L A;  1APS A;  1RWM B;  3H42 A;  3H20 A;  2WTF A;  1UVJ A;  4QWE A;  3THV A;  3CJT A;  3MM8 B;  2CPJ A;  2HLT A;  2ZOM A;  1RAF B;  4KV8 A;  3V6D A;  4LFB F;  1RHM B;  2FB0 A;  3O6Q A;  1FFS B;  4DQS A;  5KFE A;  1BQX A;  4UUW A;  4M94 A;  3D3B J;  5HP1 A;  3OTO F;  1S6Q A;  1J5E J;  3J7Y U;  3M30 A;  1FRX A;  5JXS A;  4DX8 H;  4ECW A;  3K8V A;  3S6E A;  3KTQ A;  2R2S A;  2YKM B;  2HND A;  1GNK A;  4YB6 A;  4YB1 P;  2GA7 A;  2GJ2 A;  2DGT A;  4OYZ A;  5KG7 A;  3G6X A;  5EHH A;  4WU3 A;  1Q7L B;  2GHV C;  5ETP A;  3KDO A;  2IRX A;  2BM1 A;  2F1F A;  2QL7 B;  2RB7 A;  4IFV A;  4P7T A;  4LF6 J;  1JLC A;  3TEG A;  2W7O A;  4RBT A;  2PI4 A;  1JK9 B;  4E0D A;  4FKY A;  2XS5 A;  1SJR A;  5HN0 A;  1YJR A;  2R2R A;  1VBK A;  3OSP A;  4FDF A;  4O44 A;  3GFX A;  2ASL A;  3SSS A;  3AOD A;  3NEK A;  4X4U A;  3TX0 A;  3GTY X;  4NML A;  2XLJ A;  1F0X A;  3P49 B;  5DZ6 A;  3SCJ E;  3PW7 A;  1X5O A;  1DRZ A;  2R42 A;  4OZ1 A;  4CLK A;  2HK3 A;  2DNQ A;  4U6P A;  1NK9 A;  3GIR A;  3LP0 B;  2G9O A;  1HIY A;  4B3S F;  2XNQ A;  4KV8 B;  5DLG A;  2HWT A;  2K1R B;  3I96 A;  5JMN A;  3QSY B;  2DPJ A;  3DOM A;  2KHD A;  2YX7 A;  2QA4 G;  2R2U A;  2FLP A;  2MLY A;  2RHS B;  1F9E B;  1TKT A;  1PC5 A;  2LDI A;  5J2N A;  1PIE A;  2PMH A;  1WOO A;  3C16 B;  1EAR A;  3NMA A;  3H90 A;  4ZP9 A;  4LT6 A;  3M8R A;  2V8G A;  4I67 A;  3LAM A;  2I6W A;  1XK8 A;  4NLG A;  2CA9 A;  3IG1 B;  4X4R A;  1VQ6 S;  2KM8 B;  1VBX A;  1TKZ B;  2JZ5 A;  4DSI A;  1WEL A;  3IRX A;  5C5J A;  4BDP A;  4J90 A;  2HLU A;  1GXT A;  1UJ4 A;  1V5V A;  1YRU A;  3VAL A;  4I0W A;  2FY1 A;  3JYT B;  1FNO A;  1N4L A;  3I5A A;  4HDH A;  1LWE B;  5KT4 A;  1IKY A;  1KBR A;  1MN7 A;  3L9Z A;  3P8B B;  3ILI A;  5K8N A;  5F9L A;  3T5K A;  1IQT A;  2UXB F;  3WX8 A;  3RW6 A;  3EDQ B;  5CYM A;  4RW7 A;  2J9D A;  3GPA A;  2RML A;  4H4O B;  4J9O A;  1KVI A;  2W1B A;  3UDE A;  4M5I A;  3LP0 A;  4CDI A;  1EX8 A;  3I6P A;  4NZ6 A;  3BPD A;  2W7P A;  1N34 J;  4G3I A;  3KLH B;  5ETN A;  1S1X B;  1Q81 T;  2K1R A;  3CED A;  4EFA C;  3ZO7 A;  2W2O P;  3FRY A;  1NJW A;  2BJE A;  1EZZ B;  2VG5 A;  2HQG A;  1X60 A;  3HHN B;  2ZC4 A;  3KG1 A;  3R9L A;  1BQN B;  1RIS A;  3NOG A;  1LFP A;  1RB0 A;  3JTP A;  3KG4 A;  4ZP8 A;  5T7L B;  4C8M A;  3OL6 A;  3KK1 B;  3I9V 9;  3N5B A;  1SC6 A;  2FZG B;  4I2P A;  4L72 B;  4ECT A;  2L9D A;  3FEX B;  4DR7 J;  2VC1 A;  1RT5 A;  5J1E A;  1H3D A;  1KDN A;  1R89 A;  2DR6 A;  3BSC A;  1NSA A;  4RW9 B;  3TUI C;  3PW5 A;  3TAQ A;  1VC6 A;  3JSR A;  3ZTQ A;  1N56 A;  3L4B C;  3CCU S;  2R9L A;  1U1P A;  2RF2 A;  4HKQ A;  4F26 A;  3KJV A;  2YWK A;  4QCL A;  5T14 A;  3A3P B;  3V4M A;  3D2W A;  2CQ0 A;  2HBR B;  2JVR A;  1T3O A;  2DCL A;  3G2X A;  3ONQ A;  4J9V A;  4ZVR B;  3RRK A;  4YUD A;  4P72 A;  2HNZ B;  1Y7P A;  1S4F A;  3PAC A;  1HPZ A;  1SIZ A;  3KHG A;  2HGM A;  3OVB A;  3RUB L;  3JSM A;  2V9W A;  1C0U B;  5K5M A;  1DFD A;  3R1L A;  2H48 B;  1PIL A;  1W7W A;  3OFG A;  4G1P A;  2DBB A;  1UPP A;  5IT0 A;  1S57 A;  2DNK A;  4JOU A;  4UQG A;  3G71 S;  4FBU A;  3SBM A;  1CC7 A;  3SCI E;  4OI0 A;  3FBF A;  3PR4 A;  2AHO B;  1KQF B;  2FHM A;  3FSX A;  1LW2 B;  2F4V F;  1P27 B;  1FE4 A;  5CZV A;  1NH7 A;  4DSF A;  5C24 B;  4Q0B B;  2YWE A;  4I1T A;  3SXL A;  3TX8 A;  4F3Q A;  1I94 J;  3ENQ A;  1WD6 A;  2OSR A;  1IKV B;  4NCG A;  3I4H X;  2A10 A;  3M2U A;  4NXN J;  1JLQ B;  5FJ4 A;  4IOB A;  2BQU A;  4F4X A;  1AYE A;  4USV A;  1G1X A;  4WK3 A;  5A6W A;  1LFW A;  2VFR A;  3CC7 S;  1ZZF A;  1XBW A;  3UN3 A;  1EQM A;  5E3C A;  4URG A;  3RB4 A;  2QZ8 A;  1X5T A;  2VD3 A;  3CJR A;  1Z1Z A;  3Q2S C;  4MIA A;  3RYL A;  3L09 A;  3GU0 A;  5DM7 Q;  4RW4 A;  3A8K A;  5KFK A;  4LF4 F;  2YNF A;  3UI3 A;  1HBN B;  1OO0 B;  4R8U B;  4B9U A;  4GKK F;  5KFJ A;  1WUU A;  1URR A;  4C8K A;  3T1Y F;  4QZV B;  3VAH A;  4DV6 J;  1PC4 A;  1WF1 A;  3W62 A;  1ZZN A;  3I0S A;  5IC6 B;  4K8R A;  2RRN A;  4OJ3 A;  1J5O A;  3BEG B;  1VQM S;  5D4N A;  5B7W A;  1GTE A;  1M5H A;  1RWW B;  3AFG A;  3BQ0 A;  4PG6 A;  4LF5 J;  1PJ6 A;  2KRB A;  1OYD A;  5D4O A;  4DMZ A;  3EVM A;  2CG4 A;  4O3P A;  5IT4 A;  1DHM A;  4EBE A;  1KFS A;  1EIY B;  2P8I A;  3ELH A;  1DTQ B;  2X3D A;  4KC5 A;  5HI7 A;  5IM0 A;  4DL4 A;  1OPZ A;  4GC7 A;  4LFA F;  1EET B;  2I8E A;  2IPO B;  1S79 A;  2VOP A;  2QSW A;  3TZZ A;  1B70 B;  2B5J A;  2CNL B;  3BF4 A;  3NGS A;  1RYR A;  2OMO A;  2PT0 A;  3CJ5 A;  3BDP A;  3BYP A;  1YTY A;  3LOU A;  2VA3 A;  2COL A;  3CJ4 A;  1B3T A;  4KH1 B;  2XGP A;  5CCL A;  2UV8 A;  2D3O 1;  2LQ9 A;  3KJN B;  2J0X A;  1PJ5 A;  2V2V A;  3KNA A;  4LF2 A;  4P9S A;  1BQM A;  3C14 A;  3UQS A;  1N5V A;  2OLW A;  2VV5 A;  3QRR A;  2YKM A;  1VYA A;  4ZVO B;  4WFA Q;  2E5J A;  4HAC A;  2CZ4 A;  2QFI A;  4ZS6 A;  4C8Y A;  2X1A A;  1RHU B;  1SV5 B;  5HP1 B;  3C6T A;  2QJ3 A;  4DV4 F;  1DLO B;  3BDE A;  3CXC R;  1R6Y A;  1G2E A;  2YKQ A;  2XS2 A;  1HWK A;  5AXM A;  5DDQ C;  2NUU G;  3Q89 A;  5L38 A;  4R5P A;  5SZT A;  3OL9 A;  3EZO A;  5FDL B;  1N33 F;  4IG3 A;  1RGV A;  2I0X A;  4DG1 B;  5ETK A;  4LRA A;  2LDY A;  1M90 T;  5KFZ A;  4IFY A;  5L1J A;  1FER A;  3HD2 A;  4Y6I A;  3V5R A;  1FDA A;  1Q8L A;  1ZET A;  5GVQ A;  1H7W A;  1OIA A;  3NY0 A;  1HNI B;  2CZV C;  2XQC A;  3TRG A;  2FYX A;  2ZC3 A;  3MTJ A;  2B4P A;  2MLZ A;  3O2I A;  4CLW A;  2HFO A;  1DQA A;  3X1L B;  5KG6 A;  4OI4 A;  3BS9 A;  5B0B A;  1RTJ B;  3JTO A;  2GHP A;  1HR0 J;  4Y2C A;  3MD1 A;  2KXH A;  1BQM B;  3C14 B;  2B3T B;  3BSO A;  4ERD A;  1UZD A;  4UUX A;  5LL6 d;  1TKD A;  5GMK a;  4K4W A;  3PJ9 A;  4I7F A;  3JTN A;  2DR5 A;  1S97 A;  3C19 A;  4ZJO A;  4E98 A;  2XMT A;  4KRW A;  3TQE A;  1XC9 A;  2ADC A;  3CDW A;  4PYD A;  5D4L A;  2R7U A;  4WKR A;  5J2M A;  1RTD B;  4Y2K A;  2YQ1 A;  3H5U A;  3P45 B;  5ETM A;  1Q1K A;  4ECQ A;  2ASD A;  2J6U A;  2AD9 A;  4B3O A;  1D8Z A;  3B6B A;  3ZZU A;  4B3M J;  3DRR B;  2KZZ A;  2Y1J A;  1HYS B;  4KB7 A;  1PYS B;  2ACM A;  2DH8 A;  4IG3 B;  1ZTT A;  4BCA A;  3DRP A;  2IVY A;  3QJJ A;  1K1Q A;  2RIL A;  5I3Q A;  3OLB A;  1GQE A;  4LR7 A;  1N0U A;  1O51 A;  1VRU B;  3MR7 A;  4J91 A;  3FC9 A;  4IDK A;  4RWW A;  4ZOS A;  5I3P A;  5A8W A;  5MLC V;  3MR5 A;  2AMC B;  1C4A A;  2CQI A;  1A7G E;  1LWE A;  2DNN A;  2B8Q A;  2DIS A;  2GVD B;  5ETO A;  1FKO B;  1HNX F;  3HSG A;  1RAC B;  2I5J B;  2VU5 A;  2E1M C;  4OQJ A;  3H2V E;  3W5X A;  3G4S S;  1IR1 A;  4ZKA A;  4XAK A;  4LF7 F;  1GX5 A;  2EFN A;  1NK5 A;  4B02 A;  4X84 A;  2OPP A;  3OL7 A;  4ZK7 M;  1N33 J;  3JQM A;  1D9A A;  4C11 B;  3I31 A;  4DR3 F;  1REV A;  3CD6 S;  4K0K F;  2BX6 A;  4ATN A;  2ZE2 A;  4LIR A;  4KT0 C;  2OEJ A;  1SL0 A;  4NLP A;  2Q1L A;  4MIB A;  4ETZ A;  4QBU A;  4L74 A;  1ZBT A;  5F8G A;  5CA5 A;  4UOC A;  3I5B A;  1TP7 A;  3T1A A;  3BN4 A;  2VQF J;  3QRQ A;  1RAJ A;  3SDE B;  1VQ7 S;  1FKA F;  1KTQ A;  4F4W A;  3FSY A;  2NYH A;  5IXU A;  2E7X A;  4ECX A;  3D7S B;  2CQ4 A;  2FC9 A;  2NZC A;  2ZD1 A;  3DM2 A;  3MM6 B;  4MK7 A;  1T9U A;  2KB2 A;  2V94 A;  3OBI A;  1SJF A;  2MY7 A;  4LF8 F;  1SKU B;  5J1N A;  4QWB A;  2CDQ A;  3SQO P;  1TL7 A;  5U47 A;  1TMM A;  1SC1 B;  3KJV B;  4N5S A;  4C8O A;  2EEY A;  2EC0 A;  3VWS A;  1MNE A;  3NBP A;  2EK6 A;  2IJN A;  4NA1 A;  1RT3 B;  2Z0G A;  3BGL A;  4LRE A;  3PRD A;  4X65 F;  3PX0 A;  3PY8 A;  2GMH A;  4JI1 F;  3Q86 A;  1JJC B;  1RAH B;  3AQO A;  2MSS A;  4ZIV A;  5BYS A;  3HSJ A;  5K20 B;  1DY3 A;  2VUG A;  2DY1 A;  2EKN A;  1B7Y B;  5EGY A;  4PUO B;  2B51 A;  3ZZT A;  4YME A;  2X1G A;  5A8R B;  1T8E A;  1PBA A;  3IFE A;  1R0B G;  2MQL A;  3U7J A;  3NGR A;  1N5S A;  3CCE S;  3CD5 A;  3T6J A;  4LF5 F;  2M8D B;  1RJJ A;  2DTJ A;  3MWB A;  1CJU A;  2EG2 A;  1G7C B;  4NE9 C;  5A76 A;  4RJV A;  4PPD A;  2DVI A;  4X2B A;  4KE5 A;  3K57 A;  3N6N A;  1LW2 A;  3V81 A;  1TK8 A;  4OZ5 A;  1OMS A;  2B4U A;  1L3S A;  3T1Y J;  2OUG A;  1G6B A;  3KG0 A;  4W92 B;  1LWC A;  1QUP A;  5C24 A;  4Q0B A;  2MZQ A;  4ECU A;  2HS3 A;  1O5J A;  2BE7 D;  3J7Z T;  4X4S A;  4G1Q B;  3OHB A;  1NDL A;  1CPZ A;  2C2K B;  2L3M A;  5FII A;  2W9C B;  4L75 A;  3FRZ A;  4L3N A;  1SH0 A;  1I1G A;  4GRS A;  3J81 Y;  4B3T F;  1NB7 A;  2RS2 A;  2AEM A;  1VQS A;  4CO4 A;  4WPA A;  4YDD B;  9ATC B;  2XSF A;  3M2V B;  3R2D J;  4ZJQ A;  2LXU A;  3IO1 A;  3LTO A;  3D28 A;  2DKO B;  4ECS A;  5CYQ B;  3MPW A;  4TXS A;  1YJ9 S;  4J7C A;  3K17 A;  2QC3 A;  2CQB A;  4M5K A;  4RX6 A;  2HIY A;  2KN4 A;  3KXD A;  1R8P A;  1SL2 A;  2QYG A;  1NSK L;  1YJ7 A;  2CJK A;  3BM7 A;  2JVO A;  3HVT B;  3E2E A;  2RHQ B;  2FJW A;  2XLI A;  1RK8 A;  1KHV A;  2UXC J;  1AA1 B;  2HQF A;  2MST A;  1EET A;  1WC4 A;  2V63 A;  3DOL A;  4BBY A;  5J2P A;  4O3O A;  2DRA A;  1XQI A;  2XWY A;  3OSN A;  3D0I E;  3POT B;  1XNQ F;  2J9D E;  2GW8 A;  1RT1 A;  1TV6 A;  1KR4 A;  4RBU A;  3JQK A;  4OYP A;  4DI6 A;  3W8G A;  4IRK A;  1V3R A;  2HPU A;  1DLO A;  3MMC A;  4I56 A;  1DTT A;  1OJ4 A;  3GJT B;  4KGZ B;  1IR2 A;  3KKF A;  1BC6 A;  1RWX B;  2J0W A;  1IKX A;  1PYT A;  2LXF A;  2ZIT A;  1P9Q C;  2VG7 A;  4KKO A;  3PIP Q;  4Q8F A;  4ICL A;  3EMT A;  5C42 B;  9RUB A;  4ZCL A;  4Y2I A;  4DG1 A;  1TL1 B;  4DDF A;  1IM6 A;  4OV6 A;  5I4M A;  2N82 B;  1SV5 A;  2ZJR Q;  3B82 A;  4P52 A;  2DH7 A;  4RW7 B;  2FQQ B;  5F3T A;  1U45 A;  3QBC A;  4LRB A;  4J9K A;  1S6P A;  3KUH A;  1R0A A;  4N76 A;  1YDL A;  2GNK A;  4I2Q B;  3SIP B;  1DAR A;  5IV4 A;  2ROE A;  3T9Z A;  3ZNJ 1;  1ZPW X;  1UJ5 A;  1JLA B;  3ZTS A;  3RB6 A;  2YWW A;  4X64 J;  1HI0 P;  2RKI A;  2V9K A;  4E2F B;  4RL1 A;  1RTI B;  2HQC A;  4M5H A;  4WFY A;  2XHW A;  2M5Y A;  2NPF A;  1D09 B;  5DG8 A;  2DHS A;  3CCS S;  1EKR A;  3KLE A;  2ADB A;  5CYQ A;  3FBC A;  4FP9 A;  2W01 A;  2WVC A;  3W7B A;  4K4Y A;  3LAN A;  3ULH A;  2UUB J;  1Q5Y A;  3EGW B;  2AX0 A;  4UF4 A;  1KFD A;  5JVG Q;  2D9O A;  3E01 A;  1H73 A;  5ADZ A;  3W3S A;  2NZ4 A;  1JLG A;  2ZJQ Q;  3QFW A;  4DR5 J;  2BJ7 A;  4DF8 A;  1NK8 A;  2E7V A;  2ZKT A;  1UVK A;  2DXD A;  1YI2 S;  4F3M A;  1OY6 A;  5D0G A;  2MKS A;  4ZP7 A;  1QTM A;  4I6W A;  5F8L A;  3AHP A;  3CT9 A;  4A46 A;  2A6M A;  1OSC A;  1TQL A;  4IOA Q;  4DU7 A;  5JUM A;  1RHQ B;  3E3X A;  1SC4 B;  1BXN A;  2QN6 B;  1CC8 A;  2QSF A;  3NGK A;  4Y2A A;  1C1C A;  4NLQ A;  5THW A;  2JEG A;  1VQP S;  3MMB B;  4NLT A;  2W9B A;  5F8J A;  5DO2 A;  1QAI A;  1FEH A;  1CJK A;  5IFM A;  4QWD A;  3MR6 A;  3NRB A;  1NME B;  1ITP A;  1WEY A;  3E8O A;  2D41 A;  4RUB A;  3BQ1 A;  3SV3 A;  1JKH A;  3GYG A;  3DGV A;  3JSB A;  2P6S A;  3G8S A;  3GJR B;  4O0N A;  3VAF A;  3M6X A;  3NCR A;  2ZUA A;  3CME S;  5I3U A;  1QD1 A;  2CQC A;  3M8Q A;  4U8Y A;  1YHQ S;  2RKI B;  1WTF A;  2UXD J;  1C1B B;  2GCF A;  1YG0 A;  1KD1 T;  4B3M F;  4WJB A;  1NPP A;  3QT5 A;  1X4B A;  4ZVQ B;  3BBC A;  3D54 A;  3QAU A;  2KI2 A;  4QR2 A;  2FVQ A;  1CQN A;  5D6G A;  5K8O A;  2H65 B;  4KGK A;  3KLF B;  4DSJ A;  4NWB A;  4LF9 J;  1K47 A;  3LGN A;  4IYQ A;  4MJK A;  4EYH B;  3UDL A;  1RTI A;  2ROP A;  3A8J A;  3W66 A;  5JVH Q;  4NXM J;  3V4I B;  2ROG A;  4OYI A;  4DUT A;  1X7V A;  4ES2 A;  1RBL A;  5KFI A;  4JBC A;  4B17 A;  5IS2 A;  3K5M A;  2B9X A;  3BO3 A;  4R25 A;  2X51 A;  2Z57 B;  4LSN A;  1RCO B;  5GAH I;  4H4K A;  3Q0A A;  3VAI A;  1X4D A;  2O66 A;  3I55 S;  3UNY A;  4X4T A;  2VIH A;  2GVD A;  1VRT B;  2W9B B;  1HL6 A;  2HFN A;  2DEI A;  3US5 A;  4Q2M A;  4YHH F;  4FPI A;  1K0V A;  2ZZN A;  3BGO P;  1EB0 A;  4NLX A;  1GFW B;  4K2J A;  3ICL A;  5LJ3 Y;  1U2R A;  2OPP B;  3KHR A;  2MDA A;  2P6T A;  4HHH A;  2HZC A;  4OL8 A;  3GWC A;  2BRK A;  5B0G A;  5KFS A;  3R97 A;  2LMI A;  3JXO A;  2DR7 A;  1CUL B;  2IA6 A;  1HFE L;  1HWI A;  3DM2 B;  1S59 A;  1P8G A;  3M8P B;  1XMO J;  3FCW A;  4ZVP B;  4DV1 F;  4ZPA A;  2XMA A;  4IQX A;  2VIC A;  3R1H A;  2HHP A;  3QIP B;  2OFH X;  1IBK F;  3D6M B;  2QLX A;  3RZA A;  4O3S A;  1SUQ B;  3BR9 A;  4RBV A;  3WC2 A;  1RT5 B;  5D8H B;  2HFV A;  1RAB B;  2VBZ A;  2ZOF A;  2MKI A;  2JRS A;  1S5Z A;  1EP4 B;  4KGX B;  1HW8 A;  4GMK A;  1KOH A;  3IXQ A;  3BRE A;  2KU7 A;  4LSN B;  2XZW A;  3TAM B;  2EBG A;  4A8O A;  3BSN A;  4CLS A;  2ZNY A;  3QZ8 A;  3PW0 A;  3HSD A;  1T02 A;  2WVB A;  2MHN A;  2Z2Y B;  2FJB B;  3JAM Y;  2PO4 A;  4TKT A;  2W9C A;  2DNZ A;  3IGN A;  3L7U A;  4XDC A;  2LU1 A;  4ZN1 A;  4ECV A;  2E29 A;  3DLE B;  4ZVU B;  4DXL A;  3CD0 A;  1HNX J;  2IM3 A;  5HL7 Q;  4F0M A;  4YQW A;  1VR6 A;  2WBR A;  3FCV A;  4NLY A;  4QIV A;  1AT1 B;  1LWC B;  3ILO A;  4ES1 A;  1EJ7 L;  3RBE A;  2XNR A;  2K3K A;  4CO5 A;  5E41 A;  4ED5 A;  3JSM B;  2H5J B;  3U27 A;  2QG9 B;  3NWG A;  1XMQ F;  2A1B A;  1HNW J;  2H1Y A;  1H2U X;  3D5M A;  4DZ6 A;  3PR5 B;  4DV6 F;  2CPF A;  2M0G B;  1UW4 A;  4XO0 A;  2UUA F;  2DYA A;  1QVF R;  1VQL S;  4FPR A;  4LFC J;  1ARO P;  3TZX A;  4P74 A;  4QIF A;  2V0N A;  5HQL A;  2W7A A;  4U67 Q;  3G96 A;  1BD6 A;  4WFZ A;  1YWX A;  1O8B A;  1QSL A;  2UXD F;  1TV6 B;  2RT3 A;  4HEA 9;  3Q22 A;  2C28 A;  1T9Y A;  3P5B P;  5DG7 A;  2DRB A;  2HZA A;  5AE2 A;  4DV0 J;  3LWL A;  2FZC B;  1YX2 A;  1TFY A;  1BY9 A;  1RTJ A;  4DS4 A;  1P9Y A;  3HVT A;  3MAA B;  4EI2 A;  5DDR C;  4P6Q A;  1HR0 F;  2GX8 A;  3Q8P B;  2BAC A;  2FD2 A;  2GHW A;  2CJX B;  2KVQ E;  4K4S A;  1T11 A;  2L9N A;  5KFD A;  2HHH F;  1MN9 A;  2XHC A;  3W1Y C;  1A0O B;  5HQ8 A;  1Q8K A;  4KFB B;  4YR3 A;  3MFH A;  3SEO A;  1FKP B;  2F4V J;  2B43 A;  1S1T B;  3TA1 A;  4DR2 J;  2ZWP A;  2FC8 A;  3DNC A;  3K58 A;  1U48 A;  1H38 A;  4CRJ A;  1HBN A;  3HHK A;  1N8R T;  5DJB A;  4ZLN A;  4OX7 A;  3A3O B;  4RW6 B;  2I1R A;  4IRC A;  4U96 A;  5KOX A;  1N6Q A;  3FCH A;  1NPK A;  2FHJ D;  1MU2 A;  4CO1 A;  1WJ9 A;  2P9G A;  1VRU A;  3HVR A;  2XI2 A;  2WSE C;  5E3Q A;  5G0R B;  4Z37 A;  2BZ2 A;  1VI7 A;  3CCM S;  1WC3 A;  4NRU A;  2ZH7 A;  1U8S A;  2LEC A;  2ATL A;  5IM0 B;  1WC5 A;  2J9C A;  5IQQ A;  3OW2 R;  4ED6 A;  4ELU A;  2DT9 A;  1FX4 A;  2HVZ A;  2HBQ B;  1MRO A;  2YNG A;  3DOK A;  5ETQ A;  1IQZ A;  2HKE A;  4DR1 J;  1X9M A;  2J0S D;  2BYC A;  1CS4 B;  1FF2 A;  3M9M B;  4ID5 B;  4QW8 A;  2ZH6 A;  4LR9 A;  1UVM A;  3M2R A;  3DU6 A;  4M5G A;  3QGH A;  3HFK A;  4YB7 A;  5HMY A;  2AJF E;  5D78 A;  4YR0 A;  4DV5 F;  2HWH A;  3VAM A;  2ASJ A;  3HDS A;  3MCN A;  4NYZ A;  1VMB A;  2MJU A;  2V4R A;  1X9S A;  2QLW A;  2AYM A;  2CG8 A;  1S48 A;  5HQM A;  4RUC A;  3TZY A;  2V50 A;  5F9N A;  2KM8 C;  3RU0 A;  2I2Y A;  4PQU A;  1PAE X;  4FYW B;  1RLD A;  4C4W A;  1U25 A;  1YLX A;  3AB4 B;  5KAK A;  1YBU A;  1JLG B;  2JLF A;  4HH0 A;  4NCB A;  5L8R C;  4K59 A;  1UJ6 A;  4EZ6 A;  2HNY B; 
#chains in the Genus database with same CATH homology
 5LMN J;  1I94 J;  3JAM U;  2MEW A;  4NXN J;  5IT9 U;  2E5L J;  4LF4 J;  4JI4 J;  2UU9 J;  4DR4 J;  3J80 U;  1HNX J;  4OX9 J;  3J7A N;  4X64 J;  4DV5 J;  5LMU J;  1N33 J;  4DV6 J;  4DR6 J;  2UUB J;  1HNW J;  4LF5 J;  4DV3 J;  4K0K J;  2VQF J;  3J81 U;  4DUY J;  1N32 J;  4DR5 J;  4KHP J;  2MQ8 A;  5BR8 J;  4GKK J;  4LFC J;  2UUA J;  4JV5 J;  4DV1 J;  4JI5 J;  4DV0 J;  3R2C J;  4LFB J;  4X62 J;  4DUZ J;  3T1H J;  4LFA J;  4NEZ A;  2KVQ E;  4V1A k;  4DV4 J;  4AQY J;  4YHH J;  1N34 J;  1XNQ J;  4KY3 A;  4YY3 J;  4B3R J;  3W1Y C;  1IBK J;  1XNR J;  2F4V J;  4B3T J;  1XMQ J;  2ZM6 J;  4RJV A;  5AJ3 J;  4DV2 J;  1IBM J;  4PWW A;  4DR3 J;  4LF9 J;  3T1Y J;  4X65 J;  4JI1 J;  2VQE J;  4NXM J;  4JI0 J;  4DR7 J;  1FJG J;  4X66 J;  2HHH J;  3IMQ J;  5IWA J;  4NEY A;  4LF8 J;  5FLX U;  5LM7 E;  4JYA J;  4JI7 J;  2UUC J;  4JI6 J;  3R2D J;  3D3C J;  5A2Q U;  1IBL J;  2KL8 A;  4DR1 J;  1HR0 J;  1HNZ J;  2MTL A;  2UXB J;  4B3S J;  3D3B J;  1J5E J;  4JI8 J;  4HHU A;  4LF7 J;  1XMO J;  2UXC J;  4KYZ A;  4JI3 J;  3OTO J;  4B3M J;  1N36 J;  2UXD J;  4DV7 J;  4JI2 J;  4DR2 J;  4GKJ J;  4LF6 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...