2KL8A

Solution nmr structure of de novo designed ferredoxin-like fold protein, northeast structural genomics consortium target or15
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
MEMDIRFRGDDLEAFEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OR15
publication title Principles for designing ideal protein structures.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 20
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2kl8A00
5BR8J 2UXBJ 3J80U 4B3TJ 1HNXJ 4HHUA 5A2QU 5AJ3J 4NXNJ 4DUYJ 2UXCJ 4JI7J 1HNWJ 5FLXU 4JI1J 4NXMJ 3IMQJ 4JI4J 3R2DJ 4DR6J 2KVQE 3R2CJ 4GKJJ 4DV1J 4JI2J 4KYZA 4JI0J 4DR3J 4JI8J 3J81U 1N36J 5LMNJ 4JYAJ 2E5LJ 3D3BJ 4LF5J 4NEYA 2VQEJ 4OX9J 3W1YC 4GKKJ 4JI5J 1HNZJ 1N34J 4LF9J 4DV3J 1HR0J 4B3SJ 2UUBJ 4PWWA 3J7AN 4DV6J 4JV5J 1J5EJ 4LF6J 2UU9J 2F4VJ 3T1HJ 4DR4J 4DV4J 4X65J 4LFAJ 1FJGJ 3T1YJ 4KHPJ 5IT9U 5IWAJ 4X62J 5LM7E 4DV0J 4B3MJ 2HHHJ 4DR5J 1IBLJ 4JI3J 4X66J 4YY3J 4V1Ak 2UUAJ 2MTLA 4AQYJ 4LFBJ 2KL8A 1XNRJ 2MQ8A 4B3RJ 4DR1J 4DR7J 4DV5J 1XNQJ 4YHHJ 4DV2J 1XMOJ 4K0KJ 4NEZA 2UUCJ 1IBKJ 1IBMJ 4LF8J 1I94J 3JAMU 2ZM6J 2UXDJ 4RJVA 4DR2J 4LF4J 5LMUJ 2MEWA 1N32J 2VQFJ 3OTOJ 4JI6J 4X64J 1N33J 4DV7J 4KY3A 4LFCJ 1XMQJ 3D3CJ 4DUZJ 4LF7J
chains in the Genus database with same CATH superfamily
2XYHB 4ECTA 1ZM2A 3PXGa 1FTRA 3CDUA 3H40A 1LWXA 3GPAA 3UE2A 3BQ2A 2E5HA 5LSOA 1RCOB 4MFBA 2J9CA 1P6TA 3GZ7A 1UZHA 3RR8A 2HSEB 4ECWA 2FJAB 4XIUA 1MNEA 3KLHB 1BY9A 2M8HA 2PA8D 2R7UA 3KDNA 2RT3A 2DR8A 1JLGA 1KOHA 3L09A 2GJ2A 3LPEA 1RT7A 3R7NB 4DSEA 3ISND 1R7IA 1WWHA 1DBDA 3MZIA 1VDHA 2O66A 2MQOA 4ED0A 5LMUF 1TVRB 4CO4A 2NYHA 1VC6A 5HVFA 1TKTB 4LR9A 2MSTA 4HKQA 1JLEA 3C14B 2IYIA 1YZ6A 1SKWA 3RR7A 2H4YB 2GHWA 2Q6CA 4CTAA 3TP2A 1S6QA 4DZDA 4UZCA 5A6WA 3DOLA 3AD7C 3PO4A 2G1DA 4IO9Q 4OX9J 1IJFB 3QT6A 2AV5A 4Y00A 3I55S 3PVXA 2DGOA 2RF2B 1WC4A 4EZ9A 2QLWA 2RKIB 3IG1A 3JSMA 4PXCA 3V4IB 3L95X 4YB6A 4MJKA 1JKHB 2R7OA 1TR0A 4ZVRB 4J7CA 2R3VA 1M1KT 4NI2A 1JLCA 2QN6B 2L9NA 3HK2A 4LSNB 2QA4G 2DGUA 1CJVB 4DOZA 3LP1A 4PUOB 4K5SA 1WC5A 3EMTA 1HQUB 1VR6A 2XM3A 1TELA 1CJTA 4QWAA 3CCSS 3HHDA 4DQRA 4F36A 3RBEA 1F0XA 2RDDA 3IBWA 1KLMA 4PXEA 2HZAA 1WG1A 1T3OA 2BMBA 3W5ZA 3G6XA 1Y5NB 5J1PA 4EWTA 4OYIA 3K7RA 3ZC4A 3PHEA 2YWEA 2WOMA 4IFVB 2Y1JA 4X4UA 2XMWA 3EVOA 2IJRA 5JVHQ 1VQSA 2K7JA 4AXIA 1NSPA 4DX6A 2XULA 1PO6A 2AZ3A 3NXZA 3UWTA 2XCPA 1WEYA 1C1BB 3KHLA 1S9EB 1UPMB 1VCTA 1X5TA 1UEVA 2FQQB 1QUVA 5GAGI 1PBUA 3FK4A 1LK7A 1TV6A 3CE8A 3UNYA 4DR7J 1NDLA 2HURA 3FC9A 3C6TA 1BE4A 3W2WB 4DFPA 1CJUB 4ZLLA 4FN5A 1QE1A 3D66A 4NLYA 2BQUA 2IBKA 4FBUA 4MH8A 1FRKA 1T05A 5C25B 3DOKA 2OPRB 3VV2B 5AJ3F 2DNHA 4DPYA 2MLZA 4AFFA 1SQEA 3UVJA 4DR3F 1AROP 4J9LA 3N6NA 3CJ5A 1WI6A 2WONA 4MK8A 1KLNA 4HT5A 3KLFB 3ITHA 2JEIA 3E3XA 2JFDA 5C2CA 3EVWA 3AB2B 2FLPA 4ZOSA 1GMWA 3R5DA 2FJWA 4BC9A 2DO4A 3PIPQ 1U48A 4M5KA 4P7TA 2FC8A 2HRTA 4HH1A 4DCOB 3U02A 3NGUA 5F41A 3BGRA 3SIPB 4DQSA 2HQ3A 3K58A 2M8DB 3LQVA 2V50A 1BWEA 4HI2A 5CA5A 3VZIA 5KFNA 1VRTB 1MLAA 2P8IA 1RWNB 3IO1A 4DFJA 4P6QA 5AXKA 1ZPWX 1B7YB 1GNKA 3C6UA 2VKZG 4USIA 2BVZA 3D3CJ 2BJEA 1NPKA 4NL5A 1S0MA 4ZVPB 3JS9A 4I69A 3I6PA 3LANA 1D09B 1AZSB 1Y3KA 1FO1A 5L38A 1EQMA 1LWCA 1VMBA 1RTJB 3MM7A 5L1JA 1JLAB 5ETVA 3NS7B 3M6VA 5CYMB 4ZVHA 5MLCV 4AL5A 1JNRB 2YXLA 1F9FA 4RR5A 1VC0A 3TUIC 3NGTA 3CJSA 3BBFA 5KFDA 5F8JA 1FFWB 2QX0A 1NB7A 3TZXA 2FZGB 5H9FK 1U47A 2OSQA 1Z4UA 3CCRS 1KKHA 2C3YA 2CXEA 4WXWA 1P8GA 2CRLA 5IM0B 1S1UA 4DQPA 2WBRA 2FZCB 4G1IA 3PV8A 2DD8S 1QUPA 2DR9A 2X1BA 3A8EA 3AD9C 2R7WA 2MQQA 3RRHA 2NPIA 5K8OA 3W9JA 2MKSA 4UOFA 1U1QA 3BYRA 1ZOTA 3OHAA 1S1WA 2QC3A 5KFJA 3KMSA 1NM2A 1HYSA 1RABB 3MPDA 4KIAA 4Q5VA 2ACMA 2XO6A 1PGZA 3QATA 1Y5LB 4WK1A 2IM1A 3QT8A 3BSNA 4OZ3A 4IR9A 5EN1A 4J37A 1L3KA 5K20B 3POTB 4CH1A 1LWFA 2KZMA 4P73A 2UVUA 3EGZA 2RRAA 3OFHA 4USWA 3I0RB 2Y1IA 3PX6A 3H4DA 3UN2A 2XQCA 2OEJA 3MMBA 4K4ZA 4LQ9A 1YJVA 1RA6A 2YX4A 4PG4A 1EB0A 3HCXA 2AEJA 2XMTA 2ZD1B 4IRDA 1CS4A 3GV8B 1HPZB 2ROGA 4LMZA 4CYUB 2R7RA 3JXOA 1REGX 1WF0A 1XBWA 2M2BA 1B99A 3KLIB 3M30A 2H5IB 3G8SA 2BE2B 3I0SB 4CLWA 2B4OA 1K8AT 4CH0S 4OZ2A 3O1LA 4ZHRA 5K8MA 4GRSA 4Y2MA 2NLWA 2OPQA 4OV1A 5RUBA 4ZA1A 4DV4F 4C3KA 3QO9B 3K8WA 4W92B 3PIOQ 1TL3B 3MGJA 4DR4J 1P1TA 3G82B 4JI3F 2VBXA 5E41A 1YIJS 1S1XA 3EUNA 1JJ4A 3OL6A 4DQQA 4FXWA 2EFGA 2RQKA 1O8BA 1R89A 2C1EB 1RWWB 1Q82T 1HI1A 3D5MA 1PIEA 3AXMA 3VCDA 1NJWA 7FD1A 2N7CA 5E3PA 3T5JA 3DRYA 4M5DA 4J9PA 2V94A 2MHEA 4DI6A 3NMAA 3N4WA 2K7KA 2WSFC 1N32F 4P75A 2JLGA 5KT7A 2W7PA 3AQPA 2PFDA 2VHGA 4TKTA 3OLAA 1G4CA 1M5PC 1MW7A 2VH7A 1UWBB 4JI0F 3MUVP 3M9MB 3MM8B 1REVB 1MSWD 4ED7A 1TUGB 2MZJA 4JI4J 4YMEA 3H5YA 2E1PA 5IT4A 4QZVB 4OI6A 2RDJA 3LOUA 1IKVA 2RHQB 4K8RA 3K5LA 5E3AA 5DDOC 3K5NA 1R6YA 2HQIA 3R27A 3US5A 1UEKA 1Q7YT 1TK0A 3PY8A 4YY3F 2YWHA 2VICA 2HLUA 1F5BA 1QAXA 3PFOA 4B3RJ 1NK4A 4HHJA 2W25A 1M5KC 3CJ4A 3MTJA 1KHVA 3MEGB 3MAAA 2MJUA 1NK9A 5F0WA 4MTPA 1WEXA 5DS7A 2ILZA 1UL3A 3VGTA 3MF5A 5B7WA 4IG3B 4FVCA 2A3JA 4LQ3A 1QDUB 3MCSA 1NCLA 1M5VC 1RT3A 2E5LF 5AT1B 5AE1A 4U95A 3BR8A 3D6HB 3H2VE 3HHKA 2IAJA 2V2QA 3MPUB 5HQLA 1UVMA 3HSDA 4WIQA 2V63A 1QAYA 3MMCB 4IFYA 1S72S 2G2YA 1N5VA 2HNDB 2RS8A 4DV6J 2DHSA 1J5EJ 2B56A 2GGPB 2VG6A 4OJHA 3MPYA 3Q2SC 4H54A 5ETTA 3R97A 2MZSA 4A8OA 3GG1A 1DQAA 3NRBA 2EK1A 2OD6A 2RNEA 1IM6A 1U7LA 3M9NB 2ADBA 3DGPB 3K5MA 3ZTSA 1J5OA 4J9KA 3FNNA 4DV2F 2GVDB 3CCLS 2XY6A 3W3SA 2QJ3A 2M7SA 4MMOA 4JV1A 2ZDPA 3GONA 2PEHA 4K0KJ 5FDLA 2OTLS 3OV7A 2CZ4A 2KH9A 1TKZA 5KOXA 3DHWC 2I38A 2X1GA 2HVIA 2KRRA 3AA8A 4K2XA 2DR7A 1CJKA 3F44A 4Y6IA 4Y34A 1UFKA 3DN9A 5FD1A 3IWNC 4JOUA 3BSAA 4UOCA 3BGOP 3FRYA 3NS6A 2L9WA 4OYWA 3OL8A 5KAKA 3WZ0A 1I51B 4JYAJ 1T3NA 3LP2A 1X4AA 1RA7A 2QE5A 2AW0A 2H51B 5KFHA 4A8SA 2D3UA 4P72A 1H3DA 1NJXA 1KS2A 3CC2S 1HBNA 2YKOA 1U02A 1VQNS 3AT1B 3CULA 4B3MJ 3MHYA 3MEDB 2J7KA 3KLVA 2LQBA 2RAQA 2JZ5A 3R8YA 1HBMB 3DRRA 5LXYA 4ID8A 4D3GA 2QEXS 1F1BB 1JWWA 1N5TA 2WAQD 1HNVA 2X51A 2UP1A 1NJIT 2VV5A 3ELHA 4RO0A 4I7FB 2CWKA 2AGQA 4OX9F 1OYDA 5EX3A 2LA6A 5D0GA 2L08A 5B08A 3OL9A 5LT5A 4MKVA 4JI5J 3F73A 1X4HA 1RTDB 4OIXA 4G3IA 5DZ6A 1Q79A 1PYTA 4OX7A 2AGOA 4OYBA 4I6WA 1Q4RA 2CYYA 1FRJA 2C3UA 2IFXA 3I82A 3W5XA 2PGCA 1ZTTA 4RW8B 1N6QA 4CLLA 1H38A 3HD1A 1ZM9A 3MMAB 3VF0B 1RAIB 1RKJA 3N5FA 1DJ0A 4F4YA 3N79A 1KBRA 1SC3B 3NOCA 1C1CA 2APOA 3FMBA 1Q95G 3LGNA 1AT1B 1FWLA 2JJ4D 4YB5A 5H9FJ 3OL7A 3EGNA 2AIRB 2DNLA 4M5MA 2HS3A 3IAM9 3NY0A 3KLGA 1WF2A 3W8GA 1FXLA 1VIXA 1HIYA 2DNQA 5KFXA 1HWLA 3OT9A 3SSRA 3KYLA 4CLZA 4ICLA 5E33A 5IXUA 5I42A 5HJYA 2J9EA 2J6SA 3MOZA 3UO0A 4UUXA 2PO4A 3BM7A 4IOAQ 1WKLA 5GADI 2MGZB 2YKNB 1D1UA 5EWEA 3M32A 4XTTA 4F2SA 1HQEA 4DR7F 3J80Y 2DGXA 3LP0A 1WELA 2DNRA 5GVQA 4DDFA 2GC8A 2XI2A 2B51A 4DJBA 2A6MA 2MY7A 3RG6A 1T94A 4PQAA 4OQJA 1BGXT 3M8ZA 4MYUA 2ZBCA 3GFZA 1DTQB 1B64A 4M95A 3FZ2A 2EVZA 4YDDB 2GQ2A 3MAHA 3M8PB 5E3RA 1FRHA 4CNZA 4FYDA 2YQ3A 4KQZA 1RT2B 3QGGA 2BQRA 1IKWB 4Q2MA 3MM5B 1YITS 2OO4A 1NKBA 3R2DJ 2WCXA 2KVQE 4LSLB 4DN9A 2KFYA 5HBMB 3J81U 2GHVC 3KJVA 4NLSA 1NPPA 8AT1B 4TYAA 1S9GA 3NP5A 5KFBA 3T1AA 3EICA 2AEMA 2B9EA 5A6PA 4B9TA 2ZVSA 4ES2A 1DRZA 2F63A 5J2PA 2J6TA 1WOPA 1LW0A 2VBYA 1IBLJ 4R5PB 4F50A 4LJMA 2GIRA 2MTLA 2RMLA 1UTAA 4CO3A 1ZM4A 3N5BA 4O23A 2NR0A 4FKYA 4ZLJA 5C5JA 3NNAA 4DF8A 3TW0A 5DG8A 3QLHA 1OQ3A 4NMXA 3QZ8A 4ALZA 3OD2A 4N41A 3OW2R 5CYQB 1URRA 1X4BA 4ELTA 4F4WA 1RYSA 3TI0A 3OLBA 4KHMA 2AZ1A 2HHXA 2O01C 1EQ0A 1PC5A 2HHSA 5DM6Q 3H42A 2GVZB 3A13A 4ZVFA 2NQPA 3G87A 1DURA 4ZVUB 2BJ3A 4Y2KA 2G0IA 1JX4A 2HHPA 3DLGB 1TKXB 1X7VA 4A8YA 4W90B 2BRLA 2AU0A 4KV8B 2HLTA 3UCGA 5HROB 2H65B 3OR1A 3JAMY 3Q23A 4Q2LA 5A8WA 4OHZA 2WVBA 1HI0P 1X0PA 3RTVA 1WSRA 3PDNA 2HG4A 3F41A 4LFBJ 4URSA 1NLKL 3KFWX 2HMIA 1RQ0A 1T9WA 4XK8C 1B0TA 1XNQJ 2HGNA 2YNGB 3D0IE 2CQHA 2DXFA 1D0EA 2B4PA 4Y28C 4YR0A 2CG4A 4TYBA 2DPJA 1H72C 4FKXA 2QSWA 3MR6A 3JQMA 1RHMB 3LF0A 3CJRA 4LF7J 2EI5A 1HNXJ 4ANCA 4DV1J 1R6VA 4HH0A 4ZP6A 1VRQC 2KB2A 2NUHA 3NCPA 5F9NA 4J91A 1N34J 2GMLA 2YPYA 3MM9A 5EUHA 3JSRA 2KVIA 3IGVA 1GX5A 3G2XA 4USHA 2R8KA 3UDLA 4ZPVR 5HL7Q 1RT7B 4RNNA 3MD3A 4QPXA 2W4PA 2LEBA 2HFUA 3FEYB 3J7YU 4DPXA 2GO8A 1RAJA 5HAOA 2CJYB 3QIPA 2E9ZA 1NZAA 2QLJB 1JLEB 3VVTA 1E6VB 4F3MA 4DN0A 2IDLA 1YGYA 5LSLA 2OPPA 4CDIA 1RBAA 2G1HA 4C2MA 1UW4A 4O0IA 4IDKB 2JL9A 3NL0A 5KG5A 3CCVS 3JB9k 2HZVA 1LWEB 4HDHA 3DOLB 3KK2B 3OVSA 4M63A 2ASLA 2ZFHA 4AXJA 2NXUA 3ZZYA 2VUGA 1FF2A 1VC5A 5L1LA 3JSMB 4IRKA 2YNFA 1TUVA 3LPYA 2LQ5A 4J9QA 1KD1T 4CM2A 2ZC3A 4F3OA 2Z2ZA 4DR4F 3EDRB 3DYAA 4B3SJ 2YTCA 4J9OA 3W9HA 3ZZTA 1NEEA 1HL6A 2IC3A 4Q8FA 1KNZA 2LFVA 3ZTRA 5I4MA 2D1CA 3LP1B 1T7PA 1T11A 4DSFA 3OVBA 1N0UA 4KGXB 4OYXA 1CQNA 1MMDA 4F0KA 5DQHA 3QWPA 4G65A 4NCAA 3V2UC 1R8PA 5L8RC 5DGBA 1HHTP 3FMWA 2QFIA 3J81Y 2KXFA 4R0EA 4NLUA 4X64J 2JHEA 4JI4F 3Q22A 1OMSA 2XBPA 3DRPA 4WPAA 2BE9B 2FLLA 4F4XA 3CCQS 2Q79A 3R5CA 4PABA 2V6AA 3C8YA 5BYSA 3M8SA 4JI8J 3D2WA 2DKOB 3UN3A 1U2FA 4OJGA 1ZA1B 3KK1B 1HR0J 5ETOA 1N5YA 3TOQA 4EFAC 2BKPA 3UN5A 3KUEA 5D77A 2IMOA 5D0HA 1NPRA 2JLEA 1Y11A 1TV6B 2V69A 1HLWA 4RW9A 2H54B 2J0QD 5KFYA 3C6TB 1RDRA 2KT5A 4B3RF 2DBBA 4ZJQA 1S6OA 1QE1B 4K4XA 4URQU 5L9NA 1T05B 2F4FA 1UA1A 3DOKB 3PJWA 2B4VA 1YRXA 3ZZOA 4DHVA 2A1BA 2C3MA 4ILLA 3UVJB 2RE1A 2DVIA 1Q8KA 3P49B 3EZ5A 5IT0A 2RH3A 2N3OA 4RNMA 4USTA 2DEJA 2VQFJ 2IMWP 4CIOA 2KJVA 3OTCA 4Q45A 2B43A 3ITHB 4OLOA 4TLQA 4LFCJ 1PG5B 3PR4A 2HHTA 1L3SA 3MECA 2I1RA 5DO2A 3HSJA 2V5HG 2X1AA 1D9AA 2I0XA 1UEUA 1KDNA 4P7VA 2VASA 3QSYB 5A8RA 4DV6F 2PIIA 1RHUB 1J5EF 1FFGB 3L9ZA 2C28A 2HIYA 3OR2A 5E3CA 5B0FA 3B6BA 3BPDA 3ENQA 3BGRB 1HNIA 4FS1A 4ZVQB 2BBEA 4QWDA 1RXOB 5LSRA 1JJHA 3NAHA 3FCVA 1NK8A 4K0KF 1R8HA 5ETRA 1SB6A 3GE9A 2B5JA 3CDWA 3IR7B 3T6JA 4I6YA 1FNOA 1KVKA 1U45A 3CCMS 1U1KA 3C6UB 3SBMA 3FEXB 2Z56B 4QU7A 1Q8IA 3QQCD 2E1MC 3RB3A 1VK8A 2Y0BB 4C4WA 3MM7B 2ZBIA 2DRBA 3C15B 4JYAF 4IYQA 3EWGA 4ED4A 4RU9A 1SJ1A 4RWWA 2JSXA 1NHKL 1FKPB 3DMJB 1P1LA 3AH6A 4WP3A 2AF6A 3QRRA 1UZDA 1GH8A 4RBVA 3CJQA 1GX6A 2Z8QA 3V81A 1NKEA 2NXCA 1KR4A 4CT9A 1YWXA 4B3MF 2ZH4A 3KJNB 3C3LA 3K5PA 3EE3A 1VBYA 4U96A 5LM7E 1S1UB 2ZEJA 1WTFA 3A3NB 1MROA 3GTYX 3AJDA 3H5UA 3T5LA 5G0RA 1EAYC 4C8YA 1EHWA 4A8KA 2E7XA 2LQJA 3BKUA 5ITHA 2BR0A 3Q8SB 2QV6A 1QAJA 2UUCJ 2J6UA 3CVKA 1YVFA 2V9WA 3TUZC 1S1WB 2VG7B 2G4BA 3R1LA 3RAQA 3CEDA 1RT5A 4LRBA 5KG1A 1R0AA 2KT2A 3CJKA 3FBCA 1RWOB 5K5MA 1K1SA 4JI5F 3OUYB 1WHVA 4KYZA 3QSIA 2BKOA 2QLXA 2KFNA 4OX6A 3HP6A 2KYZA 4DL5A 4GO7X 2MKKA 2W9CA 1VBKA 2DNOA 3TQEA 3BBBA 4DG1B 3MMBB 1GK8A 3PR5B 3S1TA 1U1PA 3FBFA 4NRUA 1ROFA 2V9KA 3D9BA 3ZZZA 1RT6A 2D69A 2KI2A 1SV5B 5KFIA 2O1PA 5DLGA 3M30B 4O3OA 1F9HA 2EBGA 3M6UA 2HW3A 3MEEA 2MEWA 4X4VA 4P71A 4I56A 2A0FB 4MK9A 2V8HA 1LFWA 2DHAA 2OPQB 2QT7A 4MKYA 4RX6A 2K1RA 1PYOB 5J2NB 1RGVA 2NYIA 3SCIE 4J9SA 4ILRA 2HNZA 3W8PA 4WE1A 1FNMA 3M8RA 3TO8A 1S1XB 1FXRA 3H20A 1SIZA 1KVJA 1WHYA 1R27B 1TL5A 3HFVA 3BB5A 4KTQA 4PWWA 1ZH5A 3SXLA 4DLEA 1R8AA 4RNOA 3W66A 1VJWA 1NK0A 4ZCMA 1EARA 1K44A 1MU2A 2K3IA 3PW0A 1MN9A 4RW6A 3Q83A 4LRCA 1I5OB 2GIFA 2MZ1A 3R9LA 1GTEA 3I87A 4LR7A 5EWFA 4J90A 5HQ8A 2HK3A 2NS1B 1YJWS 2GFFA 5F0UA 1T95A 3B78A 4DCPB 1UJ6A 4J9RA 1WTBA 4O0NA 2IDEA 4V19J 4NCGA 3PYFA 1S77D 5D78A 2NXNA 4Q0BB 4U7UK 5KFEA 5D8HB 2FHOB 2PSZA 3CCZA 1RWMB 1IKVB 2B8QA 1IR2A 1VHFA 3UD5A 2UXCJ 1RKIA 3R1HA 1Z2LA 1VK3A 3W9IA 2UV8G 4WU3A 3TA1A 4OZNA 4KC5A 1AFIA 4NEYA 3GCWP 5LJ5Y 1EETB 1NDPA 3KG1A 3HZGA 2NXEA 4OI4A 4NLTA 3BSCA 1RT4A 1HI8A 4H4MA 4U7UD 4EK2A 3M2VA 4PG6A 5KFVA 3A8KA 2VG5A 5CQGA 4HI1A 2CQ2A 3MAAB 4WFXA 5A2QY 3AD8C 3ONQA 4BLGA 2BJ9A 3E8OA 1VLOA 4ZPBA 3IAS9 1J27A 4X2BA 1XN9A 2LA4A 1H74A 2AEFA 2W2QP 2BM0A 2VA2A 4LF8J 3TZYA 1RT3B 4F0MA 4ZN1A 2Z0GA 2LYVA 2IAJB 3PEJA 3CPWR 2JEGA 3VGSA 2XWXA 4FYYB 4C11A 2Y9HA 1WKKA 2OFHX 1PKUA 1YJTA 2YH0A 2W9BB 4G1PA 2RD5C 5J2QB 4IFYB 5EDWA 3O6QA 1VJQA 2V2KA 3VR1A 3QPIA 4C48A 3ADAC 1FE4A 2BA9A 4CLSA 3ISZA 2ZJRQ 4WIIA 1WD6A 3CDBA 3Q8RB 1QY7A 1U2CA 3TVZA 4FNIA 2PMZD 3T9ZA 1J5OB 3IFEA 1QVFR 2Q3PA 3SI8A 2H1YA 4WF9Q 5J1EA 2P9GA 2IIHA 2XYGB 3RZAA 4LFBF 1HD1A 2MXYA 2HHHJ 3LGHA 1TKZB 3C2PA 1XNQF 1O51A 3L4BC 1G1XA 2KU7A 4HLBA 5I3PA 2DR5A 3V6DA 1W2IA 1PBAA 1CJKB 1SUQA 3ZNJ1 4UW2A 4NRTA 3FSXA 4QBUA 2CJAA 4AYBD 1P27B 4TU7A 4QW8A 4LF7F 1HNXF 3LUYA 4TY9A 4DV1F 3CJTA 2AYBA 5AXNA 1RTIA 2J7UA 2CQCA 3TUPA 3JSBA 4PXBA 5A8KA 2LDIA 4LRFA 3MR5A 1N34F 2EEYA 5GAEU 2VF3A 2V67A 1HWIA 1HBNB 1RT1B 5DDRC 2MQLA 1LXNA 2HBQB 2OLWA 5CCLA 3ZTOA 3DHXA 2DH7A 2DXEA 2MKHA 3DRRB 5K8NA 5CCMA 2LU2A 5J2MA 5DQGA 2CQ0A 3MR3A 4X4OA 2UUAJ 2DO0A 2IM3A 3FFIA 1YBAA 2H3EB 1HNVB 1RLDA 4IG0B 2XNRA 4BDPA 4WBFA 2DIUA 2GS8A 2HS0A 4Z37A 1KC8T 2CPHA 3TEHB 3KLHA 4P2SA 2EPIA 1NJZA 2HBRB 4OL8A 2FZKB 3I9ZA 1TL7B 4IH7A 5AXMA 1NNDA 3D6MB 4DUZJ 3TUJC 3A12A 2ZHOA 2EG2A 3K5OA 4DL0C 2ZWPA 2E44A 4B3SF 2QO3A 4OX8A 4ECRA 1RB0A 4X4NA 1TKTA 1T9TA 5LJ3Y 3CW2C 3G96A 1N0VC 1JLFA 1VRUB 4M5NA 1ZTWA 2XWYA 2MZRA 1W26A 5HVGA 4TN2A 3VTIA 1C1CB 1MMLA 5HMXA 1SQFA 3U1MA 3SYZA 2F4VF 1AW0A 5H9EK 1LQ9A 3UCUP 3ZNUA 4I0WA 3PCOB 4GVLA 3TWZA 3GIIA 2EFNA 2W4DA 2EKYA 3CMES 1TL1B 1U6FA 3CSKA 5KG2A 1QTNB 2DGSA 3KLGB 1R8CA 3M9OB 3BO4A 2CQIA 2EW9A 2RF2A 2RKIA 3I96A 1QAIA 1U0HA 4X64F 4PQUA 3HVRA 3I5BA 1JKHA 5U47A 1S57A 5I42B 2OTJS 1TAQA 5HJXA 4USJC 4JI8F 2UV8A 2BYCA 2ZH3A 2G2ZA 2HAFA 4JI1J 1S4EA 2E7WA 2PI5A 4WP8A 4XPCA 4Y2IA 1HR0F 4DPTA 3EXYA 2IJNA 2ZOMA 3AOBA 1E6YB 2XI3A 4WFBQ 1RWUA 2JFKA 1HQUA 2AHOB 2FD2A 3GJQB 1VQMS 1CC7A 1YLXA 4FPRA 1CBKA 2QG9B 4WFAQ 2XMVA 3E01B 4Q44A 2UU9J 2M3DA 4OHVA 3FJ2A 4X4SA 1X0FA 2K2PA 3OTDA 2L48A 3ENAA 2BDPA 4WZMA 3DU5A 2KFZA 4GVBA 4RW7A 2XNQA 4KBIA 3VAKA 4KO0B 2NSCA 3U1LA 3VVUA 3W5YA 2MKJA 3C16A 2E1CA 3NBPA 3GIMA 2J8SA 4J9VA 3BGUA 3H2UB 4IFVA 2VQFF 3OFGA 3W2VB 1S0OA 4BBYA 2DCLA 2ZH1A 2ZOFA 4XAKA 5F8IA 1Y0HA 4LFCF 3OFEA 3G6YA 5DDQC 2CIMA 3HJFA 1C1BA 1S9EA 2QL7B 3TANA 4KGZB 1JK9B 1S9GB 2ZNYA 4WYLA 2CQPA 2MSSA 4KFBA 2CUYA 2OKQA 2OH2A 2EC0A 2C2OB 4YFUA 1V3SA 4XO0A 4U67Q 4TU8A 3WBZA 2R2TA 5J2PB 1RCXB 3RRGA 3W2WA 3BH6B 3R7BB 3AOAA 1WORA 5D4PA 1A0OB 4HVZA 4A4JA 2BRKA 3T1HJ 5C25A 2UUTA 2FJDB 3X3UA 2W2OP 4QR0A 2R8GA 3VGVA 4ETXA 4LF2A 4C98A 3QLHB 4BWJA 3G4SS 2IYGA 1F5AA 2ZH5A 2YNIB 1VS3A 1IR0A 1NDKA 2GJIA 4AL7A 1Y9OA 3HHLB 2FHJD 2KHDA 4YHHJ 2V8GA 3KK3B 1M90T 3VZHA 2HAIA 3DDKA 1RLCL 3P5TL 3G9CA 5K9FA 3F56A 3AB4B 1RAAB 2CPJA 1BLUA 2QL9B 3FQKA 2CNLB 4W98A 2H5EA 2XGPA 4G1QB 1NKCA 1HW8A 5JJBA 2CQBA 3EM1A 1FD8A 1DLOA 2PMHA 3N9UC 3UCZP 4KH0B 5A8WB 3LH2S 3WHIA 2XSJA 3T19A 3GILA 4BCAA 3CO0P 3MFIA 2HQCA 3GU0A 2W7OA 4HL9A 2MQMA 2OEMA 1UVJA 3W65A 3TRGA 2IRUA 1CVJA 1VQ5S 1J2VA 4EGLA 1Z1ZA 5I3QA 4ZN3A 2VBWA 4KH1B 2C22A 2FLNA 2B9YA 2XS5A 1VQOS 1IKYA 1AZSA 2C2NA 4DSJA 4RUCA 2UUCF 1UJ5A 3TARA 1RTJA 2X1FA 2AGPA 4F26A 1X4GA 2R7VA 5CYMA 1IM4A 1BQMA 3LALA 2RHSB 2O5DA 1WHXA 3VWSA 3FCHA 1F2HA 3IM8A 2C2KB 2LMIA 1X4CA 3CIMA 2CA9A 2DT9A 2CQ1A 1M1HA 3HFKA 4GKKJ 4IOBA 2DH9A 4Q8EA 3S8SA 2FIUA 1M5SA 4KGVB 4CP5A 4M5HA 2ACYA 2JEFA 5D0EA 2EWHA 1U8WA 3V4MA 1S12A 4C8KA 3VALA 4C0HA 2HIQA 1KQGB 3QIPB 5K14B 3H4BA 2FGOA 3PZPA 3CIZA 3CDAA 2ZOGA 3PJXA 1JLBA 3HHLC 4KT0C 2VODA 4K4YA 3T1YJ 2ZNZA 1N56A 1HMVB 2ASDA 2JOQA 2OPPB 3QWUA 3PRBA 1JB0C 4LBHA 1L5UA 3LAMA 4DU7A 4YUDA 4J9MA 2MQPA 4RNFA 5IC6B 2KZZA 4UUWA 3OXLA 3QRPA 2FY8A 1S59A 4K4SA 1GXUA 2FJEB 2RILA 1A7GE 1U1RA 1SJRA 3G86A 3G71S 3D6FB 2RUSA 2OUGA 1XJWB 2ZM6J 4ED3A 2Z30B 2DNMA 2HHVA 1EX8A 3EX7B 2W24A 3R6LB 1GMUA 4CLUA 3CJ3A 4RNHA 3DM2B 2DIVA 3ENVA 3ZFVA 3DYAB 2C2MB 4U6PA 2FB0A 4QWEA 4OZ5A 5BJRA 2IC3B 5ETKA 1DQ9A 3ZTQA 1XIQA 1HWUA 1PAEX 2BABA 3G6ES 4F02A 3BO3A 5GAGU 1JLQA 4X4QA 1HPZA 3TJAA 2FJBB 4CYUA 4Z7CA 2CJXB 5KT5A 2RRNA 2NZCA 3HKZD 4EU0A 3UFCX 5KFUA 2BE2A 1X31C 4ANEA 3S7RA 1A9NB 1U6BA 3GJSB 3PRVA 3B4MA 2KYXA 4R25A 3ET6B 4BHQA 3N6LA 1KVIA 3HMJG 2YBVA 3SQGA 2IVMA 5DLFA 3TJ8A 5ETQA 2W4CA 1TL3A 3G82A 3GWCA 1U0SA 4C8ZA 2UXCF 5LOQA 1VYAA 4H4KC 4ID5A 3KHHA 2Z2YB 1JJCB 4RW4A 1RUSA 1JNZB 1N5YB 1Q5VA 4ELUA 3PW2A 3GG0A 3PYDA 4OZJA 2IRYA 4PWDB 3KWMA 5IFMA 2CPEA 4USKA 2KJWA 4RW9B 3ILLA 9ATCB 4PXDA 2WBMA 2CQGA 5KFLA 1VQKS 3THPA 4E2FB 2XLKA 2DITA 4ZIWA 4QQBA 2JH3A 2PT0A 4IQMA 2C42A 2ZBRA 3GLJA 2WRMA 1UWBA 3H25A 2V8VA 3D54A 1REVA 2WB4A 3UI3A 2AYGA 3JTPA 3KTQA 5EHHA 4QIVA 2XO7A 4LF8F 4DV5J 1RZMA 1XMOJ 4OYAA 3DLBA 5CXTA 1HFEL 1U25A 3IBFB 4WU2A 1KN6A 4OZLA 3CD7A 2ASJA 1FK9B 1VQ7S 3RJMB 3OTOJ 2E1AA 4I68A 4C8MA 4M5LA 4RUBA 3ILJA 5A8RB 2OJ3A 2B3TB 1YHQS 4IKAA 2KM8B 5HMWA 2XLJA 1KRPA 1LW2A 4PWUA 4NLXA 1HNIB 2YX7A 3MEGA 2R8JA 3SZ2A 4LR8A 4QWCA 2NZ4A 3L7OA 3DKDA 3GSIA 2BJ1A 2UUBJ 2L41A 1YK9A 3J7AN 2H48B 3GFHA 4MAKA 3EGVA 5EX0A 2HHHF 4OHWA 2O67A 4ZCIA 1X5PA 3Q8VA 2VFVA 3I32A 2DNGA 2MZQA 2W7AA 4WFNQ 3VQSA 3NWGA 3RBDA 4IOCQ 1RADB 3MMCA 4USMA 1F60B 3TA2A 1NBEB 2HNDA 2V34A 1D9DA 1F3FA 1NZ8A 1N5SA 2B8PA 4QCLA 1EP4B 4DR2J 3SQOP 2WW8A 2YWWA 1VGYA 3GFYA 3ETMA 3PM9A 4P9SA 2UXDF 1C0UB 1IWGA 1YQHA 4JUZA 4NXNJ 4K4WA 2GVDA 5DG7A 4OHYA 2BJDA 3EPGA 4B3TF 1H73A 3GIKA 3RYLA 2QL5B 5T41A 1SH3A 2QMWA 5B0GA 2IHR1 1CLFA 2KDOA 1WEZA 4NYOA 3GB0A 2UUAF 3DLEA 1HBUA 5G0RB 2YKPA 1R31A 1VFJA 1OYEA 3KDOA 3UDCA 4DV0J 2YWGA 2LU1A 2ROPA 3EDQB 5DM7Q 2QLBB 3M8QA 2XS2A 3PFEA 2KN4A 5A0YA 4DL6A 4LBPA 4WFYA 2RQMA 4N5SA 3NEKA 4WTYA 1U24A 2KM8C 4ZVEA 2XZDB 4NASA 4KR0B 3CJKB 5M2UA 1ITPA 3IRXB 1RTHA 4DUZF 2HBZB 4O4GA 3CMAS 1K47A 2CPXA 1U8SA 1N33J 3M2RA 1S76D 4L3KA 1YSJA 2XY5A 3MEDA 1FT8A 3UW1A 3P8BB 1FX4A 4C97A 4JI2J 2BANA 5F8GA 3RAXA 2W9CB 2GO9A 2M4MA 1RJJA 2CZ9A 3ILOA 4DF4A 3IXQA 5B0EA 5F3TA 2RSQA 1XQIA 1L3VA 1XTZA 4UQTA 2EG1A 4B9SA 2N7YA 2KO1A 2AKWB 1SH0A 3C19A 2XEXA 4I7FA 4OV6A 2XZTB 2UZAA 1KONA 1RT6B 3M1VB 4RBUA 3D67A 2RQ4A 1OSCA 1PJ6A 4WJBA 4FZVA 3EYZA 3W63A 3MEEB 1VISA 4WXOA 1S6PB 3OFFA 4RWXA 1KTQA 3TZWA 5F8NA 1IQZA 1RTDA 3V5RA 5GAEI 2ABYA 3BDEA 3CO9A 5SUHA 1FKOA 4BC7A 2HNZB 3KLEA 2HWTA 2QA1A 4FF2A 6AT1B 1RE1B 4C0OC 4JI1F 2HQGA 1R0BG 1VQ9S 1UVLA 3M4XA 3UDEA 2UVRA 3NWRA 3V6HA 3MDFA 5CABA 2R7SA 7AT1B 3B4DA 1OPIA 5EWGA 1FHTA 1UMJA 4CLFA 8ATCB 4GC6A 3I5CA 2UU9F 1RISA 1MU2B 1V3RA 3HULA 2CQDA 1HHQA 3RRKA 4RW6B 4DU8A 4H4OB 1VQPS 2QZ8A 3CMQA 2F8EX 5M2RA 1WOOA 3AA9A 3BBCA 1KQSR 2F9JA 2CQ3A 4PG7A 1CULA 4DEZA 1FA0A 2UUWA 3FVYA 2HQFA 2VJUA 3A8JA 4NCGB 3RW6A 2ATLA 1D3WA 1F3VA 1O6XA 5HO4A 4DX8H 4MYTA 3H8YA 2K06A 5BXIA 1ZZNA 4WK3A 2BV3A 2FLOA 2YKNA 2W2MP 3QAEA 3PTWA 4CLTA 2E66A 2I6WA 1LOUA 1KHWA 4WKYA 2ZH9A 3P3DA 4J9NA 2E5GA 4QIWD 2AP6A 4ECXA 2ADCA 1RT4B 1KQKA 4YR2A 5JVGQ 3CTRA 3T1HF 1DTQA 1WG5A 2VFUA 4ER8A 4TY8A 1N36F 1ZAXA 1FCAA 1FEEA 2ZE2B 1U1OA 2IA6A 2KT3A 4V19X 3DI6A 3HSGA 5IWAJ 3K17A 1RT2A 3J7A1 3O5TB 1KFDA 1Y7PA 3GV5B 1RWVB 2YKMB 3HFZB 3EPIA 4LVOP 4YHHF 5KFWA 4NCBA 2R7QA 4HTJA 2JNJA 4NE9C 3H5SA 3TAMB 1OY9A 4C11B 4RL1A 2YX1A 1IBKJ 1YJ7A 2W01A 4ELVA 2YWFA 4L74A 1S48A 5T7LB 4OFZA 4C9DA 3N0VA 1KEKA 2XMUA 3TAPA 5HATA 1BC6A 3K2YA 2D9OA 3D28A 7FDRA 3MM6A 5FIIA 1G7CB 4NA3A 5J1EB 3QT5A 3FBEA 4ZVSB 2CJBA 3MR7A 4ERDA 3T5HA 3QT7A 2F8MA 4KKOA 2JC0A 5CYQA 4ZLNA 3IRWP 4K4VA 3CCUS 4ZPDA 3NNCA 5CD4H 3AXKA 3I4HX 1JXEA 2GVZA 2K3KA 3HF5A 2HHWA 4QIGA 1SUQB 3GR0A 4USVA 4QU6A 5HLFB 5GMKa 2RB7A 1OY6A 3MCMA 5D0RA 4ECUA 3RB4A 1SXLA 4B02A 4KPCA 4KV8A 1FRIA 2OAUA 2CPDA 3MFHA 1RTIB 4J9UE 3SV3A 2AYEA 4CCHA 4B9VA 3NNHA 2V8DA 3CCJS 4GKKF 2FPHX 1XERA 2L9DA 1IUJA 4TLRA 3X1LB 2HHQA 3JSYA 2I5JA 1VBZA 2VC0A 4QWBA 4CWBA 4L6V3 4DPUA 5ETNA 3JYTA 3KOAA 2VDIA 4ZITA 4OJ3A 1TFWA 4R0JA 3KXDA 5B0AA 3OSPA 2EKNA 2OD4A 4NLWA 2GMJA 3HDSA 2QTWA 3AOCA 1LK5A 5J2MB 3T1YF 1LXJA 2ILYA 3NCQA 2OMOA 2VQEF 2P9EA 4ATNA 3FFIB 3EJMA 1H2UX 3HO1A 4D3HA 3D1QA 4F4AA 2B6AA 3IGNA 3UD3P 3HSZA 2OEKA 1TUWA 3AQOA 4DR5J 1U2RA 3OQ2A 4B9LA 1H0HB 3MURP 1S4FA 3I5AA 4CH7A 2YNHA 1B70B 5CZXA 2ZM6F 1S1VB 1IN0A 1GFWB 2BOPA 2B7BB 3MPVA 4CNYA 1T03B 3V6JA 4A8XA 5KFMA 3CXCR 2JC1A 4FXDA 4JI6J 1ELOA 3D68A 4N56A 2BW7A 5GADU 1A6LA 1SC1B 3H5XA 2DHGA 5KT6A 3ZZ0A 2BOAA 3QIDA 3M2UA 1RK8A 1E6VA 2VU5A 1FXDA 4DCJB 5FJ4A 1JLFB 1WI8A 3BQ1A 2W9AA 4LF5J 3Q89A 1WKJA 4FNHA 4NLGA 3BN7A 4NLPA 4IDKA 4PYAA 2OP5A 3P4UB 1LWEA 3KK2A 5DRKA 5LL6d 4ZVGA 2EFQA 3HI9A 3FQLA 2XC9A 2OSRA 4X4TA 2WHOA 1U0HB 1W7WA 4PQUB 2AJ0A 3D6TB 2VZ9A 3SCKE 4M5JA 3H0PA 3JTNA 4ZK7M 1CSJA 4CQ1A 3IWLA 3MR2A 3D4JA 3BO2A 2LXFA 1H2TZ 3M8WA 3F0NA 5KFFA 3U27A 2HRUA 1D8ZA 4DR6J 3BS9A 3K57A 2VOPA 4P2XA 3RUBL 2B0GA 2LXUA 1SPBP 5JUMA 2DPIA 4GVBB 4RW7B 1K9MT 3LAKA 2FGCA 2VONA 1V9OA 4W4MA 4O3RA 3C16B 3NBPB 1JJ2R 2VA3A 3EGWB 4DV5F 3KUHA 3Q0AA 2PEBA 2CQ4A 2COLA 3M8YA 2K8GA 1C2PA 1XMOF 4ZVOB 4DR1J 1YRUA 3OBIA 3FCWA 4OI2A 4DUTA 3TVKA 4CI0B 5HP1B 3FZBA 3KK1A 4UF4A 3IA0A 3OTOF 2JVRA 2MKCA 1WC6A 2MJNA 1XR5A 4KFBB 1RSCA 5AE2A 4BS2A 4UOHA 4PG8A 3DLKB 3PNIA 3BYPA 2IRXA 2V8PA 5L1KA 1UVIA 2UXBJ 2VL1A 3J7ZT 1GTHA 4ZVTB 1QTMA 4JP8A 5FLXU 3ILIA 5IV4A 1AUSL 5IZHA 2UUBF 2HS4A 3ICLA 1DHMA 4QR2A 4TXSA 4O3SA 3RU0A 4DMZA 5F8LA 3IS9B 1F6TA 4O44A 2JLFA 5IC4B 3PO5A 1SC4B 3HHEA 5C24A 1U09A 1S0NA 4HACB 4YQWA 4UT4A 1S1TA 2WVDA 3LTOA 4WYWA 3PRDA 1UVNA 3QJJA 2FVPA 1YBUA 5KT4A 2N4DA 2CKWA 4MFBB 2AJQA 2HGLA 4DR2F 5KFOA 3CC7S 2UVWA 3VAJA 1DLOB 5K8PA 2VPYB 2KXNB 1IKXA 2PD1A 3IR5B 4K50A 4NXNF 3NMRA 5G4DA 1RAEB 4DX5A 2XSJB 1JLGB 3TX0A 4DPWA 4ZMMA 1PC4A 2HWIA 1TQLA 2CPZA 1FDAA 4B3OA 3B8HA 1N5QA 4NLQA 3H90A 4JV5J 2DNYA 1NO8A 1TK8A 2XMKA 3SFUA 4DV0F 1SL0A 3FEZA 3IN5A 1IKYB 1UP1A 1X4DA 2XG8A 3C15A 1V5IB 3S01A 3DDIA 4AL6A 4AUKA 2MKIA 3BSOA 4CTAB 2G2OA 1S6QB 2WSCC 1FKPA 5L39A 1BQMB 1GEHA 4EBDA 2VFRA 3DMJA 3MD1A 2JDJA 2NPFA 4EI2A 2VD3A 4F2RA 4YB1P 2XGQA 4G6VB 4NLVA 3I4PA 1N33F 3IG1B 4CZCA 1DTTA 3G8TA 3KMQA 2JX2A 5DQIA 1B0VA 3DRSA 4JI2F 5E7OB 4NI2B 5L1IA 1JLCB 1H98A 4C3LA 2AJFE 3BKTA 3IMQJ 1IJEB 1VQ8S 2G9OA 1LV5A 1JLBB 4YN3B 1NJYA 2QLFB 4RBTA 2I9SA 3MTKA 1CJTB 3JTOA 2CZVC 2F4VJ 2VG7A 3RAMA 4X65J 2WVEA 3GR1A 1KLMB 3CCTA 1SJQA 3RBXA 3TZZA 4I2PA 4NZ7A 1C0TA 4WFZA 2GJFA 4QW9A 4Q43A 2KL8A 5IQ6A 2HFNA 3OUYA 1VLYA 4LF1A 1FD2A 2RJZA 4M5GA 3GJTB 3ZZRA 4MT1A 2BZ2A 2XTJP 2CVIA 2PDAA 2WOMB 2FYXA 3EXCX 2DEIA 3HPOA 3IM9A 2DXDA 4ANDA 3ENWA 3TVYA 4CO5A 5F9LA 4CLKA 5M2PA 4DG1A 2CDRB 4CT8A 4ED5A 3E2EA 1U49A 1WUUA 4N8OA 5KT2A 3CGIA 3PW4A 1JLQB 2Z2LA 3FBBA 3A3OB 1HARA 1X9MA 3G8QA 4ZPCA 1YJRA 1BMQB 3NKYA 1SV5A 3ZXWA 5L9XA 1OO0B 1DAXA 2DTJA 3T9NA 3BJYA 1ZM3A 4YP3A 4MKBA 2MLXA 2AQ4A 3T6BA 4DL2A 1B4SA 3GYNA 5THWA 2F40A 5IT9U 1AXQA 1I1GA 3SEOA 2IVYA 5J2NA 2P6TA 2D3OR 3SQGB 2NREA 2J0WA 1RBLA 3OTBA 1G3OA 2GX8A 1HBOA 2RDIA 2X7IA 1NU4A 2WONB 4DX7A 1XR7A 4X84A 3N28A 2MKYA 1AUDA 1EKRA 3AY0A 3PG9A 1JMTA 2N3LA 4ID5B 4RW4B 2M5YA 1HHSA 3HLUA 4O3NA 4R8UA 5FLXY 3AJ1A 3HXMA 5LXRA 4ETZA 2QSFA 4DQIA 4EMDA 4F7VA 3OSNA 5IOLA 2AX0A 4O4RA 3BR9A 1YJUA 2GW8A 5DJBA 2RQCA 4MIWA 4GC7A 1M5OC 3DLLQ 1URNA 1S5ZA 1CEZA 1RI7A 4X4PA 4B9NA 2ZC4A 5IWAF 4UQGA 5D4NA 4Q0BA 3B82A 1YKWA 2YPZA 4PCQA 3MAQA 3SV4A 4IH5A 1V6HA 1XMBA 2GNKA 2M0GB 3CB4A 2ZH7A 2J8AA 2QA2A 1FWPA 4NPOA 2LECA 4ZCLA 3A4TA 3TNVA 1IBKF 3ULHA 2GAGC 3QAUA 2D3O1 3M05A 1YG0A 1LWCB 4PPZA 1EETA 2ZUAA 3VGUA 2W2PP 1FDDA 4KB7A 2ZITA 1S7IA 1OIAA 4QIEA 1LW2B 2MQNA 4WZQA 2DY9A 3U7JA 2GQCA 4RLEA 3J80U 3BDPA 2MB0B 1KFSA 4MIAA 4NXMJ 4N7TA 2E5IA 4GKJJ 1FEHA 3PKMA 3QFHA 3EZUA 5IV3A 2CAJA 3PX0A 1I3OB 5D3GA 3BPSP 2YH1A 4DV3J 2JEJA 2UVVA 4RU2A 2P5VA 2HYIB 2VOOA 4TNOA 4I2QA 1FJEB 3OVAA 4Z2XA 1M1GA 2W9BA 5J2QA 2M9KA 1O5JA 2IPOB 1K0VA 5D4OA 3KHGA 1U1MA 4S0MA 1RP5A 2NXJA 1RAGB 1HYSB 1WACA 1U26A 4PAAA 1X4FA 2F8HA 1YTYA 5I3UA 1NSAA 1RBOB 4N8NA 1S10A 3P45B 4K5RA 2HK2A 2CADA 2B4UA 2AJ2A 1Y4ZB 1BWVA 4NLDA 2KXHA 1LWFB 2RUGA 2Y1LB 4HHUA 1VQLS 4JI7J 1RTZA 3BKFA 2CG8A 2A18A 3DDNA 2FJVA 3BEGB 1JQGA 2QFJA 4ZJOA 1T0TV 3DLEB 1HBUB 1N88A 1DY3A 5B0DA 3HHLD 2ZKTA 2BJ8A 4P2FA 1CS4B 3HX9A 4DR5F 3M8QB 4GMKA 5A0YB 1SJFA 1UVKA 5ETLA 1RHQB 1RAOA 2LQ9A 1KSPA 3MEKA 1YX2A 2LXIA 1GAOA 1RTHB 4ZHRB 4O3PA 3I9V9 1ZETA 4O4GB 1RT1A 4FVMA 3NGDA 1I6JA 3M2RB 2GV1A 4JI6F 3ISNC 3JAMU 2GQQA 3FDSA 3FSIA 2BANB 1T9UA 4LT6A 3HM9A 2HNYA 1GXTA 4AE5A 5KFRA 1FDBA 5C7PA 3DC2A 4LF5F 2D74B 2HWHA 4ED2A 3R2CJ 3DGVA 4ILMA 1T8EA 4IG0A 2HFOA 1X9SA 2AX1A 2LVWA 2GCFA 3B54A 4K4UA 4M5DB 5IT9Y 4A46A 2WK4A 1N52B 4KHRA 2DRAA 4URGA 2A6OA 2BACA 3CDEA 2V4QA 1TL7A 3C66A 4FF4A 5CHCB 3GCXP 2PI4A 2QYCA 3CCWA 1JXVA 1Q0NA 3IP0A 5DGAA 1FKOB 4FF3A 4PRFA 3CJ0A 3RBZA 3ZO7A 3VAIA 3KLEB 4Y65A 1UAWA 1IBMJ 1SKUB 2V68A 3V6KA 3AAWB 2QIFA 4JV2A 1VRUA 4WKRA 5B0BA 3QYYA 3WC0A 4DR6F 4ZS6A 2M88A 2ERRA 4N77A 2A2DA 1N54B 3GYGA 1Q53A 4TQSA 2CNNB 3SCLE 3MUTP 3HVTA 1TL1A 3HZEA 2DGWA 4C8LA 2XLIA 2X3DA 2MPUA 3VQTA 5D6GA 3MCNA 1SL2A 4DFMA 1F2GA 1W25A 2YY3A 5KFZA 5C42A 4ZJLA 4ZIVA 1CULB 2BW2A 4LF6J 4E98A 1TK5A 2J7WA 1TL4A 1O0PA 2CVEA 3I31A 2QRRA 5E5NA 3BGLA 1RAFB 3MOJB 1IVZA 4KHPJ 3R7SB 1NXIA 3T3FA 4DR1F 5HMZA 2E9RX 1L3UA 3BN4A 3HT0A 3WDOA 1DQ8A 2V4JA 4CRJA 3NLCA 1FWKA 2E7VA 3H7HB 1HW9A 3GIRA 5CD4A 5DETA 2DNNA 5DDPC 1E6YA 3DRXA 2W8LA 4P2MA 2H5JB 2B9XA 4OZ1A 3E01A 2LEPA 2VG6B 2UXBF 2XY7A 1DZ5A 1SL1A 1BQNA 3VAGA 1X4EA 4EO8A 4QJVA 1S97A 4TY8B 3H98A 4KO0A 1X9WA 2J0XA 1N4LA 3TAQA 4C0BA 2E1RA 3ZZPA 5KG6A 3DI6B 3QRQA 1RWKB 1IR1A 5FDLB 3W2VA 1YJNS 4I4BA 1NHVA 3BZQA 2OPSA 1Z2ZA 4M94A 1NSQA 2N4CA 3GV7B 4OZ0A 4CLYA 3SDEA 4EYIB 3CWJA 4NX9A 3DCAA 4ZDNA 4ED8A 4LFAJ 1N8RT 4X62J 2YKAA 2R2UA 1QSLA 5IQQA 3MMJA 2CPIA 3DLHA 1UCNA 1CPZA 4YB7A 4CO0A 2VFSA 4QYZK 4FDFA 3GJRB 3LP2B 1SC6A 2ZWOA 1FRXA 2DGQA 1UFLA 1TAUA 2G0JA 3M6WA 2UXDJ 3Q86A 1F9EB 6FDRA 1WC0A 3KG4A 3MM6B 4XPEA 1ACMB 1QJHA 5AE3A 3DOMA 2VB6A 4Q7AA 5E2QA 2HVDA 1XMQJ 3CD6S 4FYXB 4Y3CA 4B3TJ 1B3TA 4LVNP 2YNIA 1HNWJ 3R5GA 2BE7D 4KKOB 1WDDA 2FVCA 3AHPA 4DL7A 3HHLA 4ENOA 4JV5F 3KK3A 3EZOA 3THTA 4IR1A 1TMMA 1HNZJ 3OJUA 4O3QA 2EK6A 3PW7A 4L3NA 4QYRA 1Q86T 2D3ZA 3L7PA 1RHRB 2XMMA 3FKBA 4G1QA 1HKAA 3O3LA 1EZZB 1VQYA 2R7TA 3FRZA 2J76E 2HEKA 4F4ZA 4PZVA 4OI1A 1UETA 2Z4PA 5KFGA 2FDNA 1XNRJ 2F3JA 1FDNA 1FJCA 2J5AA 3K0JA 3J7Z5 4UY8T 2NCKL 4B17A 3QJLA 2CJQA 2HZCA 4P74A 2I5JB 1GT8A 3WC2A 4MKAA 3JQKA 4B9MA 4B9UA 1UW9A 3JYTB 1TVRA 3DNCA 4DV7J 1BQXA 2CNOB 1N6QB 4K7QA 3C14A 1KQFB 2VFTA 2EFVA 3W61A 4EBEA 3THVA 4NZ0A 1R8BA 5HN0A 1YZ7A 1S99A 4I67A 4C3MA 5HK4A 2B6AB 1APSA 4LF9J 4X65F 1BD6A 2MDAA 1MMNA 1WG4A 1BHNA 1LNQA 3W62A 1FTCA 4FPIA 3SSSA 2ATCB 3HHNB 4U9RA 1L3TA 1PJ7A 5GAHU 4L73A 4QPTA 2YNHB 2H4WB 3R5AA 2AD9A 1S6UA 4F04B 2QA4S 2Z57B 3A1YG 4AQYJ 3LWLA 3V4IA 1RWPB 3PX4A 1FNXH 4ICLB 5KOWA 5BYRA 4HTIA 3ZZUA 4H4KA 2CPYA 4A8FA 4NEZA 4LIRA 4DLGA 1EIYB 2Q66A 1U4BA 2F65A 4LSNA 4PEOA 3OPKA 5K14A 1CJVA 3M2UB 4OI3A 3J7YI 4J5OA 2OGUA 2FJXA 4K2JA 4LUBA 4PUOA 2XB2D 2IVFB 1HMVA 3M32B 3UR3C 3NOGA 1Q78A 5CH7B 1TKDA 3RW7A 1NB2A 1HQEB 3BREA 1WJ9A 3Q8YA 1TFYA 3R3TA 4ITSA 2DHXA 2Z2MA 2ZHAA 2R8IA 3LP0B 2HBYB 2CWXA 2ZZTA 1RACB 5LMNJ 1VQ6S 1WSVA 2A10A 2L3MA 1OWXA 2KHCA 4U8VA 1D9FA 3IC1A 3CNQP 2G0CA 2CPFA 3WQPA 2YQ1A 2AT1B 5B09A 2ZBQA 4DSKA 5ADZA 4ECVA 5F3ZA 1S79A 1XEZA 4KJIA 3KHRA 2R9LA 1FJGJ 4TQRA 2M52A 5J1NA 4CLPA 4B08A 1NMEB 3NAIA 2WTFA 4BWMA 1KP6A 3E51A 3EVMA 2DCUB 3DM2A 1FVSA 3PW5A 4Y2CA 4UTGA 1TU0B 5DZ7A 2VIHA 1TZ0A 2XSFA 3KJVB 2OMLA 4AT1B 1SQGA 1ZZFA 1NH7A 2DK2A 3BV8A 1Y00A 1AA1B 1WC1A 2M70A 4KAIA 3C46A 4PYDA 5F8MA 1T9XA 3TJ9A 5F8HA 4ZPTR 4F67A 1CJUA 2XHWA 4YOEA 3SFGA 5L46A 2IY5B 1LW0B 4KRWA 2FVQA 2OPRA 1X60A 1SKSA 1C4CA 1N36J 2VJVA 3ET6A 1NK6A 4JV0A 4HEA9 5KFTA 3DXSX 2FY1A 4ECQA 2X3GA 2BQ3A 3DU6A 4HHHA 4U8YA 3HVAA 3KLFA 3D0HE 4RPFA 4IQXA 2ALZA 3SMZA 3OTEA 2R42A 2GIQA 1U1LA 4V1Ak 1AFJA 1MWZA 4NA2A 1FE0A 2VC1A 3Q8UA 3BGFA 4PWDA 2LDYA 1XR6A 2HVHA 1PAUB 4LSZB 3CC4S 2O3DA 1PILA 1LEOA 5ETSA 3HJVA 4WWSA 3OR1B 4FF1A 2LEAA 2Y8YA 4ED6A 4LF4J 4DFKA 2D41A 1R3NA 2HHUA 2XMJA 4NXMF 2HFVA 2DNZA 4GKJF 2BUNA 1VRTA 3P6YC 4DUYJ 4UOGA 4DSLA 4O44B 2F1FA 1YDLA 4DV3F 2HMIB 2HPUA 4NLOA 2F5GA 5C24B 1SJ4P 1BUXA 3FSYA 5KT3A 2KKHA 1NH8A 4EEYA 3AJ2A 1HQ2A 1S1TB 2DNKA 2P6SA 4U7CA 2XCAA 1FX2A 3UDVA 1FVQA 1FK9A 1H6KX 1SCJB 4ZCKA 1OY8A 4X4RA 4RUHA 1XK8A 3GMGA 1GXLA 1JLAA 1JIHA 3PHTA 2ASYA 4X66J 2U2FA 5HSPA 3O8WA 2DGTA 2ZH2A 3KNAA 1IKXB 3K89A 1ZS6A 2FUG9 3Q8PB 1RHJB 6FD1A 4IRCA 4KGMA 5KG0A 3MM9B 1I94J 2N82B 5HVHA 1EJ7L 2GHPA 2FVSA 4DXLA 4K4TA 2WVFA 1JXLA 2VPZB 5IM0A 4EUVA 1X8DA 4ECYA 4JI7F 4KSEB 2Y3YA 4B3OB 1H7XA 3AFGA 2PC6A 3RB6A 5BR8J 4E0DA 5A2QU 2E5JA 3KJQB 1YI2S 1UJ4A 2HQDA 1NSKL 4DL3A 3GSDA 2WVCA 3W7BA 2J9DA 3D0GE 2V2VA 3FUYA 3QZ7A 2VQEJ 2GZOA 2IJFA 4F8RA 3KG0A 1EP4A 3KJFB 3CJ2A 1S7HA 1C0UA 2C3OA 4EYHB 1WC3A 5KFAA 3QNWB 4DBQA 3HVWA 2C2RA 3NGKA 5HANA 3M7VA 2YNFB 3CD0A 1DTTB 3D7SB 1MWYA 3WX4A 1EKSA 1RHKB 3POTA 4XDDA 3DRSB 2P2CB 2P9CA 1Y3JA 2JVOA 4RKUC 2SXLA 5KG7A 3I0RA 2C3PA 4RJVA 4ZLPA 4FXVA 5LMUJ 2MHNA 2LKZA 3CT9A 1NAQA 4QYZJ 4OLPA 3OXFA 1Q8LA 2ZHBA 1SH2A 4MK7A 2WB1D 2ZD1A 4ZP8A 2FC9A 3LW5C 1OPZA 3NGRA 4HT7A 4NMLA 2C2ZB 3NS5A 4LIWA 2EC2A 2R8HA 4ZP9A 2NSBA 3KLIA 4I6AA 4P52A 1Q81T 3PACA 3I0SA 3LA0A 4I2PB 4CM0A 2Q1LA 1C0TB 5DG9A 5KFKA 4JB8B 4PR6A 1HWKA 3IBCB 4ZPAA 3IRXA 2V0NA 3QMQA 4C8OA 2DY1A 3CJ8A 2RVJA 4ZKAA 1NK7A 2CJ9A 4E8UA 4RZRA 2DHHA 1V5VA 3QO9A 4OJ1A 4I1TA 4L75A 1B0PA 3DRPB 2J9DE 1AB8A 4WP9A 2RU9A 1G6BA 2VKRA 1D8YA 2BEFA 2GA7A 1ULRA 1IBMF 2E9TA 4A8QA 2QYGA 1TMJA 1S9FA 4M1KA 1KWMA 4C7QA 2HFSA 5EGYA 2LQ8A 3M1VA 4KY3A 1OJ4A 4OHXA 1QSYA 3L3CA 3W64A 4YEAA 3H2LA 1HWJA 9RUBA 1S6PA 1OS5A 3D3BJ 2BKNA 4OI0A 4JBCA 4LF6F 2U1AA 2D9PA 3MM8A 3PKYA 4OYZA 2FHJA 2ZUGA 2BJ7A 2YVSA 2BM1A 1GMVA 4KHPF 1HBOB 4C8NA 2H9ZA 1LKZA 2PE8A 4N76A 1VHIA 3N01A 4LBIA 1CG2A 2MMYA 5JXSA 4YR3A 5H9EJ 4Y0FA 1V3ZA 3Q24A 4LRAA 3MECB 3A8IA 1SJ3P 5JMNA 3BH7B 1Y5IB 3Q8QB 4R8UB 3TQ1A 4OMFG 1ZA2B 1QM9A 1IXKA 3T5KA 1DARA 3Q2TC 1T9YA 2C2EA 4K59A 2J0SD 1VIOA 3OR2B 2OFGX 3NCRA 4H4OA 2IM0A 2PMWA 2DNPA 1Q8BA 4MIBA 4PG5A 1WHWA 3GFXA 2KTQA 4DS4A 2W1BA 2RRBA 1P9QC 3P5BP 1SI9A 2ALYB 2ZH8A 5AJ3J 3I56S 4ES3A 4IG3A 5KG3A 1F5CA 3MI7X 4DR3J 2HVZA 3R5JB 4RUAA 2B5JB 2W8KA 3BF4A 5KFCA 5CYJA 1CQMA 1PJ5A 2YWKA 2Y0SD 3DLJA 4LFAF 2F7VA 3TX8A 2F9DA 4GO5X 5D15A 3WIVA 4CO2A 5SZTA 4X62F 4USUA 5KFPA 3J81j 4FYWB 4L76A 2YKQA 2MZTA 2PFFB 3VHQA 2ROEA 3UQSA 4KPYA 1X5SA 3W60A 4N47A 5KFSA 2GGPA 4M8LA 4L72B 2E29A 4HYKA 4A8WA 5GMEA 3MCOA 3UPFA 4NYPA 1G2EA 3P96A 1IBLF 3PEHA 4FBTA 4OYMA 4F25A 1UWAA 2OIHA 3DGPA 2DYAA 2ZE2A 3IR6B 1M0SA 3V81B 5E0OA 3QGIA 1DFDA 1XMQF 2AWZA 4CO1A 1ZAVA 2QMUB 3TA0A 3TEGA 1S49A 1HNWF 4P10A 4KGKA 4ED1A 5D3GB 1Q7LB 2YKMA 1FRMA 1H7WA 3FGVA 3GP9A 2HGMA 1MROB 2G13A 1HNZF 3K8VA 1PYSB 3OXGA 4XDCA 2KG0A 4I2QB 4EZ6A 3LGMA 2MLYA 1BXNA 2DISA 3TAMA 2R7XA 1SIWB 2LLZA 5GMDA 3HKWA 1K73T 4FYVB 5T7LA 3LO3A 2DR6A 4Z7YA 3GIJA 5A76A 3PYGA 3CUNA 2V2ZA 3NGSA 4TU9A 1UPPA 2Q43A 1RT5B 2JWNA 5KG4A 4F3QA 3KKFA 2BX6A 2MYFA 1C4AA 4EBCA 1Q5YA 3MWBA 1XNRF 1K0TA 2B9WA 1T9VA 1R0AB 1PCAA 2AYMA 1FJ7A 1H2VZ 2AJ1A 2D7SA 5I3UB 4ZPWR 2ZBPA 1FFSB 3QBCA 1Q16B 3ETOA 1VQ4S 2ZDOA 3QGPA 2XZWA 4NA1A 4DV7F 2MY8A 2I2YA 4YDXA 1HBMA 1R0CB 1QD1A 5H1SV 1WDTA 2GAHC 4M5IA 5ETMA 2XHCA 2I8EA 5HLFA 3HT3A 4LF9F 3VAHA 3VAMA 1UA0A 1QVGR 1NUEA 1XC9A 5IS2A 1RYRA 1YRTA 1KTVA 1FERA 2AJ4A 1ZBTA 3GQCA 4NOHA 5CZVA 4NYZA 4QIFA 3SCJE 3T41A 1ZAWA 1X5OA 4AQYF 4YS2A 1TP7A 3UD4P 3KUGA 3O2IA 2K1RB 2ZJPQ 2WSEC 1YJ9S 1B7FA 3RGIA 2JRSA 1RU1A 2KRBA 3D1OA 4DL4A 3QGHA 2V4RA 4WE1B 4RW8A 3AODA 2ZJQQ 2HNYB 2ZZNA 4F0HA 3MMAA 2YQ0A 3KNGA 2QMXA 4WCEQ 2HFZA 2EFOA 1N48A 4ES1A 1YBTA 2W2NP 2HVEA 3NG8A 4DSIA 2PN6A 1RAHB 5LMNF 4PKDB 1FESA 3QJPA 4NZ6A 2XMAA 2EFPA 2FHMA 2CFXA 1P9YA 1XWLA 1NDCA 5HMYA 4DPOA 1KOOA 1S1VA 2CJKA 4EO6A 2QGFB 2LP4A 1FJGF 2C2DA 1T03A 1U1NA 4NLRA 2LCWA 2HKEA 3M6XA 4DV4J 3VAFA 3R5BA 4TVAB 3DXBA 1R43A 4UY85 2R4FA 2R2RA 2PA3A 4JI3J 3WIUA 3CD5A 5MAOA 3PYEA 8RUCA 1ZYQA 4QOTA 1IQTA 1RWXB 2MGZA 4DWIA 3RB0A 1NRKA 5KTQA 1S0VA 3L7UA 1HD0A 1ICEB 4Y2AA 1UFWA 1MG7A 1NK5A 2BXJA 1Y10A 1NHUA 5HQMA 4I64A 1VI7A 1N32J 2IBOA 3HVTB 3QFWA 4H4MB 2OELA 3M2VB 3UNGC 5BYQA 2KG1A 2VG5B 2FVRA 5GAHI 5C42B 4AD6A 2FHKA 4PPDA 5HI7A 3MUMP 3M8PA 4JI0J 2VBZA 2DGVA 4ECZA 2RU3A 2A2CA 2POKA 2B7CB 2DJWA 1IKWA 2RS2A 1QLNA 4OYPA 3A3PB 2AMCB 3D1HA 3MM5A 3OHBA 3UR0A 1WNEA 4LSLA 4NWBA 2VPXB 5HBMA 1QSSA 5C2GA 4LRDA 1LFPA 2EBEA 4C6AA 2V4JB 2DB1A 3K59A 2FTRA 2CNKB 4A48A 2VDHA 2DH8A 2XS7A 4ZP7A 2ZVIA 4YY3J 2CDQA 2ZKUA 4IUFA 1GQEA 2Y1RI 1SVDA 1M5HA 2NUUG 3TR5A 4LREA 2RIJA 1FRLA 1CC8A 2EXUA 3R6GB 4R5PA 4LF4F 3GYXB 1BQNB 2Z58B 4QR1A 1U6ZA 4HR2A 1WOSA 3LWMA 3S6EA 1K1QA 5D4LA 1UKUA 4IH6A 3H59A 1SKRA 3TYTA 1MN7A 4DUYF 3SSQA 3HD2A 4ECSA 4F4KA 2DRDA 2XYPB 1FKAF 2GMHA 2OI2A 2OPSB 3U1NA 2HRYA 1WF1A 3MXHP 2WZ1A 4A47A 3V6DB 3SDEB 2E5LJ 3CF5Q 1T02A 1FI4A 3W1YC 2ZH6A 5HP1A 4IO1A 1ZPVA 2ZZMA 1VBXA 1PSDA 5CAAA 1Q1KA 4UZBA 4WTOB 1OQ6A 2IM2A 3DLKA 2VPWB 4FP9A 1W2BR 3DLGA 3WX8A 1TKXA 3N6MA 4X66F 5KFQA 3OJSA 3DFEA 1GMWD 3IWXA 5HROA 2IA0A 5ETPA 5E3QA 2Y8WA 1IBCB 2Q6BA 5T14A 3BQ0A 2OHDA 4DZ6A 5A8KB 2MQ8A 4OYOA 1OSDA 5B0CA 2WW4A 1VOMA 3JQJA 1I94F 1MWQA 3PJ9A 3ZTPA 4DV2J 3DOMB 4FS2A 3IS9A 1SBRA 2R2SA 1AYEA 4HDGA 4A8MP 3CCES 4KE5A 3G6VA 5BR8F 1RU2A 2YNGA 1HA1A 4HACA 4DS5A 1TTHB 1IWAA 3O44A 5AXLA 3MPWA
chains in the Genus database with same CATH topology
5BR8J 2UXBJ 3J80U 4B3TJ 1HNXJ 4HHUA 5A2QU 5AJ3J 4NXNJ 4DUYJ 2UXCJ 4JI7J 1HNWJ 5FLXU 4JI1J 4NXMJ 3IMQJ 4JI4J 3R2DJ 4DR6J 2KVQE 3R2CJ 4GKJJ 4DV1J 4JI2J 4KYZA 4JI0J 4DR3J 4JI8J 3J81U 1N36J 5LMNJ 4JYAJ 2E5LJ 3D3BJ 4LF5J 4NEYA 2VQEJ 4OX9J 3W1YC 4GKKJ 4JI5J 1HNZJ 1N34J 4LF9J 4DV3J 1HR0J 4B3SJ 2UUBJ 4PWWA 3J7AN 4DV6J 4JV5J 1J5EJ 4LF6J 2UU9J 2F4VJ 3T1HJ 4DR4J 4DV4J 4X65J 4LFAJ 1FJGJ 3T1YJ 4KHPJ 5IT9U 5IWAJ 4X62J 5LM7E 4DV0J 4B3MJ 2HHHJ 4DR5J 1IBLJ 4JI3J 4X66J 4YY3J 4V1Ak 2UUAJ 2MTLA 4AQYJ 4LFBJ 2KL8A 1XNRJ 2MQ8A 4B3RJ 4DR1J 4DR7J 4DV5J 1XNQJ 4YHHJ 4DV2J 1XMOJ 4K0KJ 4NEZA 2UUCJ 1IBKJ 1IBMJ 4LF8J 1I94J 3JAMU 2ZM6J 2UXDJ 4RJVA 4DR2J 4LF4J 5LMUJ 2MEWA 1N32J 2VQFJ 3OTOJ 4JI6J 4X64J 1N33J 4DV7J 4KY3A 4LFCJ 1XMQJ 3D3CJ 4DUZJ 4LF7J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 J;  2UXB J;  3J80 U;  4B3T J;  1HNX J;  4HHU A;  5A2Q U;  5AJ3 J;  4NXN J;  4DUY J;  2UXC J;  4JI7 J;  1HNW J;  5FLX U;  4JI1 J;  4NXM J;  3IMQ J;  4JI4 J;  3R2D J;  4DR6 J;  2KVQ E;  3R2C J;  4GKJ J;  4DV1 J;  4JI2 J;  4KYZ A;  4JI0 J;  4DR3 J;  4JI8 J;  3J81 U;  1N36 J;  5LMN J;  4JYA J;  2E5L J;  3D3B J;  4LF5 J;  4NEY A;  2VQE J;  4OX9 J;  3W1Y C;  4GKK J;  4JI5 J;  1HNZ J;  1N34 J;  4LF9 J;  4DV3 J;  1HR0 J;  4B3S J;  2UUB J;  4PWW A;  3J7A N;  4DV6 J;  4JV5 J;  1J5E J;  4LF6 J;  2UU9 J;  2F4V J;  3T1H J;  4DR4 J;  4DV4 J;  4X65 J;  4LFA J;  1FJG J;  3T1Y J;  4KHP J;  5IT9 U;  5IWA J;  4X62 J;  5LM7 E;  4DV0 J;  4B3M J;  2HHH J;  4DR5 J;  1IBL J;  4JI3 J;  4X66 J;  4YY3 J;  4V1A k;  2UUA J;  2MTL A;  4AQY J;  4LFB J;  2KL8 A;  1XNR J;  2MQ8 A;  4B3R J;  4DR1 J;  4DR7 J;  4DV5 J;  1XNQ J;  4YHH J;  4DV2 J;  1XMO J;  4K0K J;  4NEZ A;  2UUC J;  1IBK J;  1IBM J;  4LF8 J;  1I94 J;  3JAM U;  2ZM6 J;  2UXD J;  4RJV A;  4DR2 J;  4LF4 J;  5LMU J;  2MEW A;  1N32 J;  2VQF J;  3OTO J;  4JI6 J;  4X64 J;  1N33 J;  4DV7 J;  4KY3 A;  4LFC J;  1XMQ J;  3D3C J;  4DUZ J;  4LF7 J; 
#chains in the Genus database with same CATH topology
 2XYH B;  4ECT A;  1ZM2 A;  3PXG a;  1FTR A;  3CDU A;  3H40 A;  1LWX A;  3GPA A;  3UE2 A;  3BQ2 A;  2E5H A;  5LSO A;  1RCO B;  4MFB A;  2J9C A;  1P6T A;  3GZ7 A;  1UZH A;  3RR8 A;  2HSE B;  4ECW A;  2FJA B;  4XIU A;  1MNE A;  3KLH B;  1BY9 A;  2M8H A;  2PA8 D;  2R7U A;  3KDN A;  2RT3 A;  2DR8 A;  1JLG A;  1KOH A;  3L09 A;  2GJ2 A;  3LPE A;  1RT7 A;  3R7N B;  4DSE A;  3ISN D;  1R7I A;  1WWH A;  1DBD A;  3MZI A;  1VDH A;  2O66 A;  2MQO A;  4ED0 A;  5LMU F;  1TVR B;  4CO4 A;  2NYH A;  1VC6 A;  5HVF A;  1TKT B;  4LR9 A;  2MST A;  4HKQ A;  1JLE A;  3C14 B;  2IYI A;  1YZ6 A;  1SKW A;  3RR7 A;  2H4Y B;  2GHW A;  2Q6C A;  4CTA A;  3TP2 A;  1S6Q A;  4DZD A;  4UZC A;  5A6W A;  3DOL A;  3AD7 C;  3PO4 A;  2G1D A;  4IO9 Q;  4OX9 J;  1IJF B;  3QT6 A;  2AV5 A;  4Y00 A;  3I55 S;  3PVX A;  2DGO A;  2RF2 B;  1WC4 A;  4EZ9 A;  2QLW A;  2RKI B;  3IG1 A;  3JSM A;  4PXC A;  3V4I B;  3L95 X;  4YB6 A;  4MJK A;  1JKH B;  2R7O A;  1TR0 A;  4ZVR B;  4J7C A;  2R3V A;  1M1K T;  4NI2 A;  1JLC A;  2QN6 B;  2L9N A;  3HK2 A;  4LSN B;  2QA4 G;  2DGU A;  1CJV B;  4DOZ A;  3LP1 A;  4PUO B;  4K5S A;  1WC5 A;  3EMT A;  1HQU B;  1VR6 A;  2XM3 A;  1TEL A;  1CJT A;  4QWA A;  3CCS S;  3HHD A;  4DQR A;  4F36 A;  3RBE A;  1F0X A;  2RDD A;  3IBW A;  1KLM A;  4PXE A;  2HZA A;  1WG1 A;  1T3O A;  2BMB A;  3W5Z A;  3G6X A;  1Y5N B;  5J1P A;  4EWT A;  4OYI A;  3K7R A;  3ZC4 A;  3PHE A;  2YWE A;  2WOM A;  4IFV B;  2Y1J A;  4X4U A;  2XMW A;  3EVO A;  2IJR A;  5JVH Q;  1VQS A;  2K7J A;  4AXI A;  1NSP A;  4DX6 A;  2XUL A;  1PO6 A;  2AZ3 A;  3NXZ A;  3UWT A;  2XCP A;  1WEY A;  1C1B B;  3KHL A;  1S9E B;  1UPM B;  1VCT A;  1X5T A;  1UEV A;  2FQQ B;  1QUV A;  5GAG I;  1PBU A;  3FK4 A;  1LK7 A;  1TV6 A;  3CE8 A;  3UNY A;  4DR7 J;  1NDL A;  2HUR A;  3FC9 A;  3C6T A;  1BE4 A;  3W2W B;  4DFP A;  1CJU B;  4ZLL A;  4FN5 A;  1QE1 A;  3D66 A;  4NLY A;  2BQU A;  2IBK A;  4FBU A;  4MH8 A;  1FRK A;  1T05 A;  5C25 B;  3DOK A;  2OPR B;  3VV2 B;  5AJ3 F;  2DNH A;  4DPY A;  2MLZ A;  4AFF A;  1SQE A;  3UVJ A;  4DR3 F;  1ARO P;  4J9L A;  3N6N A;  3CJ5 A;  1WI6 A;  2WON A;  4MK8 A;  1KLN A;  4HT5 A;  3KLF B;  3ITH A;  2JEI A;  3E3X A;  2JFD A;  5C2C A;  3EVW A;  3AB2 B;  2FLP A;  4ZOS A;  1GMW A;  3R5D A;  2FJW A;  4BC9 A;  2DO4 A;  3PIP Q;  1U48 A;  4M5K A;  4P7T A;  2FC8 A;  2HRT A;  4HH1 A;  4DCO B;  3U02 A;  3NGU A;  5F41 A;  3BGR A;  3SIP B;  4DQS A;  2HQ3 A;  3K58 A;  2M8D B;  3LQV A;  2V50 A;  1BWE A;  4HI2 A;  5CA5 A;  3VZI A;  5KFN A;  1VRT B;  1MLA A;  2P8I A;  1RWN B;  3IO1 A;  4DFJ A;  4P6Q A;  5AXK A;  1ZPW X;  1B7Y B;  1GNK A;  3C6U A;  2VKZ G;  4USI A;  2BVZ A;  3D3C J;  2BJE A;  1NPK A;  4NL5 A;  1S0M A;  4ZVP B;  3JS9 A;  4I69 A;  3I6P A;  3LAN A;  1D09 B;  1AZS B;  1Y3K A;  1FO1 A;  5L38 A;  1EQM A;  1LWC A;  1VMB A;  1RTJ B;  3MM7 A;  5L1J A;  1JLA B;  5ETV A;  3NS7 B;  3M6V A;  5CYM B;  4ZVH A;  5MLC V;  4AL5 A;  1JNR B;  2YXL A;  1F9F A;  4RR5 A;  1VC0 A;  3TUI C;  3NGT A;  3CJS A;  3BBF A;  5KFD A;  5F8J A;  1FFW B;  2QX0 A;  1NB7 A;  3TZX A;  2FZG B;  5H9F K;  1U47 A;  2OSQ A;  1Z4U A;  3CCR S;  1KKH A;  2C3Y A;  2CXE A;  4WXW A;  1P8G A;  2CRL A;  5IM0 B;  1S1U A;  4DQP A;  2WBR A;  2FZC B;  4G1I A;  3PV8 A;  2DD8 S;  1QUP A;  2DR9 A;  2X1B A;  3A8E A;  3AD9 C;  2R7W A;  2MQQ A;  3RRH A;  2NPI A;  5K8O A;  3W9J A;  2MKS A;  4UOF A;  1U1Q A;  3BYR A;  1ZOT A;  3OHA A;  1S1W A;  2QC3 A;  5KFJ A;  3KMS A;  1NM2 A;  1HYS A;  1RAB B;  3MPD A;  4KIA A;  4Q5V A;  2ACM A;  2XO6 A;  1PGZ A;  3QAT A;  1Y5L B;  4WK1 A;  2IM1 A;  3QT8 A;  3BSN A;  4OZ3 A;  4IR9 A;  5EN1 A;  4J37 A;  1L3K A;  5K20 B;  3POT B;  4CH1 A;  1LWF A;  2KZM A;  4P73 A;  2UVU A;  3EGZ A;  2RRA A;  3OFH A;  4USW A;  3I0R B;  2Y1I A;  3PX6 A;  3H4D A;  3UN2 A;  2XQC A;  2OEJ A;  3MMB A;  4K4Z A;  4LQ9 A;  1YJV A;  1RA6 A;  2YX4 A;  4PG4 A;  1EB0 A;  3HCX A;  2AEJ A;  2XMT A;  2ZD1 B;  4IRD A;  1CS4 A;  3GV8 B;  1HPZ B;  2ROG A;  4LMZ A;  4CYU B;  2R7R A;  3JXO A;  1REG X;  1WF0 A;  1XBW A;  2M2B A;  1B99 A;  3KLI B;  3M30 A;  2H5I B;  3G8S A;  2BE2 B;  3I0S B;  4CLW A;  2B4O A;  1K8A T;  4CH0 S;  4OZ2 A;  3O1L A;  4ZHR A;  5K8M A;  4GRS A;  4Y2M A;  2NLW A;  2OPQ A;  4OV1 A;  5RUB A;  4ZA1 A;  4DV4 F;  4C3K A;  3QO9 B;  3K8W A;  4W92 B;  3PIO Q;  1TL3 B;  3MGJ A;  4DR4 J;  1P1T A;  3G82 B;  4JI3 F;  2VBX A;  5E41 A;  1YIJ S;  1S1X A;  3EUN A;  1JJ4 A;  3OL6 A;  4DQQ A;  4FXW A;  2EFG A;  2RQK A;  1O8B A;  1R89 A;  2C1E B;  1RWW B;  1Q82 T;  1HI1 A;  3D5M A;  1PIE A;  3AXM A;  3VCD A;  1NJW A;  7FD1 A;  2N7C A;  5E3P A;  3T5J A;  3DRY A;  4M5D A;  4J9P A;  2V94 A;  2MHE A;  4DI6 A;  3NMA A;  3N4W A;  2K7K A;  2WSF C;  1N32 F;  4P75 A;  2JLG A;  5KT7 A;  2W7P A;  3AQP A;  2PFD A;  2VHG A;  4TKT A;  3OLA A;  1G4C A;  1M5P C;  1MW7 A;  2VH7 A;  1UWB B;  4JI0 F;  3MUV P;  3M9M B;  3MM8 B;  1REV B;  1MSW D;  4ED7 A;  1TUG B;  2MZJ A;  4JI4 J;  4YME A;  3H5Y A;  2E1P A;  5IT4 A;  4QZV B;  4OI6 A;  2RDJ A;  3LOU A;  1IKV A;  2RHQ B;  4K8R A;  3K5L A;  5E3A A;  5DDO C;  3K5N A;  1R6Y A;  2HQI A;  3R27 A;  3US5 A;  1UEK A;  1Q7Y T;  1TK0 A;  3PY8 A;  4YY3 F;  2YWH A;  2VIC A;  2HLU A;  1F5B A;  1QAX A;  3PFO A;  4B3R J;  1NK4 A;  4HHJ A;  2W25 A;  1M5K C;  3CJ4 A;  3MTJ A;  1KHV A;  3MEG B;  3MAA A;  2MJU A;  1NK9 A;  5F0W A;  4MTP A;  1WEX A;  5DS7 A;  2ILZ A;  1UL3 A;  3VGT A;  3MF5 A;  5B7W A;  4IG3 B;  4FVC A;  2A3J A;  4LQ3 A;  1QDU B;  3MCS A;  1NCL A;  1M5V C;  1RT3 A;  2E5L F;  5AT1 B;  5AE1 A;  4U95 A;  3BR8 A;  3D6H B;  3H2V E;  3HHK A;  2IAJ A;  2V2Q A;  3MPU B;  5HQL A;  1UVM A;  3HSD A;  4WIQ A;  2V63 A;  1QAY A;  3MMC B;  4IFY A;  1S72 S;  2G2Y A;  1N5V A;  2HND B;  2RS8 A;  4DV6 J;  2DHS A;  1J5E J;  2B56 A;  2GGP B;  2VG6 A;  4OJH A;  3MPY A;  3Q2S C;  4H54 A;  5ETT A;  3R97 A;  2MZS A;  4A8O A;  3GG1 A;  1DQA A;  3NRB A;  2EK1 A;  2OD6 A;  2RNE A;  1IM6 A;  1U7L A;  3M9N B;  2ADB A;  3DGP B;  3K5M A;  3ZTS A;  1J5O A;  4J9K A;  3FNN A;  4DV2 F;  2GVD B;  3CCL S;  2XY6 A;  3W3S A;  2QJ3 A;  2M7S A;  4MMO A;  4JV1 A;  2ZDP A;  3GON A;  2PEH A;  4K0K J;  5FDL A;  2OTL S;  3OV7 A;  2CZ4 A;  2KH9 A;  1TKZ A;  5KOX A;  3DHW C;  2I38 A;  2X1G A;  2HVI A;  2KRR A;  3AA8 A;  4K2X A;  2DR7 A;  1CJK A;  3F44 A;  4Y6I A;  4Y34 A;  1UFK A;  3DN9 A;  5FD1 A;  3IWN C;  4JOU A;  3BSA A;  4UOC A;  3BGO P;  3FRY A;  3NS6 A;  2L9W A;  4OYW A;  3OL8 A;  5KAK A;  3WZ0 A;  1I51 B;  4JYA J;  1T3N A;  3LP2 A;  1X4A A;  1RA7 A;  2QE5 A;  2AW0 A;  2H51 B;  5KFH A;  4A8S A;  2D3U A;  4P72 A;  1H3D A;  1NJX A;  1KS2 A;  3CC2 S;  1HBN A;  2YKO A;  1U02 A;  1VQN S;  3AT1 B;  3CUL A;  4B3M J;  3MHY A;  3MED B;  2J7K A;  3KLV A;  2LQB A;  2RAQ A;  2JZ5 A;  3R8Y A;  1HBM B;  3DRR A;  5LXY A;  4ID8 A;  4D3G A;  2QEX S;  1F1B B;  1JWW A;  1N5T A;  2WAQ D;  1HNV A;  2X51 A;  2UP1 A;  1NJI T;  2VV5 A;  3ELH A;  4RO0 A;  4I7F B;  2CWK A;  2AGQ A;  4OX9 F;  1OYD A;  5EX3 A;  2LA6 A;  5D0G A;  2L08 A;  5B08 A;  3OL9 A;  5LT5 A;  4MKV A;  4JI5 J;  3F73 A;  1X4H A;  1RTD B;  4OIX A;  4G3I A;  5DZ6 A;  1Q79 A;  1PYT A;  4OX7 A;  2AGO A;  4OYB A;  4I6W A;  1Q4R A;  2CYY A;  1FRJ A;  2C3U A;  2IFX A;  3I82 A;  3W5X A;  2PGC A;  1ZTT A;  4RW8 B;  1N6Q A;  4CLL A;  1H38 A;  3HD1 A;  1ZM9 A;  3MMA B;  3VF0 B;  1RAI B;  1RKJ A;  3N5F A;  1DJ0 A;  4F4Y A;  3N79 A;  1KBR A;  1SC3 B;  3NOC A;  1C1C A;  2APO A;  3FMB A;  1Q95 G;  3LGN A;  1AT1 B;  1FWL A;  2JJ4 D;  4YB5 A;  5H9F J;  3OL7 A;  3EGN A;  2AIR B;  2DNL A;  4M5M A;  2HS3 A;  3IAM 9;  3NY0 A;  3KLG A;  1WF2 A;  3W8G A;  1FXL A;  1VIX A;  1HIY A;  2DNQ A;  5KFX A;  1HWL A;  3OT9 A;  3SSR A;  3KYL A;  4CLZ A;  4ICL A;  5E33 A;  5IXU A;  5I42 A;  5HJY A;  2J9E A;  2J6S A;  3MOZ A;  3UO0 A;  4UUX A;  2PO4 A;  3BM7 A;  4IOA Q;  1WKL A;  5GAD I;  2MGZ B;  2YKN B;  1D1U A;  5EWE A;  3M32 A;  4XTT A;  4F2S A;  1HQE A;  4DR7 F;  3J80 Y;  2DGX A;  3LP0 A;  1WEL A;  2DNR A;  5GVQ A;  4DDF A;  2GC8 A;  2XI2 A;  2B51 A;  4DJB A;  2A6M A;  2MY7 A;  3RG6 A;  1T94 A;  4PQA A;  4OQJ A;  1BGX T;  3M8Z A;  4MYU A;  2ZBC A;  3GFZ A;  1DTQ B;  1B64 A;  4M95 A;  3FZ2 A;  2EVZ A;  4YDD B;  2GQ2 A;  3MAH A;  3M8P B;  5E3R A;  1FRH A;  4CNZ A;  4FYD A;  2YQ3 A;  4KQZ A;  1RT2 B;  3QGG A;  2BQR A;  1IKW B;  4Q2M A;  3MM5 B;  1YIT S;  2OO4 A;  1NKB A;  3R2D J;  2WCX A;  2KVQ E;  4LSL B;  4DN9 A;  2KFY A;  5HBM B;  3J81 U;  2GHV C;  3KJV A;  4NLS A;  1NPP A;  8AT1 B;  4TYA A;  1S9G A;  3NP5 A;  5KFB A;  3T1A A;  3EIC A;  2AEM A;  2B9E A;  5A6P A;  4B9T A;  2ZVS A;  4ES2 A;  1DRZ A;  2F63 A;  5J2P A;  2J6T A;  1WOP A;  1LW0 A;  2VBY A;  1IBL J;  4R5P B;  4F50 A;  4LJM A;  2GIR A;  2MTL A;  2RML A;  1UTA A;  4CO3 A;  1ZM4 A;  3N5B A;  4O23 A;  2NR0 A;  4FKY A;  4ZLJ A;  5C5J A;  3NNA A;  4DF8 A;  3TW0 A;  5DG8 A;  3QLH A;  1OQ3 A;  4NMX A;  3QZ8 A;  4ALZ A;  3OD2 A;  4N41 A;  3OW2 R;  5CYQ B;  1URR A;  1X4B A;  4ELT A;  4F4W A;  1RYS A;  3TI0 A;  3OLB A;  4KHM A;  2AZ1 A;  2HHX A;  2O01 C;  1EQ0 A;  1PC5 A;  2HHS A;  5DM6 Q;  3H42 A;  2GVZ B;  3A13 A;  4ZVF A;  2NQP A;  3G87 A;  1DUR A;  4ZVU B;  2BJ3 A;  4Y2K A;  2G0I A;  1JX4 A;  2HHP A;  3DLG B;  1TKX B;  1X7V A;  4A8Y A;  4W90 B;  2BRL A;  2AU0 A;  4KV8 B;  2HLT A;  3UCG A;  5HRO B;  2H65 B;  3OR1 A;  3JAM Y;  3Q23 A;  4Q2L A;  5A8W A;  4OHZ A;  2WVB A;  1HI0 P;  1X0P A;  3RTV A;  1WSR A;  3PDN A;  2HG4 A;  3F41 A;  4LFB J;  4URS A;  1NLK L;  3KFW X;  2HMI A;  1RQ0 A;  1T9W A;  4XK8 C;  1B0T A;  1XNQ J;  2HGN A;  2YNG B;  3D0I E;  2CQH A;  2DXF A;  1D0E A;  2B4P A;  4Y28 C;  4YR0 A;  2CG4 A;  4TYB A;  2DPJ A;  1H72 C;  4FKX A;  2QSW A;  3MR6 A;  3JQM A;  1RHM B;  3LF0 A;  3CJR A;  4LF7 J;  2EI5 A;  1HNX J;  4ANC A;  4DV1 J;  1R6V A;  4HH0 A;  4ZP6 A;  1VRQ C;  2KB2 A;  2NUH A;  3NCP A;  5F9N A;  4J91 A;  1N34 J;  2GML A;  2YPY A;  3MM9 A;  5EUH A;  3JSR A;  2KVI A;  3IGV A;  1GX5 A;  3G2X A;  4USH A;  2R8K A;  3UDL A;  4ZPV R;  5HL7 Q;  1RT7 B;  4RNN A;  3MD3 A;  4QPX A;  2W4P A;  2LEB A;  2HFU A;  3FEY B;  3J7Y U;  4DPX A;  2GO8 A;  1RAJ A;  5HAO A;  2CJY B;  3QIP A;  2E9Z A;  1NZA A;  2QLJ B;  1JLE B;  3VVT A;  1E6V B;  4F3M A;  4DN0 A;  2IDL A;  1YGY A;  5LSL A;  2OPP A;  4CDI A;  1RBA A;  2G1H A;  4C2M A;  1UW4 A;  4O0I A;  4IDK B;  2JL9 A;  3NL0 A;  5KG5 A;  3CCV S;  3JB9 k;  2HZV A;  1LWE B;  4HDH A;  3DOL B;  3KK2 B;  3OVS A;  4M63 A;  2ASL A;  2ZFH A;  4AXJ A;  2NXU A;  3ZZY A;  2VUG A;  1FF2 A;  1VC5 A;  5L1L A;  3JSM B;  4IRK A;  2YNF A;  1TUV A;  3LPY A;  2LQ5 A;  4J9Q A;  1KD1 T;  4CM2 A;  2ZC3 A;  4F3O A;  2Z2Z A;  4DR4 F;  3EDR B;  3DYA A;  4B3S J;  2YTC A;  4J9O A;  3W9H A;  3ZZT A;  1NEE A;  1HL6 A;  2IC3 A;  4Q8F A;  1KNZ A;  2LFV A;  3ZTR A;  5I4M A;  2D1C A;  3LP1 B;  1T7P A;  1T11 A;  4DSF A;  3OVB A;  1N0U A;  4KGX B;  4OYX A;  1CQN A;  1MMD A;  4F0K A;  5DQH A;  3QWP A;  4G65 A;  4NCA A;  3V2U C;  1R8P A;  5L8R C;  5DGB A;  1HHT P;  3FMW A;  2QFI A;  3J81 Y;  2KXF A;  4R0E A;  4NLU A;  4X64 J;  2JHE A;  4JI4 F;  3Q22 A;  1OMS A;  2XBP A;  3DRP A;  4WPA A;  2BE9 B;  2FLL A;  4F4X A;  3CCQ S;  2Q79 A;  3R5C A;  4PAB A;  2V6A A;  3C8Y A;  5BYS A;  3M8S A;  4JI8 J;  3D2W A;  2DKO B;  3UN3 A;  1U2F A;  4OJG A;  1ZA1 B;  3KK1 B;  1HR0 J;  5ETO A;  1N5Y A;  3TOQ A;  4EFA C;  2BKP A;  3UN5 A;  3KUE A;  5D77 A;  2IMO A;  5D0H A;  1NPR A;  2JLE A;  1Y11 A;  1TV6 B;  2V69 A;  1HLW A;  4RW9 A;  2H54 B;  2J0Q D;  5KFY A;  3C6T B;  1RDR A;  2KT5 A;  4B3R F;  2DBB A;  4ZJQ A;  1S6O A;  1QE1 B;  4K4X A;  4URQ U;  5L9N A;  1T05 B;  2F4F A;  1UA1 A;  3DOK B;  3PJW A;  2B4V A;  1YRX A;  3ZZO A;  4DHV A;  2A1B A;  2C3M A;  4ILL A;  3UVJ B;  2RE1 A;  2DVI A;  1Q8K A;  3P49 B;  3EZ5 A;  5IT0 A;  2RH3 A;  2N3O A;  4RNM A;  4UST A;  2DEJ A;  2VQF J;  2IMW P;  4CIO A;  2KJV A;  3OTC A;  4Q45 A;  2B43 A;  3ITH B;  4OLO A;  4TLQ A;  4LFC J;  1PG5 B;  3PR4 A;  2HHT A;  1L3S A;  3MEC A;  2I1R A;  5DO2 A;  3HSJ A;  2V5H G;  2X1A A;  1D9A A;  2I0X A;  1UEU A;  1KDN A;  4P7V A;  2VAS A;  3QSY B;  5A8R A;  4DV6 F;  2PII A;  1RHU B;  1J5E F;  1FFG B;  3L9Z A;  2C28 A;  2HIY A;  3OR2 A;  5E3C A;  5B0F A;  3B6B A;  3BPD A;  3ENQ A;  3BGR B;  1HNI A;  4FS1 A;  4ZVQ B;  2BBE A;  4QWD A;  1RXO B;  5LSR A;  1JJH A;  3NAH A;  3FCV A;  1NK8 A;  4K0K F;  1R8H A;  5ETR A;  1SB6 A;  3GE9 A;  2B5J A;  3CDW A;  3IR7 B;  3T6J A;  4I6Y A;  1FNO A;  1KVK A;  1U45 A;  3CCM S;  1U1K A;  3C6U B;  3SBM A;  3FEX B;  2Z56 B;  4QU7 A;  1Q8I A;  3QQC D;  2E1M C;  3RB3 A;  1VK8 A;  2Y0B B;  4C4W A;  3MM7 B;  2ZBI A;  2DRB A;  3C15 B;  4JYA F;  4IYQ A;  3EWG A;  4ED4 A;  4RU9 A;  1SJ1 A;  4RWW A;  2JSX A;  1NHK L;  1FKP B;  3DMJ B;  1P1L A;  3AH6 A;  4WP3 A;  2AF6 A;  3QRR A;  1UZD A;  1GH8 A;  4RBV A;  3CJQ A;  1GX6 A;  2Z8Q A;  3V81 A;  1NKE A;  2NXC A;  1KR4 A;  4CT9 A;  1YWX A;  4B3M F;  2ZH4 A;  3KJN B;  3C3L A;  3K5P A;  3EE3 A;  1VBY A;  4U96 A;  5LM7 E;  1S1U B;  2ZEJ A;  1WTF A;  3A3N B;  1MRO A;  3GTY X;  3AJD A;  3H5U A;  3T5L A;  5G0R A;  1EAY C;  4C8Y A;  1EHW A;  4A8K A;  2E7X A;  2LQJ A;  3BKU A;  5ITH A;  2BR0 A;  3Q8S B;  2QV6 A;  1QAJ A;  2UUC J;  2J6U A;  3CVK A;  1YVF A;  2V9W A;  3TUZ C;  1S1W B;  2VG7 B;  2G4B A;  3R1L A;  3RAQ A;  3CED A;  1RT5 A;  4LRB A;  5KG1 A;  1R0A A;  2KT2 A;  3CJK A;  3FBC A;  1RWO B;  5K5M A;  1K1S A;  4JI5 F;  3OUY B;  1WHV A;  4KYZ A;  3QSI A;  2BKO A;  2QLX A;  2KFN A;  4OX6 A;  3HP6 A;  2KYZ A;  4DL5 A;  4GO7 X;  2MKK A;  2W9C A;  1VBK A;  2DNO A;  3TQE A;  3BBB A;  4DG1 B;  3MMB B;  1GK8 A;  3PR5 B;  3S1T A;  1U1P A;  3FBF A;  4NRU A;  1ROF A;  2V9K A;  3D9B A;  3ZZZ A;  1RT6 A;  2D69 A;  2KI2 A;  1SV5 B;  5KFI A;  2O1P A;  5DLG A;  3M30 B;  4O3O A;  1F9H A;  2EBG A;  3M6U A;  2HW3 A;  3MEE A;  2MEW A;  4X4V A;  4P71 A;  4I56 A;  2A0F B;  4MK9 A;  2V8H A;  1LFW A;  2DHA A;  2OPQ B;  2QT7 A;  4MKY A;  4RX6 A;  2K1R A;  1PYO B;  5J2N B;  1RGV A;  2NYI A;  3SCI E;  4J9S A;  4ILR A;  2HNZ A;  3W8P A;  4WE1 A;  1FNM A;  3M8R A;  3TO8 A;  1S1X B;  1FXR A;  3H20 A;  1SIZ A;  1KVJ A;  1WHY A;  1R27 B;  1TL5 A;  3HFV A;  3BB5 A;  4KTQ A;  4PWW A;  1ZH5 A;  3SXL A;  4DLE A;  1R8A A;  4RNO A;  3W66 A;  1VJW A;  1NK0 A;  4ZCM A;  1EAR A;  1K44 A;  1MU2 A;  2K3I A;  3PW0 A;  1MN9 A;  4RW6 A;  3Q83 A;  4LRC A;  1I5O B;  2GIF A;  2MZ1 A;  3R9L A;  1GTE A;  3I87 A;  4LR7 A;  5EWF A;  4J90 A;  5HQ8 A;  2HK3 A;  2NS1 B;  1YJW S;  2GFF A;  5F0U A;  1T95 A;  3B78 A;  4DCP B;  1UJ6 A;  4J9R A;  1WTB A;  4O0N A;  2IDE A;  4V19 J;  4NCG A;  3PYF A;  1S77 D;  5D78 A;  2NXN A;  4Q0B B;  4U7U K;  5KFE A;  5D8H B;  2FHO B;  2PSZ A;  3CCZ A;  1RWM B;  1IKV B;  2B8Q A;  1IR2 A;  1VHF A;  3UD5 A;  2UXC J;  1RKI A;  3R1H A;  1Z2L A;  1VK3 A;  3W9I A;  2UV8 G;  4WU3 A;  3TA1 A;  4OZN A;  4KC5 A;  1AFI A;  4NEY A;  3GCW P;  5LJ5 Y;  1EET B;  1NDP A;  3KG1 A;  3HZG A;  2NXE A;  4OI4 A;  4NLT A;  3BSC A;  1RT4 A;  1HI8 A;  4H4M A;  4U7U D;  4EK2 A;  3M2V A;  4PG6 A;  5KFV A;  3A8K A;  2VG5 A;  5CQG A;  4HI1 A;  2CQ2 A;  3MAA B;  4WFX A;  5A2Q Y;  3AD8 C;  3ONQ A;  4BLG A;  2BJ9 A;  3E8O A;  1VLO A;  4ZPB A;  3IAS 9;  1J27 A;  4X2B A;  1XN9 A;  2LA4 A;  1H74 A;  2AEF A;  2W2Q P;  2BM0 A;  2VA2 A;  4LF8 J;  3TZY A;  1RT3 B;  4F0M A;  4ZN1 A;  2Z0G A;  2LYV A;  2IAJ B;  3PEJ A;  3CPW R;  2JEG A;  3VGS A;  2XWX A;  4FYY B;  4C11 A;  2Y9H A;  1WKK A;  2OFH X;  1PKU A;  1YJT A;  2YH0 A;  2W9B B;  4G1P A;  2RD5 C;  5J2Q B;  4IFY B;  5EDW A;  3O6Q A;  1VJQ A;  2V2K A;  3VR1 A;  3QPI A;  4C48 A;  3ADA C;  1FE4 A;  2BA9 A;  4CLS A;  3ISZ A;  2ZJR Q;  4WII A;  1WD6 A;  3CDB A;  3Q8R B;  1QY7 A;  1U2C A;  3TVZ A;  4FNI A;  2PMZ D;  3T9Z A;  1J5O B;  3IFE A;  1QVF R;  2Q3P A;  3SI8 A;  2H1Y A;  4WF9 Q;  5J1E A;  2P9G A;  2IIH A;  2XYG B;  3RZA A;  4LFB F;  1HD1 A;  2MXY A;  2HHH J;  3LGH A;  1TKZ B;  3C2P A;  1XNQ F;  1O51 A;  3L4B C;  1G1X A;  2KU7 A;  4HLB A;  5I3P A;  2DR5 A;  3V6D A;  1W2I A;  1PBA A;  1CJK B;  1SUQ A;  3ZNJ 1;  4UW2 A;  4NRT A;  3FSX A;  4QBU A;  2CJA A;  4AYB D;  1P27 B;  4TU7 A;  4QW8 A;  4LF7 F;  1HNX F;  3LUY A;  4TY9 A;  4DV1 F;  3CJT A;  2AYB A;  5AXN A;  1RTI A;  2J7U A;  2CQC A;  3TUP A;  3JSB A;  4PXB A;  5A8K A;  2LDI A;  4LRF A;  3MR5 A;  1N34 F;  2EEY A;  5GAE U;  2VF3 A;  2V67 A;  1HWI A;  1HBN B;  1RT1 B;  5DDR C;  2MQL A;  1LXN A;  2HBQ B;  2OLW A;  5CCL A;  3ZTO A;  3DHX A;  2DH7 A;  2DXE A;  2MKH A;  3DRR B;  5K8N A;  5CCM A;  2LU2 A;  5J2M A;  5DQG A;  2CQ0 A;  3MR3 A;  4X4O A;  2UUA J;  2DO0 A;  2IM3 A;  3FFI A;  1YBA A;  2H3E B;  1HNV B;  1RLD A;  4IG0 B;  2XNR A;  4BDP A;  4WBF A;  2DIU A;  2GS8 A;  2HS0 A;  4Z37 A;  1KC8 T;  2CPH A;  3TEH B;  3KLH A;  4P2S A;  2EPI A;  1NJZ A;  2HBR B;  4OL8 A;  2FZK B;  3I9Z A;  1TL7 B;  4IH7 A;  5AXM A;  1NND A;  3D6M B;  4DUZ J;  3TUJ C;  3A12 A;  2ZHO A;  2EG2 A;  3K5O A;  4DL0 C;  2ZWP A;  2E44 A;  4B3S F;  2QO3 A;  4OX8 A;  4ECR A;  1RB0 A;  4X4N A;  1TKT A;  1T9T A;  5LJ3 Y;  3CW2 C;  3G96 A;  1N0V C;  1JLF A;  1VRU B;  4M5N A;  1ZTW A;  2XWY A;  2MZR A;  1W26 A;  5HVG A;  4TN2 A;  3VTI A;  1C1C B;  1MML A;  5HMX A;  1SQF A;  3U1M A;  3SYZ A;  2F4V F;  1AW0 A;  5H9E K;  1LQ9 A;  3UCU P;  3ZNU A;  4I0W A;  3PCO B;  4GVL A;  3TWZ A;  3GII A;  2EFN A;  2W4D A;  2EKY A;  3CME S;  1TL1 B;  1U6F A;  3CSK A;  5KG2 A;  1QTN B;  2DGS A;  3KLG B;  1R8C A;  3M9O B;  3BO4 A;  2CQI A;  2EW9 A;  2RF2 A;  2RKI A;  3I96 A;  1QAI A;  1U0H A;  4X64 F;  4PQU A;  3HVR A;  3I5B A;  1JKH A;  5U47 A;  1S57 A;  5I42 B;  2OTJ S;  1TAQ A;  5HJX A;  4USJ C;  4JI8 F;  2UV8 A;  2BYC A;  2ZH3 A;  2G2Z A;  2HAF A;  4JI1 J;  1S4E A;  2E7W A;  2PI5 A;  4WP8 A;  4XPC A;  4Y2I A;  1HR0 F;  4DPT A;  3EXY A;  2IJN A;  2ZOM A;  3AOB A;  1E6Y B;  2XI3 A;  4WFB Q;  1RWU A;  2JFK A;  1HQU A;  2AHO B;  2FD2 A;  3GJQ B;  1VQM S;  1CC7 A;  1YLX A;  4FPR A;  1CBK A;  2QG9 B;  4WFA Q;  2XMV A;  3E01 B;  4Q44 A;  2UU9 J;  2M3D A;  4OHV A;  3FJ2 A;  4X4S A;  1X0F A;  2K2P A;  3OTD A;  2L48 A;  3ENA A;  2BDP A;  4WZM A;  3DU5 A;  2KFZ A;  4GVB A;  4RW7 A;  2XNQ A;  4KBI A;  3VAK A;  4KO0 B;  2NSC A;  3U1L A;  3VVU A;  3W5Y A;  2MKJ A;  3C16 A;  2E1C A;  3NBP A;  3GIM A;  2J8S A;  4J9V A;  3BGU A;  3H2U B;  4IFV A;  2VQF F;  3OFG A;  3W2V B;  1S0O A;  4BBY A;  2DCL A;  2ZH1 A;  2ZOF A;  4XAK A;  5F8I A;  1Y0H A;  4LFC F;  3OFE A;  3G6Y A;  5DDQ C;  2CIM A;  3HJF A;  1C1B A;  1S9E A;  2QL7 B;  3TAN A;  4KGZ B;  1JK9 B;  1S9G B;  2ZNY A;  4WYL A;  2CQP A;  2MSS A;  4KFB A;  2CUY A;  2OKQ A;  2OH2 A;  2EC0 A;  2C2O B;  4YFU A;  1V3S A;  4XO0 A;  4U67 Q;  4TU8 A;  3WBZ A;  2R2T A;  5J2P B;  1RCX B;  3RRG A;  3W2W A;  3BH6 B;  3R7B B;  3AOA A;  1WOR A;  5D4P A;  1A0O B;  4HVZ A;  4A4J A;  2BRK A;  3T1H J;  5C25 A;  2UUT A;  2FJD B;  3X3U A;  2W2O P;  4QR0 A;  2R8G A;  3VGV A;  4ETX A;  4LF2 A;  4C98 A;  3QLH B;  4BWJ A;  3G4S S;  2IYG A;  1F5A A;  2ZH5 A;  2YNI B;  1VS3 A;  1IR0 A;  1NDK A;  2GJI A;  4AL7 A;  1Y9O A;  3HHL B;  2FHJ D;  2KHD A;  4YHH J;  2V8G A;  3KK3 B;  1M90 T;  3VZH A;  2HAI A;  3DDK A;  1RLC L;  3P5T L;  3G9C A;  5K9F A;  3F56 A;  3AB4 B;  1RAA B;  2CPJ A;  1BLU A;  2QL9 B;  3FQK A;  2CNL B;  4W98 A;  2H5E A;  2XGP A;  4G1Q B;  1NKC A;  1HW8 A;  5JJB A;  2CQB A;  3EM1 A;  1FD8 A;  1DLO A;  2PMH A;  3N9U C;  3UCZ P;  4KH0 B;  5A8W B;  3LH2 S;  3WHI A;  2XSJ A;  3T19 A;  3GIL A;  4BCA A;  3CO0 P;  3MFI A;  2HQC A;  3GU0 A;  2W7O A;  4HL9 A;  2MQM A;  2OEM A;  1UVJ A;  3W65 A;  3TRG A;  2IRU A;  1CVJ A;  1VQ5 S;  1J2V A;  4EGL A;  1Z1Z A;  5I3Q A;  4ZN3 A;  2VBW A;  4KH1 B;  2C22 A;  2FLN A;  2B9Y A;  2XS5 A;  1VQO S;  1IKY A;  1AZS A;  2C2N A;  4DSJ A;  4RUC A;  2UUC F;  1UJ5 A;  3TAR A;  1RTJ A;  2X1F A;  2AGP A;  4F26 A;  1X4G A;  2R7V A;  5CYM A;  1IM4 A;  1BQM A;  3LAL A;  2RHS B;  2O5D A;  1WHX A;  3VWS A;  3FCH A;  1F2H A;  3IM8 A;  2C2K B;  2LMI A;  1X4C A;  3CIM A;  2CA9 A;  2DT9 A;  2CQ1 A;  1M1H A;  3HFK A;  4GKK J;  4IOB A;  2DH9 A;  4Q8E A;  3S8S A;  2FIU A;  1M5S A;  4KGV B;  4CP5 A;  4M5H A;  2ACY A;  2JEF A;  5D0E A;  2EWH A;  1U8W A;  3V4M A;  1S12 A;  4C8K A;  3VAL A;  4C0H A;  2HIQ A;  1KQG B;  3QIP B;  5K14 B;  3H4B A;  2FGO A;  3PZP A;  3CIZ A;  3CDA A;  2ZOG A;  3PJX A;  1JLB A;  3HHL C;  4KT0 C;  2VOD A;  4K4Y A;  3T1Y J;  2ZNZ A;  1N56 A;  1HMV B;  2ASD A;  2JOQ A;  2OPP B;  3QWU A;  3PRB A;  1JB0 C;  4LBH A;  1L5U A;  3LAM A;  4DU7 A;  4YUD A;  4J9M A;  2MQP A;  4RNF A;  5IC6 B;  2KZZ A;  4UUW A;  3OXL A;  3QRP A;  2FY8 A;  1S59 A;  4K4S A;  1GXU A;  2FJE B;  2RIL A;  1A7G E;  1U1R A;  1SJR A;  3G86 A;  3G71 S;  3D6F B;  2RUS A;  2OUG A;  1XJW B;  2ZM6 J;  4ED3 A;  2Z30 B;  2DNM A;  2HHV A;  1EX8 A;  3EX7 B;  2W24 A;  3R6L B;  1GMU A;  4CLU A;  3CJ3 A;  4RNH A;  3DM2 B;  2DIV A;  3ENV A;  3ZFV A;  3DYA B;  2C2M B;  4U6P A;  2FB0 A;  4QWE A;  4OZ5 A;  5BJR A;  2IC3 B;  5ETK A;  1DQ9 A;  3ZTQ A;  1XIQ A;  1HWU A;  1PAE X;  2BAB A;  3G6E S;  4F02 A;  3BO3 A;  5GAG U;  1JLQ A;  4X4Q A;  1HPZ A;  3TJA A;  2FJB B;  4CYU A;  4Z7C A;  2CJX B;  5KT5 A;  2RRN A;  2NZC A;  3HKZ D;  4EU0 A;  3UFC X;  5KFU A;  2BE2 A;  1X31 C;  4ANE A;  3S7R A;  1A9N B;  1U6B A;  3GJS B;  3PRV A;  3B4M A;  2KYX A;  4R25 A;  3ET6 B;  4BHQ A;  3N6L A;  1KVI A;  3HMJ G;  2YBV A;  3SQG A;  2IVM A;  5DLF A;  3TJ8 A;  5ETQ A;  2W4C A;  1TL3 A;  3G82 A;  3GWC A;  1U0S A;  4C8Z A;  2UXC F;  5LOQ A;  1VYA A;  4H4K C;  4ID5 A;  3KHH A;  2Z2Y B;  1JJC B;  4RW4 A;  1RUS A;  1JNZ B;  1N5Y B;  1Q5V A;  4ELU A;  3PW2 A;  3GG0 A;  3PYD A;  4OZJ A;  2IRY A;  4PWD B;  3KWM A;  5IFM A;  2CPE A;  4USK A;  2KJW A;  4RW9 B;  3ILL A;  9ATC B;  4PXD A;  2WBM A;  2CQG A;  5KFL A;  1VQK S;  3THP A;  4E2F B;  2XLK A;  2DIT A;  4ZIW A;  4QQB A;  2JH3 A;  2PT0 A;  4IQM A;  2C42 A;  2ZBR A;  3GLJ A;  2WRM A;  1UWB A;  3H25 A;  2V8V A;  3D54 A;  1REV A;  2WB4 A;  3UI3 A;  2AYG A;  3JTP A;  3KTQ A;  5EHH A;  4QIV A;  2XO7 A;  4LF8 F;  4DV5 J;  1RZM A;  1XMO J;  4OYA A;  3DLB A;  5CXT A;  1HFE L;  1U25 A;  3IBF B;  4WU2 A;  1KN6 A;  4OZL A;  3CD7 A;  2ASJ A;  1FK9 B;  1VQ7 S;  3RJM B;  3OTO J;  2E1A A;  4I68 A;  4C8M A;  4M5L A;  4RUB A;  3ILJ A;  5A8R B;  2OJ3 A;  2B3T B;  1YHQ S;  4IKA A;  2KM8 B;  5HMW A;  2XLJ A;  1KRP A;  1LW2 A;  4PWU A;  4NLX A;  1HNI B;  2YX7 A;  3MEG A;  2R8J A;  3SZ2 A;  4LR8 A;  4QWC A;  2NZ4 A;  3L7O A;  3DKD A;  3GSI A;  2BJ1 A;  2UUB J;  2L41 A;  1YK9 A;  3J7A N;  2H48 B;  3GFH A;  4MAK A;  3EGV A;  5EX0 A;  2HHH F;  4OHW A;  2O67 A;  4ZCI A;  1X5P A;  3Q8V A;  2VFV A;  3I32 A;  2DNG A;  2MZQ A;  2W7A A;  4WFN Q;  3VQS A;  3NWG A;  3RBD A;  4IOC Q;  1RAD B;  3MMC A;  4USM A;  1F60 B;  3TA2 A;  1NBE B;  2HND A;  2V34 A;  1D9D A;  1F3F A;  1NZ8 A;  1N5S A;  2B8P A;  4QCL A;  1EP4 B;  4DR2 J;  3SQO P;  2WW8 A;  2YWW A;  1VGY A;  3GFY A;  3ETM A;  3PM9 A;  4P9S A;  2UXD F;  1C0U B;  1IWG A;  1YQH A;  4JUZ A;  4NXN J;  4K4W A;  2GVD A;  5DG7 A;  4OHY A;  2BJD A;  3EPG A;  4B3T F;  1H73 A;  3GIK A;  3RYL A;  2QL5 B;  5T41 A;  1SH3 A;  2QMW A;  5B0G A;  2IHR 1;  1CLF A;  2KDO A;  1WEZ A;  4NYO A;  3GB0 A;  2UUA F;  3DLE A;  1HBU A;  5G0R B;  2YKP A;  1R31 A;  1VFJ A;  1OYE A;  3KDO A;  3UDC A;  4DV0 J;  2YWG A;  2LU1 A;  2ROP A;  3EDQ B;  5DM7 Q;  2QLB B;  3M8Q A;  2XS2 A;  3PFE A;  2KN4 A;  5A0Y A;  4DL6 A;  4LBP A;  4WFY A;  2RQM A;  4N5S A;  3NEK A;  4WTY A;  1U24 A;  2KM8 C;  4ZVE A;  2XZD B;  4NAS A;  4KR0 B;  3CJK B;  5M2U A;  1ITP A;  3IRX B;  1RTH A;  4DUZ F;  2HBZ B;  4O4G A;  3CMA S;  1K47 A;  2CPX A;  1U8S A;  1N33 J;  3M2R A;  1S76 D;  4L3K A;  1YSJ A;  2XY5 A;  3MED A;  1FT8 A;  3UW1 A;  3P8B B;  1FX4 A;  4C97 A;  4JI2 J;  2BAN A;  5F8G A;  3RAX A;  2W9C B;  2GO9 A;  2M4M A;  1RJJ A;  2CZ9 A;  3ILO A;  4DF4 A;  3IXQ A;  5B0E A;  5F3T A;  2RSQ A;  1XQI A;  1L3V A;  1XTZ A;  4UQT A;  2EG1 A;  4B9S A;  2N7Y A;  2KO1 A;  2AKW B;  1SH0 A;  3C19 A;  2XEX A;  4I7F A;  4OV6 A;  2XZT B;  2UZA A;  1KON A;  1RT6 B;  3M1V B;  4RBU A;  3D67 A;  2RQ4 A;  1OSC A;  1PJ6 A;  4WJB A;  4FZV A;  3EYZ A;  3W63 A;  3MEE B;  1VIS A;  4WXO A;  1S6P B;  3OFF A;  4RWX A;  1KTQ A;  3TZW A;  5F8N A;  1IQZ A;  1RTD A;  3V5R A;  5GAE I;  2ABY A;  3BDE A;  3CO9 A;  5SUH A;  1FKO A;  4BC7 A;  2HNZ B;  3KLE A;  2HWT A;  2QA1 A;  4FF2 A;  6AT1 B;  1RE1 B;  4C0O C;  4JI1 F;  2HQG A;  1R0B G;  1VQ9 S;  1UVL A;  3M4X A;  3UDE A;  2UVR A;  3NWR A;  3V6H A;  3MDF A;  5CAB A;  2R7S A;  7AT1 B;  3B4D A;  1OPI A;  5EWG A;  1FHT A;  1UMJ A;  4CLF A;  8ATC B;  4GC6 A;  3I5C A;  2UU9 F;  1RIS A;  1MU2 B;  1V3R A;  3HUL A;  2CQD A;  1HHQ A;  3RRK A;  4RW6 B;  4DU8 A;  4H4O B;  1VQP S;  2QZ8 A;  3CMQ A;  2F8E X;  5M2R A;  1WOO A;  3AA9 A;  3BBC A;  1KQS R;  2F9J A;  2CQ3 A;  4PG7 A;  1CUL A;  4DEZ A;  1FA0 A;  2UUW A;  3FVY A;  2HQF A;  2VJU A;  3A8J A;  4NCG B;  3RW6 A;  2ATL A;  1D3W A;  1F3V A;  1O6X A;  5HO4 A;  4DX8 H;  4MYT A;  3H8Y A;  2K06 A;  5BXI A;  1ZZN A;  4WK3 A;  2BV3 A;  2FLO A;  2YKN A;  2W2M P;  3QAE A;  3PTW A;  4CLT A;  2E66 A;  2I6W A;  1LOU A;  1KHW A;  4WKY A;  2ZH9 A;  3P3D A;  4J9N A;  2E5G A;  4QIW D;  2AP6 A;  4ECX A;  2ADC A;  1RT4 B;  1KQK A;  4YR2 A;  5JVG Q;  3CTR A;  3T1H F;  1DTQ A;  1WG5 A;  2VFU A;  4ER8 A;  4TY8 A;  1N36 F;  1ZAX A;  1FCA A;  1FEE A;  2ZE2 B;  1U1O A;  2IA6 A;  2KT3 A;  4V19 X;  3DI6 A;  3HSG A;  5IWA J;  3K17 A;  1RT2 A;  3J7A 1;  3O5T B;  1KFD A;  1Y7P A;  3GV5 B;  1RWV B;  2YKM B;  3HFZ B;  3EPI A;  4LVO P;  4YHH F;  5KFW A;  4NCB A;  2R7Q A;  4HTJ A;  2JNJ A;  4NE9 C;  3H5S A;  3TAM B;  1OY9 A;  4C11 B;  4RL1 A;  2YX1 A;  1IBK J;  1YJ7 A;  2W01 A;  4ELV A;  2YWF A;  4L74 A;  1S48 A;  5T7L B;  4OFZ A;  4C9D A;  3N0V A;  1KEK A;  2XMU A;  3TAP A;  5HAT A;  1BC6 A;  3K2Y A;  2D9O A;  3D28 A;  7FDR A;  3MM6 A;  5FII A;  1G7C B;  4NA3 A;  5J1E B;  3QT5 A;  3FBE A;  4ZVS B;  2CJB A;  3MR7 A;  4ERD A;  3T5H A;  3QT7 A;  2F8M A;  4KKO A;  2JC0 A;  5CYQ A;  4ZLN A;  3IRW P;  4K4V A;  3CCU S;  4ZPD A;  3NNC A;  5CD4 H;  3AXK A;  3I4H X;  1JXE A;  2GVZ A;  2K3K A;  3HF5 A;  2HHW A;  4QIG A;  1SUQ B;  3GR0 A;  4USV A;  4QU6 A;  5HLF B;  5GMK a;  2RB7 A;  1OY6 A;  3MCM A;  5D0R A;  4ECU A;  3RB4 A;  1SXL A;  4B02 A;  4KPC A;  4KV8 A;  1FRI A;  2OAU A;  2CPD A;  3MFH A;  1RTI B;  4J9U E;  3SV3 A;  2AYE A;  4CCH A;  4B9V A;  3NNH A;  2V8D A;  3CCJ S;  4GKK F;  2FPH X;  1XER A;  2L9D A;  1IUJ A;  4TLR A;  3X1L B;  2HHQ A;  3JSY A;  2I5J A;  1VBZ A;  2VC0 A;  4QWB A;  4CWB A;  4L6V 3;  4DPU A;  5ETN A;  3JYT A;  3KOA A;  2VDI A;  4ZIT A;  4OJ3 A;  1TFW A;  4R0J A;  3KXD A;  5B0A A;  3OSP A;  2EKN A;  2OD4 A;  4NLW A;  2GMJ A;  3HDS A;  2QTW A;  3AOC A;  1LK5 A;  5J2M B;  3T1Y F;  1LXJ A;  2ILY A;  3NCQ A;  2OMO A;  2VQE F;  2P9E A;  4ATN A;  3FFI B;  3EJM A;  1H2U X;  3HO1 A;  4D3H A;  3D1Q A;  4F4A A;  2B6A A;  3IGN A;  3UD3 P;  3HSZ A;  2OEK A;  1TUW A;  3AQO A;  4DR5 J;  1U2R A;  3OQ2 A;  4B9L A;  1H0H B;  3MUR P;  1S4F A;  3I5A A;  4CH7 A;  2YNH A;  1B70 B;  5CZX A;  2ZM6 F;  1S1V B;  1IN0 A;  1GFW B;  2BOP A;  2B7B B;  3MPV A;  4CNY A;  1T03 B;  3V6J A;  4A8X A;  5KFM A;  3CXC R;  2JC1 A;  4FXD A;  4JI6 J;  1ELO A;  3D68 A;  4N56 A;  2BW7 A;  5GAD U;  1A6L A;  1SC1 B;  3H5X A;  2DHG A;  5KT6 A;  3ZZ0 A;  2BOA A;  3QID A;  3M2U A;  1RK8 A;  1E6V A;  2VU5 A;  1FXD A;  4DCJ B;  5FJ4 A;  1JLF B;  1WI8 A;  3BQ1 A;  2W9A A;  4LF5 J;  3Q89 A;  1WKJ A;  4FNH A;  4NLG A;  3BN7 A;  4NLP A;  4IDK A;  4PYA A;  2OP5 A;  3P4U B;  1LWE A;  3KK2 A;  5DRK A;  5LL6 d;  4ZVG A;  2EFQ A;  3HI9 A;  3FQL A;  2XC9 A;  2OSR A;  4X4T A;  2WHO A;  1U0H B;  1W7W A;  4PQU B;  2AJ0 A;  3D6T B;  2VZ9 A;  3SCK E;  4M5J A;  3H0P A;  3JTN A;  4ZK7 M;  1CSJ A;  4CQ1 A;  3IWL A;  3MR2 A;  3D4J A;  3BO2 A;  2LXF A;  1H2T Z;  3M8W A;  3F0N A;  5KFF A;  3U27 A;  2HRU A;  1D8Z A;  4DR6 J;  3BS9 A;  3K57 A;  2VOP A;  4P2X A;  3RUB L;  2B0G A;  2LXU A;  1SPB P;  5JUM A;  2DPI A;  4GVB B;  4RW7 B;  1K9M T;  3LAK A;  2FGC A;  2VON A;  1V9O A;  4W4M A;  4O3R A;  3C16 B;  3NBP B;  1JJ2 R;  2VA3 A;  3EGW B;  4DV5 F;  3KUH A;  3Q0A A;  2PEB A;  2CQ4 A;  2COL A;  3M8Y A;  2K8G A;  1C2P A;  1XMO F;  4ZVO B;  4DR1 J;  1YRU A;  3OBI A;  3FCW A;  4OI2 A;  4DUT A;  3TVK A;  4CI0 B;  5HP1 B;  3FZB A;  3KK1 A;  4UF4 A;  3IA0 A;  3OTO F;  2JVR A;  2MKC A;  1WC6 A;  2MJN A;  1XR5 A;  4KFB B;  1RSC A;  5AE2 A;  4BS2 A;  4UOH A;  4PG8 A;  3DLK B;  3PNI A;  3BYP A;  2IRX A;  2V8P A;  5L1K A;  1UVI A;  2UXB J;  2VL1 A;  3J7Z T;  1GTH A;  4ZVT B;  1QTM A;  4JP8 A;  5FLX U;  3ILI A;  5IV4 A;  1AUS L;  5IZH A;  2UUB F;  2HS4 A;  3ICL A;  1DHM A;  4QR2 A;  4TXS A;  4O3S A;  3RU0 A;  4DMZ A;  5F8L A;  3IS9 B;  1F6T A;  4O44 A;  2JLF A;  5IC4 B;  3PO5 A;  1SC4 B;  3HHE A;  5C24 A;  1U09 A;  1S0N A;  4HAC B;  4YQW A;  4UT4 A;  1S1T A;  2WVD A;  3LTO A;  4WYW A;  3PRD A;  1UVN A;  3QJJ A;  2FVP A;  1YBU A;  5KT4 A;  2N4D A;  2CKW A;  4MFB B;  2AJQ A;  2HGL A;  4DR2 F;  5KFO A;  3CC7 S;  2UVW A;  3VAJ A;  1DLO B;  5K8P A;  2VPY B;  2KXN B;  1IKX A;  2PD1 A;  3IR5 B;  4K50 A;  4NXN F;  3NMR A;  5G4D A;  1RAE B;  4DX5 A;  2XSJ B;  1JLG B;  3TX0 A;  4DPW A;  4ZMM A;  1PC4 A;  2HWI A;  1TQL A;  2CPZ A;  1FDA A;  4B3O A;  3B8H A;  1N5Q A;  4NLQ A;  3H90 A;  4JV5 J;  2DNY A;  1NO8 A;  1TK8 A;  2XMK A;  3SFU A;  4DV0 F;  1SL0 A;  3FEZ A;  3IN5 A;  1IKY B;  1UP1 A;  1X4D A;  2XG8 A;  3C15 A;  1V5I B;  3S01 A;  3DDI A;  4AL6 A;  4AUK A;  2MKI A;  3BSO A;  4CTA B;  2G2O A;  1S6Q B;  2WSC C;  1FKP A;  5L39 A;  1BQM B;  1GEH A;  4EBD A;  2VFR A;  3DMJ A;  3MD1 A;  2JDJ A;  2NPF A;  4EI2 A;  2VD3 A;  4F2R A;  4YB1 P;  2XGQ A;  4G6V B;  4NLV A;  3I4P A;  1N33 F;  3IG1 B;  4CZC A;  1DTT A;  3G8T A;  3KMQ A;  2JX2 A;  5DQI A;  1B0V A;  3DRS A;  4JI2 F;  5E7O B;  4NI2 B;  5L1I A;  1JLC B;  1H98 A;  4C3L A;  2AJF E;  3BKT A;  3IMQ J;  1IJE B;  1VQ8 S;  2G9O A;  1LV5 A;  1JLB B;  4YN3 B;  1NJY A;  2QLF B;  4RBT A;  2I9S A;  3MTK A;  1CJT B;  3JTO A;  2CZV C;  2F4V J;  2VG7 A;  3RAM A;  4X65 J;  2WVE A;  3GR1 A;  1KLM B;  3CCT A;  1SJQ A;  3RBX A;  3TZZ A;  4I2P A;  4NZ7 A;  1C0T A;  4WFZ A;  2GJF A;  4QW9 A;  4Q43 A;  2KL8 A;  5IQ6 A;  2HFN A;  3OUY A;  1VLY A;  4LF1 A;  1FD2 A;  2RJZ A;  4M5G A;  3GJT B;  3ZZR A;  4MT1 A;  2BZ2 A;  2XTJ P;  2CVI A;  2PDA A;  2WOM B;  2FYX A;  3EXC X;  2DEI A;  3HPO A;  3IM9 A;  2DXD A;  4AND A;  3ENW A;  3TVY A;  4CO5 A;  5F9L A;  4CLK A;  5M2P A;  4DG1 A;  2CDR B;  4CT8 A;  4ED5 A;  3E2E A;  1U49 A;  1WUU A;  4N8O A;  5KT2 A;  3CGI A;  3PW4 A;  1JLQ B;  2Z2L A;  3FBB A;  3A3O B;  1HAR A;  1X9M A;  3G8Q A;  4ZPC A;  1YJR A;  1BMQ B;  3NKY A;  1SV5 A;  3ZXW A;  5L9X A;  1OO0 B;  1DAX A;  2DTJ A;  3T9N A;  3BJY A;  1ZM3 A;  4YP3 A;  4MKB A;  2MLX A;  2AQ4 A;  3T6B A;  4DL2 A;  1B4S A;  3GYN A;  5THW A;  2F40 A;  5IT9 U;  1AXQ A;  1I1G A;  3SEO A;  2IVY A;  5J2N A;  2P6T A;  2D3O R;  3SQG B;  2NRE A;  2J0W A;  1RBL A;  3OTB A;  1G3O A;  2GX8 A;  1HBO A;  2RDI A;  2X7I A;  1NU4 A;  2WON B;  4DX7 A;  1XR7 A;  4X84 A;  3N28 A;  2MKY A;  1AUD A;  1EKR A;  3AY0 A;  3PG9 A;  1JMT A;  2N3L A;  4ID5 B;  4RW4 B;  2M5Y A;  1HHS A;  3HLU A;  4O3N A;  4R8U A;  5FLX Y;  3AJ1 A;  3HXM A;  5LXR A;  4ETZ A;  2QSF A;  4DQI A;  4EMD A;  4F7V A;  3OSN A;  5IOL A;  2AX0 A;  4O4R A;  3BR9 A;  1YJU A;  2GW8 A;  5DJB A;  2RQC A;  4MIW A;  4GC7 A;  1M5O C;  3DLL Q;  1URN A;  1S5Z A;  1CEZ A;  1RI7 A;  4X4P A;  4B9N A;  2ZC4 A;  5IWA F;  4UQG A;  5D4N A;  4Q0B A;  3B82 A;  1YKW A;  2YPZ A;  4PCQ A;  3MAQ A;  3SV4 A;  4IH5 A;  1V6H A;  1XMB A;  2GNK A;  2M0G B;  3CB4 A;  2ZH7 A;  2J8A A;  2QA2 A;  1FWP A;  4NPO A;  2LEC A;  4ZCL A;  3A4T A;  3TNV A;  1IBK F;  3ULH A;  2GAG C;  3QAU A;  2D3O 1;  3M05 A;  1YG0 A;  1LWC B;  4PPZ A;  1EET A;  2ZUA A;  3VGU A;  2W2P P;  1FDD A;  4KB7 A;  2ZIT A;  1S7I A;  1OIA A;  4QIE A;  1LW2 B;  2MQN A;  4WZQ A;  2DY9 A;  3U7J A;  2GQC A;  4RLE A;  3J80 U;  3BDP A;  2MB0 B;  1KFS A;  4MIA A;  4NXM J;  4N7T A;  2E5I A;  4GKJ J;  1FEH A;  3PKM A;  3QFH A;  3EZU A;  5IV3 A;  2CAJ A;  3PX0 A;  1I3O B;  5D3G A;  3BPS P;  2YH1 A;  4DV3 J;  2JEJ A;  2UVV A;  4RU2 A;  2P5V A;  2HYI B;  2VOO A;  4TNO A;  4I2Q A;  1FJE B;  3OVA A;  4Z2X A;  1M1G A;  2W9B A;  5J2Q A;  2M9K A;  1O5J A;  2IPO B;  1K0V A;  5D4O A;  3KHG A;  1U1M A;  4S0M A;  1RP5 A;  2NXJ A;  1RAG B;  1HYS B;  1WAC A;  1U26 A;  4PAA A;  1X4F A;  2F8H A;  1YTY A;  5I3U A;  1NSA A;  1RBO B;  4N8N A;  1S10 A;  3P45 B;  4K5R A;  2HK2 A;  2CAD A;  2B4U A;  2AJ2 A;  1Y4Z B;  1BWV A;  4NLD A;  2KXH A;  1LWF B;  2RUG A;  2Y1L B;  4HHU A;  1VQL S;  4JI7 J;  1RTZ A;  3BKF A;  2CG8 A;  2A18 A;  3DDN A;  2FJV A;  3BEG B;  1JQG A;  2QFJ A;  4ZJO A;  1T0T V;  3DLE B;  1HBU B;  1N88 A;  1DY3 A;  5B0D A;  3HHL D;  2ZKT A;  2BJ8 A;  4P2F A;  1CS4 B;  3HX9 A;  4DR5 F;  3M8Q B;  4GMK A;  5A0Y B;  1SJF A;  1UVK A;  5ETL A;  1RHQ B;  1RAO A;  2LQ9 A;  1KSP A;  3MEK A;  1YX2 A;  2LXI A;  1GAO A;  1RTH B;  4ZHR B;  4O3P A;  3I9V 9;  1ZET A;  4O4G B;  1RT1 A;  4FVM A;  3NGD A;  1I6J A;  3M2R B;  2GV1 A;  4JI6 F;  3ISN C;  3JAM U;  2GQQ A;  3FDS A;  3FSI A;  2BAN B;  1T9U A;  4LT6 A;  3HM9 A;  2HNY A;  1GXT A;  4AE5 A;  5KFR A;  1FDB A;  5C7P A;  3DC2 A;  4LF5 F;  2D74 B;  2HWH A;  4ED2 A;  3R2C J;  3DGV A;  4ILM A;  1T8E A;  4IG0 A;  2HFO A;  1X9S A;  2AX1 A;  2LVW A;  2GCF A;  3B54 A;  4K4U A;  4M5D B;  5IT9 Y;  4A46 A;  2WK4 A;  1N52 B;  4KHR A;  2DRA A;  4URG A;  2A6O A;  2BAC A;  3CDE A;  2V4Q A;  1TL7 A;  3C66 A;  4FF4 A;  5CHC B;  3GCX P;  2PI4 A;  2QYC A;  3CCW A;  1JXV A;  1Q0N A;  3IP0 A;  5DGA A;  1FKO B;  4FF3 A;  4PRF A;  3CJ0 A;  3RBZ A;  3ZO7 A;  3VAI A;  3KLE B;  4Y65 A;  1UAW A;  1IBM J;  1SKU B;  2V68 A;  3V6K A;  3AAW B;  2QIF A;  4JV2 A;  1VRU A;  4WKR A;  5B0B A;  3QYY A;  3WC0 A;  4DR6 F;  4ZS6 A;  2M88 A;  2ERR A;  4N77 A;  2A2D A;  1N54 B;  3GYG A;  1Q53 A;  4TQS A;  2CNN B;  3SCL E;  3MUT P;  3HVT A;  1TL1 A;  3HZE A;  2DGW A;  4C8L A;  2XLI A;  2X3D A;  2MPU A;  3VQT A;  5D6G A;  3MCN A;  1SL2 A;  4DFM A;  1F2G A;  1W25 A;  2YY3 A;  5KFZ A;  5C42 A;  4ZJL A;  4ZIV A;  1CUL B;  2BW2 A;  4LF6 J;  4E98 A;  1TK5 A;  2J7W A;  1TL4 A;  1O0P A;  2CVE A;  3I31 A;  2QRR A;  5E5N A;  3BGL A;  1RAF B;  3MOJ B;  1IVZ A;  4KHP J;  3R7S B;  1NXI A;  3T3F A;  4DR1 F;  5HMZ A;  2E9R X;  1L3U A;  3BN4 A;  3HT0 A;  3WDO A;  1DQ8 A;  2V4J A;  4CRJ A;  3NLC A;  1FWK A;  2E7V A;  3H7H B;  1HW9 A;  3GIR A;  5CD4 A;  5DET A;  2DNN A;  5DDP C;  1E6Y A;  3DRX A;  2W8L A;  4P2M A;  2H5J B;  2B9X A;  4OZ1 A;  3E01 A;  2LEP A;  2VG6 B;  2UXB F;  2XY7 A;  1DZ5 A;  1SL1 A;  1BQN A;  3VAG A;  1X4E A;  4EO8 A;  4QJV A;  1S97 A;  4TY8 B;  3H98 A;  4KO0 A;  1X9W A;  2J0X A;  1N4L A;  3TAQ A;  4C0B A;  2E1R A;  3ZZP A;  5KG6 A;  3DI6 B;  3QRQ A;  1RWK B;  1IR1 A;  5FDL B;  3W2V A;  1YJN S;  4I4B A;  1NHV A;  3BZQ A;  2OPS A;  1Z2Z A;  4M94 A;  1NSQ A;  2N4C A;  3GV7 B;  4OZ0 A;  4CLY A;  3SDE A;  4EYI B;  3CWJ A;  4NX9 A;  3DCA A;  4ZDN A;  4ED8 A;  4LFA J;  1N8R T;  4X62 J;  2YKA A;  2R2U A;  1QSL A;  5IQQ A;  3MMJ A;  2CPI A;  3DLH A;  1UCN A;  1CPZ A;  4YB7 A;  4CO0 A;  2VFS A;  4QYZ K;  4FDF A;  3GJR B;  3LP2 B;  1SC6 A;  2ZWO A;  1FRX A;  2DGQ A;  1UFL A;  1TAU A;  2G0J A;  3M6W A;  2UXD J;  3Q86 A;  1F9E B;  6FDR A;  1WC0 A;  3KG4 A;  3MM6 B;  4XPE A;  1ACM B;  1QJH A;  5AE3 A;  3DOM A;  2VB6 A;  4Q7A A;  5E2Q A;  2HVD A;  1XMQ J;  3CD6 S;  4FYX B;  4Y3C A;  4B3T J;  1B3T A;  4LVN P;  2YNI A;  1HNW J;  3R5G A;  2BE7 D;  4KKO B;  1WDD A;  2FVC A;  3AHP A;  4DL7 A;  3HHL A;  4ENO A;  4JV5 F;  3KK3 A;  3EZO A;  3THT A;  4IR1 A;  1TMM A;  1HNZ J;  3OJU A;  4O3Q A;  2EK6 A;  3PW7 A;  4L3N A;  4QYR A;  1Q86 T;  2D3Z A;  3L7P A;  1RHR B;  2XMM A;  3FKB A;  4G1Q A;  1HKA A;  3O3L A;  1EZZ B;  1VQY A;  2R7T A;  3FRZ A;  2J76 E;  2HEK A;  4F4Z A;  4PZV A;  4OI1 A;  1UET A;  2Z4P A;  5KFG A;  2FDN A;  1XNR J;  2F3J A;  1FDN A;  1FJC A;  2J5A A;  3K0J A;  3J7Z 5;  4UY8 T;  2NCK L;  4B17 A;  3QJL A;  2CJQ A;  2HZC A;  4P74 A;  2I5J B;  1GT8 A;  3WC2 A;  4MKA A;  3JQK A;  4B9M A;  4B9U A;  1UW9 A;  3JYT B;  1TVR A;  3DNC A;  4DV7 J;  1BQX A;  2CNO B;  1N6Q B;  4K7Q A;  3C14 A;  1KQF B;  2VFT A;  2EFV A;  3W61 A;  4EBE A;  3THV A;  4NZ0 A;  1R8B A;  5HN0 A;  1YZ7 A;  1S99 A;  4I67 A;  4C3M A;  5HK4 A;  2B6A B;  1APS A;  4LF9 J;  4X65 F;  1BD6 A;  2MDA A;  1MMN A;  1WG4 A;  1BHN A;  1LNQ A;  3W62 A;  1FTC A;  4FPI A;  3SSS A;  2ATC B;  3HHN B;  4U9R A;  1L3T A;  1PJ7 A;  5GAH U;  4L73 A;  4QPT A;  2YNH B;  2H4W B;  3R5A A;  2AD9 A;  1S6U A;  4F04 B;  2QA4 S;  2Z57 B;  3A1Y G;  4AQY J;  3LWL A;  3V4I A;  1RWP B;  3PX4 A;  1FNX H;  4ICL B;  5KOW A;  5BYR A;  4HTI A;  3ZZU A;  4H4K A;  2CPY A;  4A8F A;  4NEZ A;  4LIR A;  4DLG A;  1EIY B;  2Q66 A;  1U4B A;  2F65 A;  4LSN A;  4PEO A;  3OPK A;  5K14 A;  1CJV A;  3M2U B;  4OI3 A;  3J7Y I;  4J5O A;  2OGU A;  2FJX A;  4K2J A;  4LUB A;  4PUO A;  2XB2 D;  2IVF B;  1HMV A;  3M32 B;  3UR3 C;  3NOG A;  1Q78 A;  5CH7 B;  1TKD A;  3RW7 A;  1NB2 A;  1HQE B;  3BRE A;  1WJ9 A;  3Q8Y A;  1TFY A;  3R3T A;  4ITS A;  2DHX A;  2Z2M A;  2ZHA A;  2R8I A;  3LP0 B;  2HBY B;  2CWX A;  2ZZT A;  1RAC B;  5LMN J;  1VQ6 S;  1WSV A;  2A10 A;  2L3M A;  1OWX A;  2KHC A;  4U8V A;  1D9F A;  3IC1 A;  3CNQ P;  2G0C A;  2CPF A;  3WQP A;  2YQ1 A;  2AT1 B;  5B09 A;  2ZBQ A;  4DSK A;  5ADZ A;  4ECV A;  5F3Z A;  1S79 A;  1XEZ A;  4KJI A;  3KHR A;  2R9L A;  1FJG J;  4TQR A;  2M52 A;  5J1N A;  4CLP A;  4B08 A;  1NME B;  3NAI A;  2WTF A;  4BWM A;  1KP6 A;  3E51 A;  3EVM A;  2DCU B;  3DM2 A;  1FVS A;  3PW5 A;  4Y2C A;  4UTG A;  1TU0 B;  5DZ7 A;  2VIH A;  1TZ0 A;  2XSF A;  3KJV B;  2OML A;  4AT1 B;  1SQG A;  1ZZF A;  1NH7 A;  2DK2 A;  3BV8 A;  1Y00 A;  1AA1 B;  1WC1 A;  2M70 A;  4KAI A;  3C46 A;  4PYD A;  5F8M A;  1T9X A;  3TJ9 A;  5F8H A;  4ZPT R;  4F67 A;  1CJU A;  2XHW A;  4YOE A;  3SFG A;  5L46 A;  2IY5 B;  1LW0 B;  4KRW A;  2FVQ A;  2OPR A;  1X60 A;  1SKS A;  1C4C A;  1N36 J;  2VJV A;  3ET6 A;  1NK6 A;  4JV0 A;  4HEA 9;  5KFT A;  3DXS X;  2FY1 A;  4ECQ A;  2X3G A;  2BQ3 A;  3DU6 A;  4HHH A;  4U8Y A;  3HVA A;  3KLF A;  3D0H E;  4RPF A;  4IQX A;  2ALZ A;  3SMZ A;  3OTE A;  2R42 A;  2GIQ A;  1U1L A;  4V1A k;  1AFJ A;  1MWZ A;  4NA2 A;  1FE0 A;  2VC1 A;  3Q8U A;  3BGF A;  4PWD A;  2LDY A;  1XR6 A;  2HVH A;  1PAU B;  4LSZ B;  3CC4 S;  2O3D A;  1PIL A;  1LEO A;  5ETS A;  3HJV A;  4WWS A;  3OR1 B;  4FF1 A;  2LEA A;  2Y8Y A;  4ED6 A;  4LF4 J;  4DFK A;  2D41 A;  1R3N A;  2HHU A;  2XMJ A;  4NXM F;  2HFV A;  2DNZ A;  4GKJ F;  2BUN A;  1VRT A;  3P6Y C;  4DUY J;  4UOG A;  4DSL A;  4O44 B;  2F1F A;  1YDL A;  4DV3 F;  2HMI B;  2HPU A;  4NLO A;  2F5G A;  5C24 B;  1SJ4 P;  1BUX A;  3FSY A;  5KT3 A;  2KKH A;  1NH8 A;  4EEY A;  3AJ2 A;  1HQ2 A;  1S1T B;  2DNK A;  2P6S A;  4U7C A;  2XCA A;  1FX2 A;  3UDV A;  1FVQ A;  1FK9 A;  1H6K X;  1SCJ B;  4ZCK A;  1OY8 A;  4X4R A;  4RUH A;  1XK8 A;  3GMG A;  1GXL A;  1JLA A;  1JIH A;  3PHT A;  2ASY A;  4X66 J;  2U2F A;  5HSP A;  3O8W A;  2DGT A;  2ZH2 A;  3KNA A;  1IKX B;  3K89 A;  1ZS6 A;  2FUG 9;  3Q8P B;  1RHJ B;  6FD1 A;  4IRC A;  4KGM A;  5KG0 A;  3MM9 B;  1I94 J;  2N82 B;  5HVH A;  1EJ7 L;  2GHP A;  2FVS A;  4DXL A;  4K4T A;  2WVF A;  1JXL A;  2VPZ B;  5IM0 A;  4EUV A;  1X8D A;  4ECY A;  4JI7 F;  4KSE B;  2Y3Y A;  4B3O B;  1H7X A;  3AFG A;  2PC6 A;  3RB6 A;  5BR8 J;  4E0D A;  5A2Q U;  2E5J A;  3KJQ B;  1YI2 S;  1UJ4 A;  2HQD A;  1NSK L;  4DL3 A;  3GSD A;  2WVC A;  3W7B A;  2J9D A;  3D0G E;  2V2V A;  3FUY A;  3QZ7 A;  2VQE J;  2GZO A;  2IJF A;  4F8R A;  3KG0 A;  1EP4 A;  3KJF B;  3CJ2 A;  1S7H A;  1C0U A;  2C3O A;  4EYH B;  1WC3 A;  5KFA A;  3QNW B;  4DBQ A;  3HVW A;  2C2R A;  3NGK A;  5HAN A;  3M7V A;  2YNF B;  3CD0 A;  1DTT B;  3D7S B;  1MWY A;  3WX4 A;  1EKS A;  1RHK B;  3POT A;  4XDD A;  3DRS B;  2P2C B;  2P9C A;  1Y3J A;  2JVO A;  4RKU C;  2SXL A;  5KG7 A;  3I0R A;  2C3P A;  4RJV A;  4ZLP A;  4FXV A;  5LMU J;  2MHN A;  2LKZ A;  3CT9 A;  1NAQ A;  4QYZ J;  4OLP A;  3OXF A;  1Q8L A;  2ZHB A;  1SH2 A;  4MK7 A;  2WB1 D;  2ZD1 A;  4ZP8 A;  2FC9 A;  3LW5 C;  1OPZ A;  3NGR A;  4HT7 A;  4NML A;  2C2Z B;  3NS5 A;  4LIW A;  2EC2 A;  2R8H A;  4ZP9 A;  2NSB A;  3KLI A;  4I6A A;  4P52 A;  1Q81 T;  3PAC A;  3I0S A;  3LA0 A;  4I2P B;  4CM0 A;  2Q1L A;  1C0T B;  5DG9 A;  5KFK A;  4JB8 B;  4PR6 A;  1HWK A;  3IBC B;  4ZPA A;  3IRX A;  2V0N A;  3QMQ A;  4C8O A;  2DY1 A;  3CJ8 A;  2RVJ A;  4ZKA A;  1NK7 A;  2CJ9 A;  4E8U A;  4RZR A;  2DHH A;  1V5V A;  3QO9 A;  4OJ1 A;  4I1T A;  4L75 A;  1B0P A;  3DRP B;  2J9D E;  1AB8 A;  4WP9 A;  2RU9 A;  1G6B A;  2VKR A;  1D8Y A;  2BEF A;  2GA7 A;  1ULR A;  1IBM F;  2E9T A;  4A8Q A;  2QYG A;  1TMJ A;  1S9F A;  4M1K A;  1KWM A;  4C7Q A;  2HFS A;  5EGY A;  2LQ8 A;  3M1V A;  4KY3 A;  1OJ4 A;  4OHX A;  1QSY A;  3L3C A;  3W64 A;  4YEA A;  3H2L A;  1HWJ A;  9RUB A;  1S6P A;  1OS5 A;  3D3B J;  2BKN A;  4OI0 A;  4JBC A;  4LF6 F;  2U1A A;  2D9P A;  3MM8 A;  3PKY A;  4OYZ A;  2FHJ A;  2ZUG A;  2BJ7 A;  2YVS A;  2BM1 A;  1GMV A;  4KHP F;  1HBO B;  4C8N A;  2H9Z A;  1LKZ A;  2PE8 A;  4N76 A;  1VHI A;  3N01 A;  4LBI A;  1CG2 A;  2MMY A;  5JXS A;  4YR3 A;  5H9E J;  4Y0F A;  1V3Z A;  3Q24 A;  4LRA A;  3MEC B;  3A8I A;  1SJ3 P;  5JMN A;  3BH7 B;  1Y5I B;  3Q8Q B;  4R8U B;  3TQ1 A;  4OMF G;  1ZA2 B;  1QM9 A;  1IXK A;  3T5K A;  1DAR A;  3Q2T C;  1T9Y A;  2C2E A;  4K59 A;  2J0S D;  1VIO A;  3OR2 B;  2OFG X;  3NCR A;  4H4O A;  2IM0 A;  2PMW A;  2DNP A;  1Q8B A;  4MIB A;  4PG5 A;  1WHW A;  3GFX A;  2KTQ A;  4DS4 A;  2W1B A;  2RRB A;  1P9Q C;  3P5B P;  1SI9 A;  2ALY B;  2ZH8 A;  5AJ3 J;  3I56 S;  4ES3 A;  4IG3 A;  5KG3 A;  1F5C A;  3MI7 X;  4DR3 J;  2HVZ A;  3R5J B;  4RUA A;  2B5J B;  2W8K A;  3BF4 A;  5KFC A;  5CYJ A;  1CQM A;  1PJ5 A;  2YWK A;  2Y0S D;  3DLJ A;  4LFA F;  2F7V A;  3TX8 A;  2F9D A;  4GO5 X;  5D15 A;  3WIV A;  4CO2 A;  5SZT A;  4X62 F;  4USU A;  5KFP A;  3J81 j;  4FYW B;  4L76 A;  2YKQ A;  2MZT A;  2PFF B;  3VHQ A;  2ROE A;  3UQS A;  4KPY A;  1X5S A;  3W60 A;  4N47 A;  5KFS A;  2GGP A;  4M8L A;  4L72 B;  2E29 A;  4HYK A;  4A8W A;  5GME A;  3MCO A;  3UPF A;  4NYP A;  1G2E A;  3P96 A;  1IBL F;  3PEH A;  4FBT A;  4OYM A;  4F25 A;  1UWA A;  2OIH A;  3DGP A;  2DYA A;  2ZE2 A;  3IR6 B;  1M0S A;  3V81 B;  5E0O A;  3QGI A;  1DFD A;  1XMQ F;  2AWZ A;  4CO1 A;  1ZAV A;  2QMU B;  3TA0 A;  3TEG A;  1S49 A;  1HNW F;  4P10 A;  4KGK A;  4ED1 A;  5D3G B;  1Q7L B;  2YKM A;  1FRM A;  1H7W A;  3FGV A;  3GP9 A;  2HGM A;  1MRO B;  2G13 A;  1HNZ F;  3K8V A;  1PYS B;  3OXG A;  4XDC A;  2KG0 A;  4I2Q B;  4EZ6 A;  3LGM A;  2MLY A;  1BXN A;  2DIS A;  3TAM A;  2R7X A;  1SIW B;  2LLZ A;  5GMD A;  3HKW A;  1K73 T;  4FYV B;  5T7L A;  3LO3 A;  2DR6 A;  4Z7Y A;  3GIJ A;  5A76 A;  3PYG A;  3CUN A;  2V2Z A;  3NGS A;  4TU9 A;  1UPP A;  2Q43 A;  1RT5 B;  2JWN A;  5KG4 A;  4F3Q A;  3KKF A;  2BX6 A;  2MYF A;  1C4A A;  4EBC A;  1Q5Y A;  3MWB A;  1XNR F;  1K0T A;  2B9W A;  1T9V A;  1R0A B;  1PCA A;  2AYM A;  1FJ7 A;  1H2V Z;  2AJ1 A;  2D7S A;  5I3U B;  4ZPW R;  2ZBP A;  1FFS B;  3QBC A;  1Q16 B;  3ETO A;  1VQ4 S;  2ZDO A;  3QGP A;  2XZW A;  4NA1 A;  4DV7 F;  2MY8 A;  2I2Y A;  4YDX A;  1HBM A;  1R0C B;  1QD1 A;  5H1S V;  1WDT A;  2GAH C;  4M5I A;  5ETM A;  2XHC A;  2I8E A;  5HLF A;  3HT3 A;  4LF9 F;  3VAH A;  3VAM A;  1UA0 A;  1QVG R;  1NUE A;  1XC9 A;  5IS2 A;  1RYR A;  1YRT A;  1KTV A;  1FER A;  2AJ4 A;  1ZBT A;  3GQC A;  4NOH A;  5CZV A;  4NYZ A;  4QIF A;  3SCJ E;  3T41 A;  1ZAW A;  1X5O A;  4AQY F;  4YS2 A;  1TP7 A;  3UD4 P;  3KUG A;  3O2I A;  2K1R B;  2ZJP Q;  2WSE C;  1YJ9 S;  1B7F A;  3RGI A;  2JRS A;  1RU1 A;  2KRB A;  3D1O A;  4DL4 A;  3QGH A;  2V4R A;  4WE1 B;  4RW8 A;  3AOD A;  2ZJQ Q;  2HNY B;  2ZZN A;  4F0H A;  3MMA A;  2YQ0 A;  3KNG A;  2QMX A;  4WCE Q;  2HFZ A;  2EFO A;  1N48 A;  4ES1 A;  1YBT A;  2W2N P;  2HVE A;  3NG8 A;  4DSI A;  2PN6 A;  1RAH B;  5LMN F;  4PKD B;  1FES A;  3QJP A;  4NZ6 A;  2XMA A;  2EFP A;  2FHM A;  2CFX A;  1P9Y A;  1XWL A;  1NDC A;  5HMY A;  4DPO A;  1KOO A;  1S1V A;  2CJK A;  4EO6 A;  2QGF B;  2LP4 A;  1FJG F;  2C2D A;  1T03 A;  1U1N A;  4NLR A;  2LCW A;  2HKE A;  3M6X A;  4DV4 J;  3VAF A;  3R5B A;  4TVA B;  3DXB A;  1R43 A;  4UY8 5;  2R4F A;  2R2R A;  2PA3 A;  4JI3 J;  3WIU A;  3CD5 A;  5MAO A;  3PYE A;  8RUC A;  1ZYQ A;  4QOT A;  1IQT A;  1RWX B;  2MGZ A;  4DWI A;  3RB0 A;  1NRK A;  5KTQ A;  1S0V A;  3L7U A;  1HD0 A;  1ICE B;  4Y2A A;  1UFW A;  1MG7 A;  1NK5 A;  2BXJ A;  1Y10 A;  1NHU A;  5HQM A;  4I64 A;  1VI7 A;  1N32 J;  2IBO A;  3HVT B;  3QFW A;  4H4M B;  2OEL A;  3M2V B;  3UNG C;  5BYQ A;  2KG1 A;  2VG5 B;  2FVR A;  5GAH I;  5C42 B;  4AD6 A;  2FHK A;  4PPD A;  5HI7 A;  3MUM P;  3M8P A;  4JI0 J;  2VBZ A;  2DGV A;  4ECZ A;  2RU3 A;  2A2C A;  2POK A;  2B7C B;  2DJW A;  1IKW A;  2RS2 A;  1QLN A;  4OYP A;  3A3P B;  2AMC B;  3D1H A;  3MM5 A;  3OHB A;  3UR0 A;  1WNE A;  4LSL A;  4NWB A;  2VPX B;  5HBM A;  1QSS A;  5C2G A;  4LRD A;  1LFP A;  2EBE A;  4C6A A;  2V4J B;  2DB1 A;  3K59 A;  2FTR A;  2CNK B;  4A48 A;  2VDH A;  2DH8 A;  2XS7 A;  4ZP7 A;  2ZVI A;  4YY3 J;  2CDQ A;  2ZKU A;  4IUF A;  1GQE A;  2Y1R I;  1SVD A;  1M5H A;  2NUU G;  3TR5 A;  4LRE A;  2RIJ A;  1FRL A;  1CC8 A;  2EXU A;  3R6G B;  4R5P A;  4LF4 F;  3GYX B;  1BQN B;  2Z58 B;  4QR1 A;  1U6Z A;  4HR2 A;  1WOS A;  3LWM A;  3S6E A;  1K1Q A;  5D4L A;  1UKU A;  4IH6 A;  3H59 A;  1SKR A;  3TYT A;  1MN7 A;  4DUY F;  3SSQ A;  3HD2 A;  4ECS A;  4F4K A;  2DRD A;  2XYP B;  1FKA F;  2GMH A;  2OI2 A;  2OPS B;  3U1N A;  2HRY A;  1WF1 A;  3MXH P;  2WZ1 A;  4A47 A;  3V6D B;  3SDE B;  2E5L J;  3CF5 Q;  1T02 A;  1FI4 A;  3W1Y C;  2ZH6 A;  5HP1 A;  4IO1 A;  1ZPV A;  2ZZM A;  1VBX A;  1PSD A;  5CAA A;  1Q1K A;  4UZB A;  4WTO B;  1OQ6 A;  2IM2 A;  3DLK A;  2VPW B;  4FP9 A;  1W2B R;  3DLG A;  3WX8 A;  1TKX A;  3N6M A;  4X66 F;  5KFQ A;  3OJS A;  3DFE A;  1GMW D;  3IWX A;  5HRO A;  2IA0 A;  5ETP A;  5E3Q A;  2Y8W A;  1IBC B;  2Q6B A;  5T14 A;  3BQ0 A;  2OHD A;  4DZ6 A;  5A8K B;  2MQ8 A;  4OYO A;  1OSD A;  5B0C A;  2WW4 A;  1VOM A;  3JQJ A;  1I94 F;  1MWQ A;  3PJ9 A;  3ZTP A;  4DV2 J;  3DOM B;  4FS2 A;  3IS9 A;  1SBR A;  2R2S A;  1AYE A;  4HDG A;  4A8M P;  3CCE S;  4KE5 A;  3G6V A;  5BR8 F;  1RU2 A;  2YNG A;  1HA1 A;  4HAC A;  4DS5 A;  1TTH B;  1IWA A;  3O44 A;  5AXL A;  3MPW A; 
#chains in the Genus database with same CATH homology
 5BR8 J;  2UXB J;  3J80 U;  4B3T J;  1HNX J;  4HHU A;  5A2Q U;  5AJ3 J;  4NXN J;  4DUY J;  2UXC J;  4JI7 J;  1HNW J;  5FLX U;  4JI1 J;  4NXM J;  3IMQ J;  4JI4 J;  3R2D J;  4DR6 J;  2KVQ E;  3R2C J;  4GKJ J;  4DV1 J;  4JI2 J;  4KYZ A;  4JI0 J;  4DR3 J;  4JI8 J;  3J81 U;  1N36 J;  5LMN J;  4JYA J;  2E5L J;  3D3B J;  4LF5 J;  4NEY A;  2VQE J;  4OX9 J;  3W1Y C;  4GKK J;  4JI5 J;  1HNZ J;  1N34 J;  4LF9 J;  4DV3 J;  1HR0 J;  4B3S J;  2UUB J;  4PWW A;  3J7A N;  4DV6 J;  4JV5 J;  1J5E J;  4LF6 J;  2UU9 J;  2F4V J;  3T1H J;  4DR4 J;  4DV4 J;  4X65 J;  4LFA J;  1FJG J;  3T1Y J;  4KHP J;  5IT9 U;  5IWA J;  4X62 J;  5LM7 E;  4DV0 J;  4B3M J;  2HHH J;  4DR5 J;  1IBL J;  4JI3 J;  4X66 J;  4YY3 J;  4V1A k;  2UUA J;  2MTL A;  4AQY J;  4LFB J;  2KL8 A;  1XNR J;  2MQ8 A;  4B3R J;  4DR1 J;  4DR7 J;  4DV5 J;  1XNQ J;  4YHH J;  4DV2 J;  1XMO J;  4K0K J;  4NEZ A;  2UUC J;  1IBK J;  1IBM J;  4LF8 J;  1I94 J;  3JAM U;  2ZM6 J;  2UXD J;  4RJV A;  4DR2 J;  4LF4 J;  5LMU J;  2MEW A;  1N32 J;  2VQF J;  3OTO J;  4JI6 J;  4X64 J;  1N33 J;  4DV7 J;  4KY3 A;  4LFC J;  1XMQ J;  3D3C J;  4DUZ J;  4LF7 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...