2KL8A

Solution nmr structure of de novo designed ferredoxin-like fold protein, northeast structural genomics consortium target or15
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
MEMDIRFRGDDLEAFEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles for designing ideal protein structures.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords OR15
total genus 20
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2kl8A00
4LF6J 4LFAJ 4V1Ak 4B3MJ 4LF4J 4GKJJ 4JI5J 3J81U 4YY3J 5A2QU 4DUZJ 2UXCJ 3D3CJ 4LF7J 4OX9J 4JI6J 2ZM6J 5FLXU 4JI0J 4LF9J 4JI1J 4DR3J 3R2DJ 5IT9U 2UUBJ 2UU9J 4JYAJ 4KHPJ 1HNXJ 4X64J 4DR7J 5LMUJ 4JI7J 4JI3J 1FJGJ 4DR1J 3J7AN 4LF5J 2HHHJ 2UUCJ 1XNRJ 4AQYJ 4DR4J 4DV7J 4YHHJ 2UXBJ 4RJVA 1I94J 2MEWA 4HHUA 1HR0J 2KVQE 4NEYA 4JI2J 3JAMU 1HNWJ 5LMNJ 4X65J 4KYZA 2MTLA 1N33J 4DUYJ 4DV4J 1N32J 2UXDJ 1HNZJ 1XNQJ 4DR2J 1XMOJ 4LFBJ 4JI8J 1J5EJ 4JV5J 5LM7E 5AJ3J 4B3SJ 4GKKJ 1N36J 4DV6J 4NEZA 3IMQJ 2KL8A 5IWAJ 3J80U 3R2CJ 1IBKJ 1IBLJ 4KY3A 5BR8J 4JI4J 4DR6J 3T1YJ 4B3RJ 4X66J 1N34J 4DV1J 4DV2J 1IBMJ 2E5LJ 4DV3J 4DV5J 1XMQJ 4K0KJ 4X62J 3OTOJ 2VQFJ 4DR5J 2F4VJ 4DV0J 3W1YC 4PWWA 4NXNJ 2UUAJ 3D3BJ 2MQ8A 2VQEJ 4LFCJ 4B3TJ 3T1HJ 4LF8J 4NXMJ
chains in the Genus database with same CATH superfamily
2JLGA 4X4RA 2GS8A 2I9SA 3AFGA 3MR5A 2BQRA 1IKVA 5A6WA 3AY0A 4PXBA 4J9RA 3RAQA 3ZTQA 2XS5A 1AUDA 4ZPWR 1UPMB 2BE2A 2HVDA 1HL6A 4LRBA 2GAGC 1HD1A 1QVGR 1Y5NB 1OIAA 4DL4A 3GJTB 4IFVB 3IRXB 4G65A 3KNGA 3N5FA 4ZLPA 1M90T 1P27B 2Z2MA 3K8WA 1M1HA 2VASA 4DUZJ 5HLFA 3FKBA 3OL7A 4WFZA 5DLGA 2MKCA 1NUEA 3FFIB 5IC4B 2ASJA 3FK4A 1WF2A 1NSAA 4EO6A 3QZ7A 2PI4A 3QRQA 2OPQB 3BR8A 1RT3A 1C0TA 1LWEB 3JYTA 2VQFF 2UXCF 1DARA 2VBWA 3DM2B 1C0TB 1LWEA 2GO8A 2LMIA 3HT0A 1NSQA 3MCMA 5T41A 4JI8F 2HBYB 2UUCF 2BANB 1SKSA 2W2OP 1TL3A 2DXFA 2IRXA 2C2DA 1FERA 1FFWB 5C2CA 2CJBA 1RTDA 2A3JA 5D4NA 2X1AA 1WNEA 4K4ZA 4EBEA 3B6BA 3BB5A 3F56A 4QU7A 1QAJA 3Q83A 3NMAA 3FDSA 1GMVA 1RHMB 1YBAA 2ZOFA 1UETA 4I2PB 3ZTPA 4YMEA 2W7OA 4ED2A 4LF9F 2KZZA 2LQJA 2XG8A 4ZN3A 1NEEA 2YNGA 2YNHB 4ZA1A 3PV8A 2B6AA 4DR4J 4IOBA 2GO9A 2XO6A 2WSCC 2YKOA 2Y1JA 3WC2A 2YXLA 3P3DA 5ETVA 3KK1B 3DRSB 2HK2A 2HHTA 4F50A 4WE1A 2X3GA 2A18A 4QYRA 1FRKA 1YTYA 1HHQA 1X8DA 3G86A 4F7VA 4ZVFA 4M1KA 3V2UC 1SH2A 1YDLA 3CO0P 4ZJOA 3S1TA 3GG0A 4Y6IA 1JJHA 4ZP8A 3S6EA 3M2VA 1K73T 2Y8YA 1S12A 2BJ3A 2DGVA 2FUG9 3M8PA 3Q0AA 2H5EA 3KHRA 1AYEA 4ZCIA 4X66F 3A8KA 1DTQB 5IV3A 5K8NA 2CPJA 4J9OA 4DQRA 4NLYA 1N32J 5KFTA 4RBUA 3HHDA 2UXDJ 3X3UA 3T1YF 4BWJA 1SKRA 2NLWA 1LKZA 1U7LA 3QMQA 1L3TA 3Q86A 4ETXA 1XTZA 4X4TA 1JNZB 4IG3A 4DL3A 4JV5J 3VCDA 3UDLA 3J81j 4LRFA 1HA1A 2AGPA 2GMJA 2PFDA 3KJVA 1VC5A 3KOAA 2KYXA 2QYCA 3D66A 4AT1B 2W9CB 1FNXH 1HHSA 1SH0A 3H4DA 2YQ3A 2FVPA 1FK9B 2CPZA 3R2CJ 3ITHB 1SQEA 2R8HA 4ZP9A 2XYGB 2UXBJ 2N3LA 3EMTA 4I68A 2B4PA 3UD5A 5A8WA 1G2EA 3CJ2A 1TKTB 4QZVB 3H25A 3FZ2A 2JWNA 4K7QA 1RI7A 3RRHA 4I7FA 3PY8A 3HI9A 4URQU 1YZ6A 3IRXA 4NI2A 4CO0A 3J7YU 2MGZB 2E5HA 2VOOA 2YX1A 3NS7B 1BMQB 1NH8A 1HBOA 2GVZA 1CULB 1PBAA 1S1WB 4FXDA 4U8VA 4MK9A 2VQFJ 4FXWA 4KKOB 3TI0A 3OR2B 2U1AA 2CAJA 2VUGA 1V5IB 2FHOB 2QA2A 3D6FB 4Q45A 1WOOA 1YLXA 4PWWA 4RR5A 2ADCA 2PC6A 4GC6A 3UN3A 1TL7A 3DLGA 1TK8A 4IDKA 4LRAA 1RCXB 2CNNB 1VQYA 4A48A 4KAIA 4CQ1A 4CO5A 3R6GB 4IR1A 4ECXA 1DFDA 2VBXA 3VAHA 5A8RA 2N7CA 1GMWA 1M5SA 1RT6B 2HBQB 2YNFA 2NXJA 2JRSA 4CM2A 1L5UA 3QATA 2ZBRA 3M8YA 3LWLA 2XY5A 4KV8A 3DRPA 3V4IB 2V8VA 1E6VA 2DY9A 1WKLA 1YJNS 4NCGB 2MMYA 1UP1A 1UEKA 3C2PA 1QTNB 1JLAB 3EVWA 3PM9A 4LIRA 3HZEA 3TZYA 2EFGA 2ILZA 3J81U 3FBEA 2F4VF 2E29A 2BA9A 5KT4A 5D6GA 4ELUA 2QSWA 2HNYA 4R25A 4FVMA 3UR0A 1HBNA 4KGKA 3NRBA 1NB2A 3GU0A 2GX8A 4ECTA 1G1XA 4DR3J 3PJ9A 3UWTA 1R6VA 2Y1IA 2FVRA 1HYSB 5I3UA 3CW2C 2WVDA 3T5KA 2EFVA 3RBDA 3RB4A 2DT9A 4FPIA 1VQKS 4D3HA 1WTBA 2Q66A 4HH1A 2DCUB 4PPDA 5GAGI 1CJUA 3MECB 2OFHX 3A1YG 3QIPA 3LPEA 4OIXA 3W2VA 1RT4B 4AD6A 2ZITA 4B3MF 3M7VA 2DY1A 3MOZA 3R8YA 3PW4A 2NCKL 3L7PA 1VBZA 2PO4A 2MHNA 2CQ1A 3LOUA 3U7JA 3ELHA 1GXUA 3QLHA 3TEHB 3IG1B 3V6HA 4YP3A 2CNKB 2BE7D 3MM8A 1S6PA 1R0CB 4UOGA 2OKQA 2AJ4A 3MAAB 3I0RB 3PIOQ 1O5JA 1B0VA 4F0MA 2MQNA 4WKYA 2YKPA 4C3LA 2LCWA 2BQUA 4USIA 4ECZA 1UJ6A 3DRPB 4U96A 3V4IA 2UVUA 1KNZA 2RDJA 3SBMA 5F9LA 2G1HA 1JNRB 3CIZA 2DNRA 5J1NA 2QLWA 1OS5A 2XMTA 1FDDA 1CLFA 4JB8B 3CJ3A 1TVRB 2V6AA 4OYIA 3POTB 2MHEA 2FGOA 1TU0B 3GB0A 3QFWA 4OX8A 4PPZA 2DGOA 3AB4B 3OFGA 1RKJA 2ZOMA 4DV2F 3TAQA 3G96A 4EWTA 5DETA 3ISZA 1Y9OA 1NPPA 4LSLB 2OEKA 2WVEA 3AT1B 2IVMA 3MOJB 2W2PP 5EGYA 1QAYA 4MFBB 3G82A 3KJNB 3ENAA 3NCRA 4OJ1A 2AJ0A 1IN0A 2DEIA 1RWKB 4EEYA 4O44B 1VQMS 4B3SJ 2HHHF 1TUVA 4WYLA 2NZ4A 3TX0A 4ZIVA 2WSFC 5IWAJ 1NH7A 3SCJE 2E5GA 2HRTA 1Q8KA 4G1QA 3W62A 1KEKA 5HMWA 1NK7A 1DAXA 3WX4A 2XGQA 3LO3A 1GT8A 4OX6A 1RWMB 2XLIA 4KH0B 3KDOA 2BOAA 3BDEA 3GYXB 3HHLB 4TVAB 3N28A 4NLGA 2VV5A 2MKKA 4B9MA 2QO3A 3AXKA 4DV1J 2VB6A 3FBBA 3OVSA 1KC8T 1HWUA 2QLJB 2HHPA 3KFWX 3NGRA 5KFIA 4MMOA 5B0DA 1FK9A 1S1XB 1U49A 4DCJB 2N82B 4B9VA 4UY85 1NB7A 2HQGA 1QUVA 3OL8A 1U1LA 2IYIA 3JB9k 1M1KT 5J2QB 3MMCB 3PEJA 5KFQA 1UL3A 1UFWA 3MPVA 2A2CA 5LSRA 1DJ0A 3M2UB 1XBWA 2A0FB 4DG1A 2RRAA 4KTQA 2CG8A 3MEGA 3JSYA 4MIWA 3KLGA 2XULA 2IM1A 4CYUB 2KI2A 1TK5A 2NYHA 1PKUA 4NMXA 3OSNA 4LFCJ 1YG0A 4FKXA 1U1RA 2Q3PA 2F5GA 3QZ8A 3I0SB 4LF4F 4XIUA 3M8PB 4LF8J 2BKPA 1EARA 2PMWA 1BQMB 1MWQA 3M8ZA 2QL9B 3ENQA 2FZGB 2ZC4A 3PYGA 4P72A 3AOCA 3RBXA 1R7IA 4CH7A 3OL6A 4DFMA 3CCMS 4JI4F 1HNXF 2H54B 1FFGB 2EI5A 2X7IA 2PMHA 4C8MA 3PX4A 3HKWA 4JI5J 4IQMA 1IKXB 2YQ0A 3DU5A 1MG7A 1PIEA 2OAUA 3I5AA 1VCTA 4U7CA 3KLHB 3M8SA 4OYAA 4WZQA 4F4AA 4P7VA 1HYSA 5KG1A 1Q8BA 1S49A 3M6UA 3AH6A 3NGTA 3UN2A 4EBCA 3D1QA 1HMVB 4YR3A 4EZ9A 1QSYA 2GIFA 3ZZPA 3DGPA 2DYAA 4LBIA 3TA1A 1FNOA 2V2QA 4BBYA 2R2UA 3KWMA 1YJVA 3W64A 3VAKA 1JLBA 5ETPA 1CG2A 2COLA 2J9EA 3O6QA 3PCOB 2XMVA 2D7SA 1SCJB 4G1IA 1S1TB 3H0PA 5ETSA 2PT0A 3R7SB 3VZIA 1U1NA 1YQHA 5J2MA 1NDPA 4PWDA 4EMDA 1RSCA 1SJFA 3GJQB 4OZ0A 4QIVA 2FLLA 4ZMMA 2HRYA 4P74A 4F36A 3BF4A 4PCQA 2ACMA 4PG6A 4JI3J 2WB1D 2KXFA 3TAPA 3FBCA 4P7TA 2KB2A 2YVSA 4C8ZA 2CZ4A 1V6HA 5T7LA 1FEHA 1T03A 3V6KA 1UEVA 2VL1A 2OJ3A 5C2GA 2ZOGA 4ZVOB 3ZZRA 1KFSA 3A8JA 3EDQB 4C11A 4DZDA 4B17A 3K5OA 1IWGA 4QR1A 3JQKA 3ETOA 1C2PA 3CD7A 1RWUA 1LW0B 3ONQA 2XMJA 2WOMA 4MK7A 5H9FJ 5KT2A 1BGXT 4PXDA 3VVUA 1N5TA 5F8GA 1U45A 3R9LA 1CBKA 1OYDA 4QW8A 1VJWA 2V8DA 3TO8A 1I94J 4DUTA 4N41A 5L9NA 5B7WA 5D77A 5DRKA 1LFPA 3H42A 4GVBB 4OFZA 3NY0A 3HVRA 4L72B 4ECVA 3CCZA 2K1RA 3ISND 5F0UA 5BR8F 2W7PA 5BXIA 1NKBA 2W4DA 3J80Y 4F2RA 1AZSB 1O51A 1HNWF 3CUNA 4WP8A 1W2BR 4QU6A 3PYFA 4ZN1A 2XMAA 3NNHA 4TU7A 4CM0A 2M7SA 3LH2S 1RTHB 3CNQP 3US5A 3LQVA 1NJWA 5B0EA 1KVKA 2DNPA 4NLRA 1N52B 2CQIA 4R8UA 5A6PA 3IWNC 1Q1KA 3DYAB 1RA7A 2QZ8A 3O44A 4HT5A 1HQ2A 1ZETA 5CABA 5CA5A 4YB1P 1Q7YT 2VDHA 2KFNA 1RB0A 1R8CA 4JI4J 1BE4A 1JLBB 2NXNA 4DR5F 3L95X 4ZOSA 1NK8A 1YJTA 4R0JA 4OHYA 4TYBA 3QT5A 5DM7Q 2KYZA 1HI1A 3AOBA 2OPPB 5DQHA 2HGNA 3DLLQ 8AT1B 1WKJA 2R2RA 3BKFA 2GJIA 4XDCA 1PGZA 1SJ1A 2YKAA 5AE3A 1I94F 1U2CA 3CJTA 2XYHB 1F9EB 5D4OA 3BQ2A 1JMTA 2CPYA 4N56A 3GIMA 2W2QP 4F25A 4CO2A 4ITSA 1IBLF 2FB0A 3BO4A 1YWXA 4GKKF 3OW2R 2OD4A 1BWVA 3DI6B 4LVOP 3WQPA 5KFUA 4CLLA 1TKXB 2ZFHA 2VG7B 2HHUA 1Y5IB 3GTYX 4OZ1A 1ZM9A 4U6PA 1O8BA 3JAMY 4DUYF 1UVMA 1K44A 3W61A 1MN9A 4CWBA 3W9IA 1GXLA 3ILLA 3PIPQ 4NZ0A 2OFGX 1X9MA 3S01A 2DEJA 2ATLA 2ZUAA 3MDFA 4CNYA 4NXMJ 4LFBF 1LWXA 1R8AA 2W2MP 1XR5A 2YKMB 2K06A 1S4FA 4RBVA 4RW8A 1VISA 4CYUA 4DSEA 4NCAA 4DMZA 1EZZB 1URRA 3QSIA 2OHDA 3TZZA 4A8OA 3KK2A 4TY8A 1VQSA 3WHIA 2V4JB 5IT9Y 4NMLA 5GAGU 5CZXA 1VIXA 2E9RX 4RWXA 4C97A 3T19A 1J5OA 4KR0B 2MKHA 5CD4H 3HVTB 5GAHI 3MCNA 3DC2A 1PYOB 3DM2A 3EE3A 3LP1B 3OTCA 4U9RA 4CLKA 1EHWA 4PUOA 3PR4A 1RDRA 3QWUA 3SEOA 4LF1A 1HHTP 4DSIA 2QIFA 3G6YA 2QLFB 4DBQA 4MKYA 2OPSB 4DJBA 4ED6A 1UA0A 1C1CB 1WC6A 2IYGA 3AJ2A 3CF5Q 3GFYA 3QGHA 1T05A 1UEUA 2RJZA 3ZZ0A 3PFEA 3GIKA 1P1LA 3F41A 4AXIA 1F9FA 2WSEC 1J2VA 4ICLB 4QIGA 2B8PA 3G6XA 3X1LB 3PW7A 4K5RA 3TVZA 2WVFA 5HJYA 4Y2AA 2R2TA 5FDLA 4G6VB 3BN7A 4NYZA 2HSEB 5ITHA 5L1LA 1RQ0A 5IS2A 2B9EA 5IT4A 1FNMA 2FJDB 4L75A 3QRRA 1Y3JA 1G4CA 2QMUB 2CQ3A 1Q4RA 2RRNA 3KYLA 4TN2A 2DKOB 3ZZUA 1NZAA 1UPPA 4JUZA 4HYKA 2M9KA 3BGLA 4M5NA 4DV7J 1FJCA 1MMDA 2FYXA 2GMHA 4IG0B 2B4UA 1FKPA 3TP2A 2DJWA 2IJRA 2J7KA 3GSIA 1WG4A 3BBFA 5IV4A 2VA3A 1KD1T 2LXIA 5H9EK 3LTOA 3PO5A 4Q0BA 1Q78A 2YY3A 3RU0A 4Q43A 2MZSA 2RU9A 3HVTA 3GV5B 3TJ8A 4BDPA 3ZZYA 3FVYA 2HPUA 3PKMA 2R8KA 1HNIB 1IQZA 1JXVA 1NDKA 2EKYA 3CCQS 2GA7A 3BREA 5E2QA 1SBRA 1VQLS 5CH7B 4Q8FA 2W7AA 4DPUA 2EC0A 2IY5B 4P52A 3VAIA 4O3RA 3PDNA 2ZH2A 3NNAA 4B3OB 1NSPA 2AKWB 2OP5A 3F44A 1Q16B 3CJKB 2G2OA 2IIHA 3D0HE 4Q8EA 5C24A 1PYTA 1SH3A 2EBGA 2G1DA 2W25A 2RF2A 1Q5VA 2H4WB 2PMZD 2KG0A 1H98A 3ICLA 4C98A 4OMFG 3C15A 2ALZA 3L3CA 3KLFB 5KG6A 4RZRA 3MEEA 4ANCA 5BR8J 3G4SS 2W8LA 3UVJB 2KTQA 1IJEB 4N5SA 4CH1A 4YFUA 1TTHB 3UVJA 1S9FA 1YHQS 3F0NA 4O0IA 4JI5F 3BZQA 4NXMF 2RAQA 2C2RA 3G8SA 1HPZB 4LRDA 3M6WA 4PQUA 3ISNC 2IAJB 4KO0B 1VYAA 2VKZG 4EI2A 5H9FK 2XO7A 3MPDA 3OFHA 4LSZB 4ED5A 1A7GE 4WXOA 3SDEB 4TNOA 4ICLA 3R5JB 2XHCA 2BYCA 2P6SA 1TL5A 5KG4A 2HVZA 5HBMB 3R5GA 2O3DA 1FXDA 2YBVA 3BV8A 3GCWP 2CRLA 4KT0C 1U6BA 3K0JA 2OTJS 2DIUA 3D6TB 5E3CA 2HLTA 1D9FA 3QJLA 5EWEA 1TFWA 4NXNJ 5DO2A 3TA2A 4M63A 1VK3A 2DHAA 1U1OA 2B9YA 3V4MA 1J5EF 2ZDOA 2C2KB 3VR1A 2YNFB 5J2NA 3AD9C 2HQDA 2MQ8A 1UFKA 1NSKL 3IC1A 2ZH9A 3DYAA 4UY8T 1S0VA 5HSPA 2W9CA 4F0HA 4ATNA 1K8AT 2EG2A 1XMOF 1T3NA 3VF0B 5HI7A 1OWXA 4AUKA 5CYMB 1T95A 3THPA 1GAOA 2G0CA 9ATCB 3KJQB 4DFKA 2HHXA 2IBOA 5ETMA 1AXQA 3UFCX 1SUQA 2VC1A 4N47A 7FD1A 3OLBA 5BYSA 3CCSS 2VJVA 2YWEA 1HBUA 3EGNA 3PTWA 4DV1F 2DR9A 3UCGA 4A8QA 4RW8B 3CULA 1YKWA 4NZ6A 4AYBD 2VHGA 1SL0A 4RL1A 2GVZB 2ROGA 2ASYA 4OI1A 1NCLA 4DX6A 2VICA 3R7NB 2Y8WA 3M8QB 3I31A 4DS4A 3I56S 2QA1A 5FLXU 3Q8QB 1X9WA 3GV7B 2M2BA 2AQ4A 4I6AA 2EW9A 4RUHA 2AYEA 1VDHA 1NBEB 2MJUA 5E3RA 1YRXA 4ZCKA 2BVZA 2G13A 5IT9U 2RSQA 1H2VZ 1KLMB 3I6PA 3EM1A 5A8WB 2C3YA 2RUGA 3BDPA 1CJTB 5A76A 1VHIA 3H5XA 3C6TB 2HVEA 1PJ7A 1S4EA 3FSYA 4USMA 4URSA 3KG0A 2DGUA 3L09A 1JQGA 4Y2KA 1FWLA 2CQDA 2VJUA 3OSPA 3JSRA 3U1LA 1X9SA 1FJGJ 1ROFA 2F40A 2M8HA 4CZCA 1S7HA 2AMCB 3FUYA 5DDQC 4FF2A 3I55S 3MPUB 1RYSA 2HG4A 3NL0A 3HFKA 5C25A 1VC0A 1M5KC 4FPRA 3DLBA 2GQQA 5DZ7A 4OYBA 2IA0A 1U0HB 4N7TA 2HNDA 3M9MB 4HLBA 1WELA 4AFFA 5KFNA 3V81A 1XQIA 2HNZB 4DCOB 2MQLA 1FHTA 2PIIA 3KDNA 4DN0A 2HFOA 1U2FA 2GJ2A 2DR7A 1N6QA 2YX7A 1PSDA 3OFFA 4B02A 2AEFA 4J37A 1WDTA 2I6WA 3SCLE 1TKDA 1R3NA 4FBTA 1Q5YA 4PKDB 5M2PA 4IG0A 1SI9A 2X3DA 3G6VA 4WCEQ 1EETA 1VI7A 2A10A 5F41A 3J7YI 1R8PA 1QJHA 2F4FA 4P6QA 5HK4A 2OI2A 2LQ5A 2CFXA 4NA3A 1U47A 2BRLA 3BH6B 1RYRA 4M94A 4FS1A 3DLEA 4YB5A 4M5IA 4DHVA 4ETZA 2WTFA 3EGVA 1NJZA 3JTPA 2V9KA 2XYPB 3G2XA 4CI0B 1CJKB 2J6SA 4PXEA 1EX8A 1TZ0A 2R42A 4BLGA 4ZITA 3Q8YA 3DLJA 1TL4A 4PWUA 5EX3A 4AQYF 3KLVA 4MAKA 3CPWR 4PYDA 1DQ8A 4NLOA 1T05B 1RUSA 1RADB 3P5TL 3KUEA 5KFVA 2ERRA 2LFVA 4XDDA 1RWVB 2KM8B 3UPFA 3BSAA 3D1HA 3K8VA 2KRRA 2FZCB 2W4PA 4F4YA 4CNZA 2QA4G 3A3PB 2HZCA 2OMOA 3OV7A 3R1LA 4NZ7A 3CCVS 1PYSB 2C2OB 1M1GA 1WI6A 5H9EJ 2QRRA 2RKIA 2D3ZA 1Z4UA 3EZOA 3LPYA 5DDPC 2W9BA 1AFIA 4OYXA 3BGFA 4FYYB 1SC3B 5E3AA 2AJQA 2C3OA 1ZAWA 4K4WA 1D3WA 3C8YA 4M5MA 1MN7A 1RWNB 5HQLA 1R0AA 4FBUA 2VONA 2M88A 5KFZA 2FLNA 3MGJA 2ACYA 4P9SA 3TARA 2CJKA 2GQ2A 1LK5A 2UVWA 5JJBA 3SIPB 1RT2B 2KZMA 5KFEA 2EFOA 3RB0A 4ILLA 2E66A 2N4DA 3OR1A 2O67A 1RJJA 3CDAA 4R5PB 5I42A 1UVNA 1NDLA 1SIZA 1RT7A 2CQ2A 3C6UB 1CPZA 4JV0A 4QWAA 1VRQC 3KXDA 1WKKA 3TNVA 1HQEA 1IBCB 2ADBA 1S0OA 1AUSL 5EHHA 2A6OA 2HZAA 3BSNA 2OGUA 3M6XA 2LU2A 4IFYB 7FDRA 3C3LA 2ZH5A 2D3UA 3ET6B 5JVHQ 4JI0J 3OD2A 1ZBTA 2DNQA 3T5HA 3Q2SC 2AYGA 3J7A1 3C14A 2V8PA 3MEGB 3OHBA 1I5OB 4BS2A 1U1KA 4FF1A 3ENVA 1U48A 3CDEA 2XB2D 4JV5F 5CXTA 1URNA 4CT9A 2YWFA 5KFXA 5F0WA 3HK2A 3A12A 2E7VA 2GHWA 4XAKA 5L39A 4RBTA 3RB6A 4ZLNA 2WB4A 1HNXJ 3HKZD 3HJVA 4DQSA 4CLWA 3VZHA 5KFBA 1RT3B 4OJGA 3JYTB 4RUCA 3E01A 2ZNZA 4DR1J 2LXFA 3BKTA 1QM9A 3MCOA 4RU2A 2FPHX 3UR3C 2PSZA 4KGVB 3LGMA 4NYPA 3AA9A 2R9LA 4DV6F 2OH2A 1QVFR 5J2MB 1WOPA 3DRRA 4DU7A 1X0PA 2EVZA 5C7PA 4I6WA 1S9GB 2WONA 4HI2A 2VZ9A 4YS2A 1HWIA 2DO0A 4YHHJ 4B9NA 3KMQA 3B78A 1LWFB 1F60B 1WEXA 5KOXA 2AEMA 2AU0A 1WEZA 1X4GA 8RUCA 4C8LA 2GIRA 1NNDA 2NS1B 4LQ9A 4P10A 5DS7A 1TKZA 2BW2A 4CO4A 5MLCV 5HQMA 3DLEB 4IUFA 1Q53A 2CNLB 3B4DA 3DGVA 1PBUA 1LW0A 3FEYB 4NEYA 4WIQA 4XK8C 4KGMA 4ZVUB 2CPHA 3HM9A 4OI3A 1WC3A 3IP0A 1SL1A 4KYZA 1N33J 1QDUB 2DNMA 3PHTA 4HKQA 4Z7YA 3MHYA 1UWBA 4UUWA 1MMLA 1RTJA 3DHWC 4J5OA 4AXJA 3CE8A 1UTAA 2L08A 4I69A 4E98A 3D6HB 5FD1A 5C24B 2GAHC 4YEAA 2CZ9A 1GTHA 1FTRA 2LQBA 1FKPB 3O3LA 1N5QA 5KOWA 3M30A 5KFOA 2VIHA 3RRKA 1N54B 3EXCX 2QGFB 1RT5A 3I4HX 4HHHA 1U09A 4WP9A 4C48A 5D0RA 3J80U 1EB0A 1RP5A 2HIYA 2F65A 3GIJA 2B5JA 3GQCA 1FRXA 7AT1B 1N32F 4I4BA 1ZZFA 3HHLA 4AL7A 4U7UD 1JJCB 4B3RJ 1U6FA 4QR2A 4UOCA 4X66J 5AE1A 5F3ZA 4ZPVR 4QOTA 4ER8A 2CG4A 4YN3B 2R7VA 3IWXA 3LUYA 3JQJA 5K5MA 4DV2J 3KMSA 4J9SA 3M2RB 1X5PA 2RQCA 1QLNA 2QSFA 3Q8SB 4RW7A 2ZUGA 1Z1ZA 4CRJA 2FLPA 2Q6BA 2R7OA 1KHVA 2WZ1A 4YB7A 3G82B 3N0VA 4YQWA 3QIPB 3TZWA 2W8KA 3ZFVA 3A13A 4I7FB 1S72S 3IWLA 1TUGB 2RH3A 2MLZA 2XI2A 4CLTA 3TJAA 1C4AA 1HD0A 4K59A 3IBCB 4I2QB 5HMZA 2PD1A 1U4BA 4ED0A 1HW8A 5CCLA 4M95A 4UTGA 4X2BA 1WACA 3D68A 1FF2A 2BM1A 2M3DA 2Y9HA 3I82A 4OYZA 1BD6A 3HVWA 3T6BA 3I0SA 4N8OA 3C46A 1S76D 2XS7A 4K2XA 1GMWD 1L3UA 3LP2B 2J7UA 2D9PA 2RRBA 3NG8A 1RHRB 4H4KA 3MEKA 2P5VA 4S0MA 4W92B 4QYZK 1RT5B 1SUQB 2BKOA 1LW2A 3WIUA 3CCRS 4CLYA 2YKMA 4UQGA 2Q6CA 2V2VA 5ETNA 5B0AA 3EPIA 2ZHBA 4DL6A 5KG3A 1RT6A 2B9XA 2O1PA 4DWIA 1NO8A 5HN0A 2AD9A 3CC2S 4DSJA 1T02A 3L4BC 3FGVA 4C8KA 4JI6J 1DTTA 3ZC4A 3W8GA 3PJWA 2JOQA 3GFZA 1X60A 2J8AA 2ZKTA 4K4VA 1RWPB 2O5DA 3BH7B 3DI6A 3TJ9A 1RT4A 2V5HG 4F8RA 3MXHP 1CS4B 3W8PA 4F3QA 5KFMA 2CA9A 3G8QA 5L8RC 2UUBJ 1NK0A 1IVZA 1WC0A 5IQ6A 2AGOA 1EKRA 2XHWA 2VA2A 4KRWA 4P75A 2C2EA 1H2UX 2AT1B 3BM7A 2XTJP 1CSJA 3UDVA 3KJFB 1RAIB 2B8QA 2IMOA 4OQJA 2OSQA 4PQUB 2BUNA 5GMEA 2BDPA 3PVXA 2AX1A 4PAAA 1ITPA 4U67Q 2FC8A 2YKQA 4U8YA 2R7TA 2L9NA 1TKTA 1L3VA 4B9SA 3HSZA 3CDUA 1XNRJ 3KHGA 4OV1A 2JFKA 1I6JA 1F2GA 1S7IA 2ZBCA 4UW2A 1DZ5A 3W5YA 4YY3F 3MR2A 5THWA 5GMKa 1TVRA 2QG9B 2MKYA 3OUYA 2ZM6F 1CJVA 4DPWA 2AZ3A 3DFEA 4OX9F 5DG8A 4J9VA 2QA4S 1PCAA 1RKIA 3GR1A 1M5PC 1WDDA 1F5AA 5A8RB 2I38A 1N33F 3H8YA 2AGQA 2G0IA 2R7UA 2NZCA 3IS9A 1UCNA 3DRYA 4OI4A 4A8KA 5HVGA 4PABA 2XBPA 2Y1LB 2VFTA 4ZCMA 3QJPA 2V4JA 1DTQA 2AZ1A 1ICEB 4HTIA 3VGTA 2V4QA 5E0OA 1UMJA 1CEZA 1HLWA 3FSXA 2MDAA 2RE1A 4B08A 5ETKA 2G0JA 2MY7A 3JSMB 4ED4A 4IRKA 2WAQD 3QGIA 4J90A 5MAOA 5KG5A 2DXDA 2V50A 1U2RA 4B3TF 2V63A 1O6XA 3I9ZA 5LM7E 3CCES 5F8IA 2KJVA 2WOMB 4F4XA 4ZVTB 3G6ES 4IOAQ 5D3GB 4DSKA 2IRUA 2LVWA 4IH6A 5I42B 4DV6J 1VQ5S 5KFPA 2KT2A 3O2IA 3WDOA 2C2NA 3W2VB 1RAGB 2WW4A 4NL5A 2GHVC 3S8SA 3M32A 2UUWA 2DR8A 3SMZA 2WVBA 4DR1F 1GNKA 3NAIA 4DSLA 3DLGB 3KHLA 3A3NB 4F02A 4A8SA 1RBAA 2R8IA 1JWWA 3KLEA 4WU2A 4ZIWA 4FN5A 4BHQA 2CVIA 2Z8QA 3MFIA 1HQUB 2YNIA 1P1TA 4WYWA 1ZZNA 1ZM4A 5HVHA 4O4RA 4DX5A 1S1WA 1TAQA 2E7XA 1S6UA 1U26A 5ETOA 4A46A 1TL1A 3NOCA 3QAEA 4ZVGA 4OHZA 4CO3A 4PG4A 3K5NA 4C0BA 2HLUA 1WEYA 5L46A 2D9OA 1KOOA 3UDCA 5C25B 2JEFA 4GO5X 5EDWA 1FO1A 3NXZA 2AYBA 2HW3A 2YWKA 2V2KA 2KXNB 2JC0A 1QAXA 2I5JB 3G8TA 2EC2A 3O5TB 2JEJA 4X4VA 2KU7A 4CDIA 3OUYB 4IRCA 3AA8A 3N6LA 3NBPA 5F9NA 1QSLA 2FDNA 3OXFA 2XSJA 1YJ7A 4EYIB 4DFPA 4JI3F 2DTJA 3BS9A 3DDNA 4WE1B 4O3OA 1U02A 1S48A 3BQ0A 1WSVA 4C8OA 5D0HA 1U0SA 4OYPA 3H5UA 3IA0A 5GAEI 1T9WA 3OR2A 3ILOA 2JLEA 1FRJA 4WPAA 1UWAA 3HSJA 1KOHA 1QY7A 2FHKA 4YY3J 3I4PA 3E51A 2RQ4A 4I64A 5L1IA 5K9FA 4LF7J 2LA4A 4JP8A 2UUAF 1XNRF 2B51A 2J0XA 1TP7A 2D3OR 3M05A 4TQSA 4C0HA 3BBCA 1KONA 4IO1A 4DQPA 2P9EA 3AXMA 4DG1B 2FJAB 3DRXA 3OTOF 5KFCA 3CC4S 2Z56B 3D1OA 3GMGA 4PR6A 2ZVSA 2LECA 4NLPA 3CIMA 3TZXA 1FE4A 2H5IB 3C66A 1OY9A 1A6LA 3UN5A 4LFAF 1DTTB 1UJ4A 1JJ2R 1XNQF 4RW6A 1M0SA 3CTRA 3AOAA 2ZC3A 4X64J 2YNGB 1H6KX 3JSMA 2UUBF 1S9EA 1VR6A 3R5AA 1JKHB 4FZVA 4MYTA 4DPTA 4N77A 4ZLJA 2C42A 2ZHAA 3UD4P 3V81B 4IG3B 2KRBA 1XR7A 1HBMA 2OPPA 1I1GA 1UVKA 2BRKA 2MZRA 3HHEA 3QNWB 4BC7A 4PWDB 1F3VA 3OPKA 4LF5J 3HFVA 1F6TA 3PRVA 2EFNA 3M2UA 3THVA 3QYYA 4EZ6A 4ZK7M 4A47A 4J9MA 2DRAA 1HNVA 4ZVRB 4PG5A 4Y0FA 4JV1A 2F8HA 1D8ZA 1APSA 3B4MA 4NLUA 3FJ2A 4LF7F 4B9UA 3PW0A 3R2DJ 4ILRA 1R43A 4EU0A 4A8XA 2H3EB 5D0EA 1FTCA 2XWXA 3IGVA 4PG8A 3MMBB 3IAS9 4JI2J 1RXOB 4K0KF 5L1KA 1SC6A 3T5LA 3MWBA 2J9CA 4FP9A 2QLBB 4EFAC 1YVFA 2QTWA 1RA6A 2OLWA 3FBFA 1TR0A 3S7RA 5HQ8A 5J1EB 3IRWP 3V6DA 4OX7A 3D54A 2HQFA 2RHQB 3K5PA 1P8GA 2W9AA 3LAMA 3T9NA 4JI8J 3H2VE 4USWA 1QSSA 3QIDA 5ETTA 4PEOA 5AJ3J 5EN1A 1N36J 2ZNYA 2E1RA 3OT9A 1RWOB 1WUUA 4PQAA 5DJBA 2O01C 2KH9A 4EBDA 1IBKJ 3HJFA 4LR9A 2BANA 3GP9A 4DOZA 4F3MA 2IM3A 2E1CA 1FESA 4WTOB 5LMNF 1S77D 3MTJA 1G6BA 4GKJF 3HT3A 4FNIA 1QTMA 1ZM3A 3H5YA 4K2JA 1HI0P 4ECYA 2IC3B 4Y2CA 1IBMJ 2XWYA 1LWCA 1W25A 4NLWA 5GADI 2MZ1A 4DV5J 3CDBA 1XN9A 4DFJA 2HYIB 2QFJA 4USUA 1SQFA 2OSRA 2V94A 4OHXA 5KT3A 4UT4A 1L3SA 3W5ZA 3TVYA 4F04B 3UCUP 5AJ3F 5B0CA 4ZPTR 3OTOJ 3W2WA 3MM7A 1MU2B 3T9ZA 3TVKA 1QE1A 5LOQA 2VQEF 3KK3B 5JVGQ 1N48A 4W90B 1FXRA 2IFXA 5D78A 1KQSR 5HATA 2UUAJ 3N79A 3M8QA 3QO9A 5AT1B 2APOA 5CCMA 4QW9A 4DV0F 5KFFA 1IXKA 2VFSA 4N76A 1IQTA 1NK5A 1VK8A 2AWZA 2WONB 4OI2A 4WP3A 2GV1A 4LF6J 3HHKA 4MFBA 4Y34A 2XLJA 4TU8A 2ZH4A 1FVSA 1WHVA 3MUTP 4DR6F 4XPEA 4NRTA 1SXLA 4B3MJ 3D0IE 4LRCA 1X4FA 4ECWA 4RW9B 4YUDA 3MUVP 3CWJA 4M5DB 2DHSA 3NWRA 1N5YB 3POTA 4YHHF 4GMKA 4DLGA 5A2QU 4Y2IA 2X1BA 2NSCA 4OX9J 2IHR1 2RNEA 4LF5F 2ZM6J 4USTA 5HO4A 1AW0A 2BMBA 2DHXA 2J9DE 3JXOA 2MQQA 1YK9A 5FJ4A 1REVA 1VLOA 1JLAA 1RU1A 2OPRA 1T9YA 2GVDB 4CTAA 4NCGA 3FCHA 1U1PA 1BQXA 3BGRB 1S59A 1RBOB 3MD3A 3T5JA 1U1QA 1X5TA 3M30B 3TAMB 3ZNUA 5LJ5Y 3QT8A 2MY8A 3D5MA 3FZBA 4WZMA 2VG6A 3BEGB 2C1EB 1MROA 4K5SA 2MGZA 3H5SA 2D41A 2C22A 3O8WA 4ZS6A 1N5YA 5E33A 2D3O1 1GMUA 2BJ7A 2F3JA 2BJ8A 3CT9A 2GCFA 4I56A 5SUHA 5J2NB 5E41A 2I2YA 3Q89A 4HDGA 4USVA 2VC0A 5KT6A 2HQ3A 3CEDA 4K50A 3E3XA 3MECA 3BO3A 2E7WA 2IM0A 5IM0A 1FDBA 1TKZB 5DZ6A 5DDOC 1HWLA 1Y5LB 1WHXA 4WFNQ 5AXKA 2P8IA 1WORA 3LP0A 1N36F 5HJXA 4QQBA 3MM7B 2CPDA 3EYZA 3CCUS 1NZ8A 2ROEA 5C42B 1XERA 2ZBIA 1HPZA 3H7HB 3MCSA 3C14B 1EP4A 2M5YA 4KHPF 2MSTA 4H4MB 1RT1A 2WRMA 4X62F 3FQLA 1S1VA 4HL9A 4OYMA 1VHFA 3ADAC 3DLKB 4ZJLA 2QEXS 1RTIA 3CC7S 2LLZA 1NXIA 4IFYA 1SV5B 3OHAA 4RO0A 2B0GA 1C1BB 2RQMA 2BEFA 4XTTA 4PUOB 1IR2A 4Q0BB 3T3FA 1RCOB 2PDAA 2R7WA 1T9TA 1RTHA 3HX9A 4KBIA 4WTYA 3TQEA 2QMXA 4ID8A 4KHMA 2BZ2A 4RW9A 2DRBA 5E3PA 1REGX 4G1PA 3I5CA 3CCLS 2JC1A 4TY8B 4DR2F 1SJ3P 1ZH5A 4FYDA 1UWBB 3OXGA 3KUHA 3CJRA 2K8GA 3HMJG 2GVDA 3NKYA 4CTAB 3MEDB 1W26A 2RU3A 3WC0A 3GILA 4O3PA 1MWZA 5HROB 3TWZA 3T1YJ 2ZWPA 4BWMA 3CCTA 4YR0A 3IBFB 4NLXA 4OZ5A 5K14A 3QLHB 2K3IA 2V4RA 4J9NA 4FDFA 3Q8RB 5FDLB 1S6QB 4DV3J 1HBOB 3MUMP 1Q8LA 2CWXA 4I2QA 4E8UA 4ECUA 3NS6A 1S9GA 3OR1B 1P9YA 2VFRA 4JI0F 2ZE2A 3CDWA 2VBZA 2IPOB 1NJXA 5KG7A 2V69A 4JOUA 1KFDA 2H65B 1I51B 5I3PA 2X51A 2GHPA 3EZUA 1B70B 2IC3A 4ID5A 2YPYA 5D4PA 1B7YB 2KO1A 3TYTA 2RQKA 4J9QA 2EK6A 2J6UA 2IVYA 4WK3A 3ILJA 4OYOA 2N7YA 4QJVA 4R0EA 5KFSA 3NGDA 2ATCB 4Y2MA 2F7VA 2B9WA 4DR7F 3SFUA 4IFVA 2BJ9A 4DPOA 1RAFB 1Q0NA 2E1MC 3H4BA 1S0MA 3KTQA 4OL8A 3J7ZT 2DNYA 2OD6A 1E6VB 4IOCQ 1X4AA 5IFMA 3DGPB 4WFXA 3A3OB 3VTIA 2OPQA 2KT3A 3OQ2A 2HWTA 1T9XA 2CDQA 4NRUA 4RU9A 4YR2A 4L76A 4C3KA 1JKHA 2RS2A 2YH1A 4L74A 2N3OA 2EWHA 2UXCJ 2JSXA 3D3CJ 2NYIA 2HIQA 1I3OB 3C6TA 2CWKA 3FNNA 1Y7PA 4LQ3A 3RBEA 4MH8A 3CD0A 2AJFE 2MQOA 1X31C 2PA3A 2ZJRQ 2JFDA 2PN6A 2IM2A 4HTJA 2HFVA 4DF8A 3EX7B 1S97A 1WC1A 3EUNA 3QGPA 1U6ZA 3EDRB 2CQBA 2Q43A 3ZTSA 1PJ6A 2L48A 2W4CA 3D28A 4DL0C 3O1LA 1V5VA 1VOMA 4NASA 1T9VA 1S1UA 4DI6A 4Z37A 1SKWA 4RX6A 3NOGA 3V5RA 1U0HA 4ZP7A 3DCAA 5J2PB 3NNCA 5G4DA 2FVCA 3I96A 4OZJA 4NX9A 1ZYQA 4FVCA 3UD3P 4K4XA 3AB2B 1N88A 2GMLA 1F9HA 4JI6F 5I4MA 4F4KA 5KAKA 1LXJA 1K0VA 2GJFA 1TV6A 4UOHA 3MPWA 3OJUA 5DGAA 1LQ9A 3WX8A 3BGOP 2MZQA 2AV5A 1WWHA 3MTKA 4C6AA 3BJYA 1FDNA 2QYGA 1RTIB 3GE9A 1HIYA 2JJ4D 4D3GA 2KM8C 1D9DA 3NGUA 4CLFA 4J7CA 3HLUA 1LNQA 3RW6A 4JI7F 4PXCA 1WF0A 5EUHA 2MTLA 1WHYA 1VQ9S 1TL1B 4F2SA 1OPIA 2RVJA 4LMZA 4WFYA 5AXMA 1IKWA 3M1VA 1GTEA 3GR0A 1SQGA 1TMJA 1UFLA 3PX6A 3H2LA 2IAJA 4L6V3 1DBDA 4U7UK 4HT7A 1Q81T 1J5EJ 3RYLA 3GIIA 2R8JA 2CNOB 3HD2A 3R97A 1EQMA 2Z58B 2MYFA 2QC3A 4NA1A 2MZTA 2NPIA 4Q2LA 4P2XA 2F63A 5DG9A 3R1HA 2VODA 1GK8A 1IM6A 3C19A 4FYWB 2H51B 1IR1A 3K89A 1N0VC 2KL8A 1AZSA 2HRUA 1S99A 5EX0A 1RAJA 2XSJB 3VGVA 1X4HA 1S6QA 3SXLA 3TA0A 1NPKA 1XK8A 2W01A 1RBLA 1GXTA 5CHCB 1VMBA 1UW9A 2Q79A 4ZPDA 5IQQA 4ZHRA 5BJRA 4X65F 1GEHA 2DHGA 2OELA 3DN9A 3PFOA 5CYQA 1FJGF 5AE2A 3QWPA 3P4UB 5HAOA 2BM0A 3VHQA 2HNZA 3CVKA 2AIRB 4IH5A 4LJMA 2ZDPA 2VU5A 3K17A 4ES3A 2MJNA 3MMCA 4ELTA 4CLZA 2G2YA 2J0WA 3PKYA 1X4DA 3NBPB 2YNIB 5H1SV 4FF4A 1KDNA 1H38A 1JLQB 3MM6B 2FJEB 3GYNA 2HURA 4CLPA 4KGXB 4A8WA 1UAWA 4J91A 4J9LA 1S5ZA 1VC6A 1NK9A 4E0DA 2DRDA 3OLAA 2Y3YA 5B08A 3ILIA 4GO7X 2ILYA 3BBBA 4RNHA 5LMUF 2OMLA 5E5NA 5KG0A 2GGPA 5F8NA 3W5XA 1CJTA 1IKYB 2RD5C 4HACB 3SDEA 1XMQF 4LF4J 2PI5A 2Y0BB 3TUJC 4RNMA 1NKCA 1FFSB 1IR0A 1RLDA 4LREA 3RG6A 1FD2A 1HQUA 1WTFA 4RPFA 1ZTWA 4M5KA 1WJ9A 1FDAA 2KHCA 3VQSA 1D8YA 5ETQA 1SJQA 4HVZA 1H74A 1MMNA 5JXSA 1A9NB 2QL7B 2CVEA 4QCLA 1JLEA 1RTZA 5A8KA 5HMYA 3MMAB 1W7WA 3W60A 2MKSA 2POKA 3BKUA 2JHEA 1K0TA 2UVRA 1A0OB 1NDCA 1UW4A 2BABA 2IRYA 2JX2A 2LQ8A 2VG6B 4U95A 5KTQA 2KKHA 1S0NA 2UU9J 3VAFA 4B9LA 2DHHA 4JYAJ 4HDHA 4LT6A 3GJSB 1JLFB 1MLAA 2RDIA 2V2ZA 3W9HA 2OTLS 5KFKA 2DIVA 3MAAA 2Z30B 4EO8A 2MPUA 2FVSA 3M4XA 1HWJA 4H4KC 1Z2ZA 2DH7A 3J7AN 4KJIA 3KK2B 1OSCA 4C8NA 4B3RF 1AT1B 2KT5A 2DH9A 3SQOP 2HHHJ 2HWHA 1FKOA 1UZDA 4L3KA 1EJ7L 5C5JA 4AQYJ 1UVIA 1OSDA 2NQPA 2GIQA 2MKJA 4OZ3A 4H4OA 5JUMA 3GJRB 3VQTA 2Z57B 1JXEA 3LP0B 4NWBA 1XR6A 2Z0GA 1CJVB 3CJ8A 1JJ4A 3IXQA 3BSCA 1NHVA 3AQPA 1RLCL 2VF3A 3DRRB 3TX8A 2CJXB 3IGNA 1NHKL 2HFZA 3EWGA 1KVIA 1FI4A 3DNCA 4YDDB 5I3UB 1PILA 2VPYB 1MNEA 3AHPA 2FIUA 3K59A 4TY9A 3KHHA 2JH3A 4KFBB 2IDLA 1ULRA 1N0UA 2Q1LA 4DV4J 2NREA 3L7OA 3CD6S 4C9DA 5F8LA 3FRZA 3EGZA 4DPYA 2DCLA 5K8MA 3KK3A 1XMOJ 1PJ5A 1R31A 1KSPA 4CCHA 2UV8G 4O23A 2X1FA 1OYEA 2D74B 2DNHA 5B0GA 4MT1A 4ZPBA 5CQGA 4GKKJ 2XLKA 1XWLA 2XY7A 3IMQJ 4OJHA 3DU6A 1RAEB 3SSSA 2OPRB 4NXNF 1LWCB 1WG5A 1K47A 2DGTA 3IBWA 4DCPB 1FWKA 1QUPA 1S9EB 2CQ0A 2HK3A 4A8MP 3DOMB 1S10A 4YB6A 2IA6A 3CMES 1HI8A 2DK2A 1TK0A 3QJJA 5A8KB 3D67A 1GH8A 1SV5A 1WOSA 2N4CA 3GZ7A 2R4FA 2HS0A 1RABB 3UCZP 3G71S 2M0GB 3CJQA 4ZKAA 1OMSA 3W66A 3DRSA 3SV3A 1RISA 2L3MA 1NAQA 3NCQA 1IWAA 3R27A 2J7WA 4ENOA 3GONA 4YOEA 4IKAA 4P2FA 4XPCA 4KKOA 3CCWA 5C42A 2VBYA 2C2MB 2VFVA 1FA0A 3MD1A 2D69A 3R3TA 4I6YA 4NLTA 2BW7A 5DG7A 2J76E 4RW7B 1DRZA 4GVBA 2FHJA 2EG1A 3M2RA 4V19J 1U25A 2HFSA 1K1QA 2KG1A 1BHNA 2RS8A 5F8HA 2ZZNA 4KFBA 2Z2ZA 3PW2A 3IN5A 1DQ9A 4LIWA 3GSDA 2DVIA 2VG5A 1QE1B 2PA8D 2RIJA 1X4BA 1Y4ZB 3B8HA 3PJXA 4OI0A 3W2WB 3DOKA 3KLIB 2DGSA 2DNLA 2HAFA 2BV3A 5B0FA 1VFJA 2BQ3A 2JL9A 2B43A 2AX0A 2LEAA 2XZDB 2E9ZA 3DXBA 1ZTTA 1FRIA 1KN6A 3P5BP 1JLGB 1OQ3A 1YRUA 1H7XA 2YKNA 3BN4A 2AEJA 2WBMA 2ASDA 2ZH1A 3FFIA 1E6YB 3PYEA 2VH7A 2EFPA 3VAMA 1B64A 3H40A 4N8NA 4EGLA 1D1UA 3A8IA 3LP1A 2FJXA 4LF2A 1NRKA 1S1TA 3D6MB 3BGUA 4EK2A 2CJ9A 2AJ2A 2OEJA 3G87A 4F4WA 1BXNA 1HNIA 3GFHA 3RB3A 3MM5A 3TW0A 3NGKA 2NPFA 3UO0A 4LSNB 1ZAVA 2RILA 3RZAA 3NS5A 3PZPA 4AE5A 2DR5A 2PE8A 4M5HA 5G0RA 2LP4A 5CYQB 1FJEB 4Z2XA 3NP5A 3VGSA 5CD4A 4UF4A 4C4WA 3K2YA 3VAJA 1DLOA 4URGA 3EGWB 1ACMB 4C11B 2R7QA 1HQEB 1LEOA 3T41A 4PYAA 4NPOA 1KP6A 2GZOA 3IR5B 5J2PA 4DZ6A 1NHUA 1JB0C 3HF5A 5D3GA 4ZCLA 2YX4A 1AFJA 1IKWB 3M1VB 1JLCB 4TKTA 4ECSA 4TYAA 2HGMA 2JEGA 1X5SA 3EVMA 5G0RB 3JTNA 4KGZB 4ECRA 1XJWB 1WC5A 2BKNA 2LU1A 4OZ2A 2V67A 3QQCD 4J9UE 5L9XA 2R8GA 1LWFA 4GVLA 3PRDA 1SL2A 1IKYA 1HARA 4HACA 2XC9A 3BO2A 3NLCA 1FRLA 2KFZA 4QIWD 3I87A 1VBKA 3LW5C 3JTOA 1C4CA 1V3SA 4F67A 1PC4A 4CP5A 2UUTA 4MJKA 4J9KA 1Y3KA 3W63A 1UA1A 3OVAA 4Y28C 1VRTB 1JLGA 2YKNB 1CC7A 4LBHA 4I1TA 4ED7A 1HNZJ 3CMQA 5F8JA 3OJSA 3C16B 1S1XA 4F26A 4LFBJ 4IH7A 2PEHA 1C0UB 3RRGA 2GFFA 1T11A 5IZHA 3KG1A 4R5PA 3ZXWA 3LANA 2YWHA 1U24A 3RAMA 5K20B 1Y00A 1VGYA 2KVIA 3MAHA 3ZO7A 3D7SB 5DDRC 2RB7A 2AYMA 1KKHA 4DQIA 2DR6A 3HZGA 4DV4F 2ZBPA 1BC6A 3ET6A 2MKIA 1RK8A 1BQNB 1CJKA 4L73A 1NLKL 3AODA 2J0QD 4FF3A 4I2PA 1TUWA 1NKEA 1N34J 4Z7CA 4ZVQB 3D0GE 1FXLA 1KS2A 2EEYA 4ED3A 2U2FA 2V68A 2VG7A 1XMQJ 2ALYB 2ZBQA 1EAYC 2J0SD 2NXUA 1GFWB 2CQHA 3JS9A 3QFHA 3BPSP 5KFRA 2B7BB 4IO9Q 2HAIA 4UOFA 3FEZA 4P2SA 3KK1A 4Y65A 3Q8VA 1H0HB 4ZPAA 4FYVB 1H72C 5ETRA 3JSBA 3BYRA 2MLYA 5AXNA 4F3OA 1T3OA 3W1YC 2CJQA 2G2ZA 4GRSA 4DU8A 3LAKA 5KFWA 4PRFA 4LVNP 2CJAA 4HHJA 4KQZA 3SQGB 2V9WA 3U1NA 5KFYA 4A4JA 3TANA 4QYZJ 1P9QC 5K8PA 4O0NA 1N6QB 1R27B 1BWEA 2ZHOA 2FD2A 4USKA 2JLFA 1KQFB 1Q95G 5KT7A 3T1HJ 3NGSA 1KVJA 2ZWOA 3IS9B 2YWWA 3DHXA 4P2MA 2I0XA 2CIMA 2HNDB 1B0TA 2H48B 2DNKA 3PEHA 4JYAF 1LV5A 1R6YA 2LA6A 5HL7Q 5KFAA 4O44A 1H7WA 3IG1A 3IO1A 4ZVEA 2YPZA 1N34F 1KLNA 3P49B 3TUPA 1RHKB 4I0WA 2P2CB 4RUAA 3BSOA 1VRTA 3VV2B 1KHWA 3QBCA 4ALZA 5LXYA 4DV7F 1TV6B 2M52A 2ZKUA 2XNRA 4W98A 3SSQA 5LXRA 2HBZB 1S1VB 3P6YC 1JK9B 1NJYA 2HWIA 3AD7C 3FEXB 2CKWA 4KHRA 2QMWA 1CC8A 4OZLA 5DQGA 4ELVA 4OZNA 1NPRA 1FEEA 3E8OA 1XIQA 4ED1A 2RMLA 5HANA 1VQOS 2FY1A 1KLMA 4JV2A 4ZVSB 1KQKA 4UQTA 4X4UA 2ZH8A 3HXMA 2DO4A 3MPYA 2F1FA 2F9DA 1RAHB 4QWDA 1YBUA 4RUBA 3CJSA 1HBUB 4A8YA 1JLCA 1V3RA 1N5SA 2WW8A 4KHPJ 4DR7J 2P9CA 3FQKA 4LSLA 3I0RA 2G9OA 5LMUJ 3DMJB 5KG2A 1AA1B 5SZTA 3RR7A 3MEDA 3ZZZA 3KLGB 2R3VA 3TQ1A 3TOQA 2EPIA 3IR7B 1YI2S 2SXLA 2FVQA 3K5LA 2PGCA 3LWMA 2ZEJA 3T1AA 8ATCB 1C1BA 3HDSA 1UJ5A 1DLOB 4IR9A 5D4LA 2MQPA 4NCBA 1TAUA 2LEBA 3DDIA 1VIOA 1T7PA 2I5JA 3D2WA 3LALA 5IOLA 2WK4A 1YX2A 2QN6B 3CJ4A 2JVRA 1D0EA 1F0XA 1Q7LB 3HSGA 4MIAA 4ZP6A 3UE2A 3VVTA 2CPFA 2FHJD 2L9WA 4UZCA 2PEBA 2R7XA 4I67A 3MR6A 2C2ZB 1O0PA 3ITHA 4HHUA 2KVQE 3FMWA 2DD8S 4QWBA 2KFYA 3MM8B 4DS5A 2Z4PA 1L3KA 2ABYA 5T14A 1EP4B 2XQCA 2NR0A 4X65J 1ZA2B 2YH0A 1Q79A 2XCAA 1OPZA 2ZD1B 4X4PA 1KWMA 2ZD1A 1BUXA 5HBMA 1YJ9S 4OJ3A 5A0YA 5HMXA 4DUYJ 4M5JA 1E6YA 3SI8A 2ZVIA 1YGYA 2RUSA 3H2UB 1MU2A 2IMWP 3MURP 2W2NP 4DR2J 2ZJPQ 4LF8F 3AD8C 3ULHA 3I5BA 4HR2A 1SPBP 2XY6A 1IM4A 2P9GA 1C1CA 3CJ0A 2ZE2B 2PFFB 3HSDA 4KV8B 4EUVA 1F1BB 1N4LA 4M5GA 1MROB 1R8HA 2XM3A 2XCPA 2HS3A 3OTEA 5GVQA 4PZVA 3FSIA 1JXLA 1KR4A 4B9TA 3CJKA 1BQMA 4KY3A 3F73A 4DEZA 3J7Z5 3LA0A 2LXUA 2DH8A 2WCXA 2CQCA 4FXVA 5HP1B 2VPXB 2CQ4A 2MLXA 1DURA 4MYUA 4Q2MA 2H5JB 2KDOA 4X84A 3ZZOA 4X4QA 4LF6F 5IC6B 2VPZB 3FCWA 1OQ6A 2FLOA 4DN9A 2I8EA 3GWCA 4O3SA 2DNNA 1Q8IA 3PR5B 2FGCA 4EYHB 1K1SA 3EZ5A 4QBUA 2YWGA 2XEXA 4UUXA 4DL5A 1TMMA 2X1GA 4M8LA 1SB6A 1B4SA 1VBYA 3PHEA 4NE9C 2Z2LA 5F8MA 3M8WA 4MKAA 5D15A 2F4VJ 5GMDA 3HD1A 2LYVA 5IWAF 3QPIA 4BC9A 4WFAQ 3U02A 3DKDA 4IDKB 4G3IA 4DPXA 4QIFA 4B3TJ 2KXHA 3KG4A 2VG5B 2DGWA 1RAOA 1D09B 4QWEA 4DL7A 1DY3A 4NLSA 4V1Ak 5BYQA 4DXLA 6FD1A 5LT5A 4USHA 4ED8A 1Q86T 2MB0B 3IFEA 2IJNA 3L9ZA 4FNHA 3VGUA 5M2UA 2MXYA 4MK8A 2A6MA 5A0YB 5LJ3Y 4Q7AA 4O3QA 2Z2YB 3OTDA 3N9UC 2GGPB 1B3TA 2UU9F 5IM0B 3K58A 3SV4A 3PRBA 1Z2LA 1KTQA 2CJYB 2JEIA 5J1PA 1CS4A 2ASLA 1RHJB 3D9BA 1PC5A 3MR7A 3RJMB 3Q23A 1TL3B 3OBIA 2ZZMA 2VOPA 1SC4B 3T1HF 1FRMA 3C15B 4X4OA 4W4MA 4DQQA 3PX0A 4JI1J 1ELOA 2IVFB 2AP6A 1MW7A 2H9ZA 4KPCA 2M70A 4Q5VA 2FZKB 4M5LA 4XO0A 1FCAA 1FKAF 4C2MA 2LDIA 2XZWA 1T8EA 2BJEA 1G3OA 2HKEA 1JLEB 4OI6A 5KFHA 3N4WA 1J27A 1TL7B 1HBMB 5HVFA 4QIEA 1T94A 1CVJA 1BQNA 3UNGC 2BE2B 1T0TV 2VKRA 3CB4A 4RLEA 4A8FA 4LUBA 2HHWA 1P6TA 2QL5B 3DLHA 3NWGA 4PG7A 3M2VB 3RW7A 2HFNA 3N5BA 4ZPCA 3PXGa 2H1YA 4RNNA 1TKXA 3SFGA 5KFLA 2YQ1A 3QGGA 1YRTA 4KB7A 2A2DA 1H2TZ 4RJVA 1CJUB 2OIHA 1IBMF 3UI3A 2GQCA 1PAEX 2MEWA 2W24A 3H90A 4WWSA 2B4VA 4QR0A 2ZH7A 2BX6A 1HR0J 4OYWA 2B6AB 3NAHA 4O3NA 1OJ4A 3IAM9 2HHSA 3THTA 3MMBA 1N5VA 3A4TA 1F5BA 1RWWB 5BYRA 5LMNJ 1QAIA 1HNWJ 3W9JA 2E9TA 2HS4A 2MQMA 3QO9B 4HEA9 1HBNB 2K2PA 1NU4A 3DXSX 3FCVA 2WHOA 1OY8A 4K4SA 4RKUC 1WI8A 2BJ1A 1U8SA 4TXSA 3KJVB 2CPXA 4DF4A 4X4NA 1HNVB 1LOUA 2DGQA 3CO9A 2RHSB 4LBPA 3AJ1A 4Y3CA 1OO0B 1R8BA 2NXCA 2FTRA 2RDDA 2UXBF 2HBRB 1WC4A 2P6TA 4KE5A 2DBBA 4MKBA 3PYDA 3CMAS 2HMIB 3R7BB 3HP6A 4FS2A 3CSKA 1IBLJ 1SJRA 3SQGA 1PG5B 3UQSA 1G7CB 1FD8A 2FQQB 4TLQA 4K4TA 2L41A 1HNZF 2HZVA 2B7CB 4JI2F 2EKNA 5EWGA 1DQAA 3UDEA 5JMNA 4WJBA 1RT7B 3C6UA 3U27A 5DGBA 2EK1A 3I32A 2E5LJ 2O66A 2DGXA 1S1UB 3N01A 3E2EA 1HWKA 1R89A 1RHQB 3H20A 1U8WA 2XSFA 3W7BA 1WHWA 1MWYA 4Q44A 2CDRB 2K1RB 2ZH3A 3EJMA 1U1MA 4B3SF 3HO1A 2JVOA 2WBRA 1KBRA 1FX4A 4JBCA 5GAHU 4DUZF 4DV0J 1FT8A 4DR3F 2ZZTA 4DR5J 2KHDA 1Y0HA 5CYJA 1KRPA 2Y0SD 3UNYA 3M6VA 5LSOA 3M8RA 1KTVA 1PO6A 3Q24A 3DDKA 2E1AA 1QD1A 2VQEJ 3LF0A 4DLEA 3LGNA 2QX0A 1TELA 4X64F 1T03B 2VD3A 2B4OA 4DX8H 1X4EA 2DITA 3K57A 1VQ8S 3MM9A 3B54A 2V8HA 3GIRA 5CYMA 1BY9A 5DQIA 3HHLC 4LFAJ 1YIJS 1LXNA 2VPWB 2QT7A 4CLUA 4DV5F 1FWPA 2HGLA 2XMKA 4V19X 3TRGA 2C3UA 4L3NA 4KIAA 4LSNA 2ZH6A 1WSRA 4GKJJ 1EQ0A 3MM5B 2CPEA 3DOKB 2YTCA 3KLIA 4J9PA 1XC9A 5D0GA 5HLFB 1YSJA 2DNGA 3CGIA 4H4MA 3Q22A 1WF1A 3KNAA 2XMUA 1IUJA 3OL9A 2CZVC 1HMVA 1PAUB 3FRYA 2XGPA 2MZJA 3HPOA 3AQOA 2QE5A 3CCJS 2XS2A 1DHMA 4ERDA 3ZTRA 4ID5B 3AJDA 5RUBA 2JZ5A 1B0PA 1IKVB 3GYGA 4O4GB 4P73A 1NM2A 1CQNA 3RUBL 3PACA 3EICA 3VAGA 1RGVA 1W2IA 2CYYA 4KC5A 4DX7A 1FX2A 1H3DA 3A8EA 3FMBA 2XNQA 3R5CA 3QRPA 4RW4A 3TEGA 1V3ZA 1RE1B 4JI7J 1VQ6S 3GV8B 3M32B 5L38A 1X4CA 3VALA 2NXEA 2YNHA 3MR3A 5K14B 3BYPA 3QSYB 2UUCJ 1B7FA 1Y11A 4NLQA 3I9V9 1M5HA 1RACB 2K7JA 3LGHA 4ZJQA 4C3MA 5KFDA 3RTVA 2K7KA 4KPYA 3EPGA 3G9CA 3CD5A 4RWWA 2FC9A 4C0OC 5K8OA 1JIHA 3H98A 3R6LB 3UW1A 5LSLA 3RAXA 3N6NA 1RTDB 1S6PB 2RKIB 3DOLB 1GX6A 2OUGA 4KSEB 2BR0A 2HVHA 4P71A 4ES2A 3M9NB 2HHQA 2E5IA 3C16A 2OEMA 4ANDA 2GC8A 3JAMU 1R0BG 5F3TA 3DOMA 3HHLD 2BBEA 2EXUA 1YZ7A 3J81Y 1HR0F 3EXYA 4YDXA 5J2QA 1NK6A 3WBZA 4Y00A 1UKUA 1AROP 1SKUB 1LW2B 1X5OA 3P96A 3QAUA 3PW5A 2HMIA 1XNQJ 1RWXB 1VJQA 2R7SA 2HFUA 1IKXA 3CJ5A 5B0BA 3K7RA 2AW0A 4HH0A 1NJIT 4LFCF 4ZLLA 1F3FA 1KQGB 1T9UA 4IRDA 2W1BA 1ZPVA 1B99A 3MFHA 1XEZA 2LEPA 3B82A 4F0KA 5CAAA 2GNKA 2M4MA 9RUBA 4KO0A 1VRUB 3R5BA 4QWCA 4CO1A 4LR7A 1FVQA 4USJC 4CT8A 1VRUA 4F4ZA 2D1CA 2CPIA 3GCXP 1SJ4P 3NEKA 4TLRA 2IJFA 4FYXB 1YITS 4DR6J 3OTBA 4WBFA 5HROA 5IT0A 2XZTB 2NUUG 3H59A 2V34A 3IM9A 4AL6A 2FJWA 4K4UA 4ZDNA 4WK1A 1RAAB 3PNIA 2KJWA 3EVOA 5A2QY 1LFWA 3KLFA 5ETLA 4BCAA 1JX4A 3OVBA 3IR6B 2J5AA 2CQGA 1N8RT 2OPSA 2NSBA 2FY8A 2XMWA 1LK7A 1ZS6A 4HI1A 3W65A 1HFEL 4C8YA 1VQPS 4X62J 4WF9Q 4H54A 1F5CA 1OY6A 4JI1F 2F8EX 4OV6A 2HQIA 2EBEA 1F2HA 1XMBA 1ZA1B 2BE9B 4ZVHA 3VWSA 1S57A 3TR5A 3MF5A 3MMAA 3QT7A 4RNOA 4B3OA 2XMMA 3HVAA 1EKSA 4TQRA 3GPAA 3M9OB 3K5MA 5KFGA 2DXEA 3OXLA 1J5OB 1EIYB 3OFEA 3LP2A 3FC9A 2QJ3A 4DDFA 1RU2A 4X4SA 2RT3A 1UZHA 5FIIA 1AB8A 4NYOA 4ANEA 1NMEB 3R5DA 2VDIA 4G1QB 4NLVA 3MAQA 4UZBA 3HHNB 2DPIA 2IDEA 5B09A 4AL5A 2I1RA 4DV3F 1M5OC 1CULA 4C7QA 1ZOTA 4ILMA 1YBTA 4LR8A 2CUYA 3D4JA 2AF6A 1VS3A 4CH0S 1RTJB 4OHVA 3ZTOA 1ZPWX 2LDYA 2GW8A 5IXUA 4WU3A 1VBXA 1Y10A 2AJ1A 3DLKA 3SCKE 3MMJA 2JDJA 2K3KA 3RBZA 5L1JA 3MEEB 3MI7X 3BQ1A 2BXJA 2CQPA 5DM6Q 3T6JA 4LF9J 1SIWB 2KN4A 3WZ0A 2DPJA 2WVCA 1N56A 2G4BA 4TU9A 3ETMA 3JQMA 4OLPA 5EWFA 1Q82T 2QV6A 2B3TB 3GFXA 3GLJA 5ADZA 3AAWB 2F9JA 1K9MT 1X7VA 1FKOB 2F8MA 4KH1B 2A1BA 2DISA 3BGRA 3KUGA 3RR8A 2C3PA 2CADA 1HKAA 4OLOA 3V6JA 1MSWD 2B5JB 2QFIA 1RHUB 1S6OA 5HP1A 1HW9A 2HEKA 2XI3A 4ZHRB 4RNFA 1JLFA 4WFBQ 2DNZA 4R8UB 3HFZB 3PO4A 4DSFA 4M5DA 1CQMA 2V8GA 2L9DA 3MM9B 2R2SA 1WG1A 1RT1B 3ZNJ1 1YJUA 2B56A 1M5VC 1VQ4S 4IQXA 4CLSA 3WIVA 4NLDA 3BPDA 5LL6d 4FKYA 1YJRA 4WIIA 2MSSA 5KT5A 4IYQA 1S79A 3N6MA 3QT6A 4NOHA 2J6TA 2BACA 4K8RA 2UXDF 1R0AB 5CZVA 2VFUA 3TUZC 4MTPA 2UP1A 5E3QA 5J1EA 2Y1RI 3V6DB 2UVVA 3P45B 2JNJA 2E5JA 2DB1A 6FDRA 1FRHA 2LQ9A 2E44A 4ZVPB 3TUIC 4RW4B 5U47A 1SC1B 3ZZTA 2J8SA 2R7RA 2HQCA 2QLXA 1ZAXA 3BR9A 3SYZA 1TQLA 1C0UA 2OO4A 1IBKF 2J9DA 2BJDA 2NUHA 2UZAA 4O4GA 5T7LB 3RGIA 1D9AA 3Q8UA 4E2FB 4NEZA 4CIOA 3Q8PB 5DLFA 2RF2B 1VQ7S 1YJWS 2M8DB 1VQNS 1V9OA 5M2RA 2EFQA 3W3SA 1GX5A 4H4OB 3E01B 4ES1A 3HULA 2IBKA 4DR4F 1JLQA 3ENWA 3MM6A 3TAMA 3Q2TC 6AT1B 5FLXY 2HNYB 5I3QA 3SSRA 5GAEU 2E5LF 1FE0A 2V0NA 2DNOA 2UV8A 4K4YA 1VLYA 3NMRA 2HVIA 1GQEA 4DL2A 1UVJA 3DOLA 2W9BB 1REVB 4NA2A 3DMJA 5KFJA 1IJFB 3PG9A 5AXLA 3SZ2A 1TFYA 1ZM2A 2CXEA 3GG1A 1NK4A 2C3MA 2BOPA 2AHOB 3HCXA 4K0KJ 4MIBA 2FJVA 5D8HB 4RW6B 4MKVA 2LKZA 3KKFA 3U1MA 3P8BB 3MZIA 3SCIE 4QPXA 4GC7A 3KLEB 2E1PA 1X0FA 3IM8A 3CXCR 1FJ7A 4NI2B 1UVLA 3KLHA 2HHVA 4WXWA 2FHMA 4QPTA 2ZJQQ 2C28A 4ECQA 1RT2A 2FJBB 1EETB 1RZMA 1SVDA 3D3BJ 1WD6A 3NCPA 4OHWA 1BLUA 5E7OB 5GADU 2ROPA 4WKRA 2H4YB 3L7UA 1H73A
chains in the Genus database with same CATH topology
4LF6J 4LFAJ 4V1Ak 4B3MJ 4LF4J 4GKJJ 4JI5J 3J81U 4YY3J 5A2QU 4DUZJ 2UXCJ 3D3CJ 4LF7J 4OX9J 4JI6J 2ZM6J 5FLXU 4JI0J 4LF9J 4JI1J 4DR3J 3R2DJ 5IT9U 2UUBJ 2UU9J 4JYAJ 4KHPJ 1HNXJ 4X64J 4DR7J 5LMUJ 4JI7J 4JI3J 1FJGJ 4DR1J 3J7AN 4LF5J 2HHHJ 2UUCJ 1XNRJ 4AQYJ 4DR4J 4DV7J 4YHHJ 2UXBJ 4RJVA 1I94J 2MEWA 4HHUA 1HR0J 2KVQE 4NEYA 4JI2J 3JAMU 1HNWJ 5LMNJ 4X65J 4KYZA 2MTLA 1N33J 4DUYJ 4DV4J 1N32J 2UXDJ 1HNZJ 1XNQJ 4DR2J 1XMOJ 4LFBJ 4JI8J 1J5EJ 4JV5J 5LM7E 5AJ3J 4B3SJ 4GKKJ 1N36J 4DV6J 4NEZA 3IMQJ 2KL8A 5IWAJ 3J80U 3R2CJ 1IBKJ 1IBLJ 4KY3A 5BR8J 4JI4J 4DR6J 3T1YJ 4B3RJ 4X66J 1N34J 4DV1J 4DV2J 1IBMJ 2E5LJ 4DV3J 4DV5J 1XMQJ 4K0KJ 4X62J 3OTOJ 2VQFJ 4DR5J 2F4VJ 4DV0J 3W1YC 4PWWA 4NXNJ 2UUAJ 3D3BJ 2MQ8A 2VQEJ 4LFCJ 4B3TJ 3T1HJ 4LF8J 4NXMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 J;  4LFA J;  4V1A k;  4B3M J;  4LF4 J;  4GKJ J;  4JI5 J;  3J81 U;  4YY3 J;  5A2Q U;  4DUZ J;  2UXC J;  3D3C J;  4LF7 J;  4OX9 J;  4JI6 J;  2ZM6 J;  5FLX U;  4JI0 J;  4LF9 J;  4JI1 J;  4DR3 J;  3R2D J;  5IT9 U;  2UUB J;  2UU9 J;  4JYA J;  4KHP J;  1HNX J;  4X64 J;  4DR7 J;  5LMU J;  4JI7 J;  4JI3 J;  1FJG J;  4DR1 J;  3J7A N;  4LF5 J;  2HHH J;  2UUC J;  1XNR J;  4AQY J;  4DR4 J;  4DV7 J;  4YHH J;  2UXB J;  4RJV A;  1I94 J;  2MEW A;  4HHU A;  1HR0 J;  2KVQ E;  4NEY A;  4JI2 J;  3JAM U;  1HNW J;  5LMN J;  4X65 J;  4KYZ A;  2MTL A;  1N33 J;  4DUY J;  4DV4 J;  1N32 J;  2UXD J;  1HNZ J;  1XNQ J;  4DR2 J;  1XMO J;  4LFB J;  4JI8 J;  1J5E J;  4JV5 J;  5LM7 E;  5AJ3 J;  4B3S J;  4GKK J;  1N36 J;  4DV6 J;  4NEZ A;  3IMQ J;  2KL8 A;  5IWA J;  3J80 U;  3R2C J;  1IBK J;  1IBL J;  4KY3 A;  5BR8 J;  4JI4 J;  4DR6 J;  3T1Y J;  4B3R J;  4X66 J;  1N34 J;  4DV1 J;  4DV2 J;  1IBM J;  2E5L J;  4DV3 J;  4DV5 J;  1XMQ J;  4K0K J;  4X62 J;  3OTO J;  2VQF J;  4DR5 J;  2F4V J;  4DV0 J;  3W1Y C;  4PWW A;  4NXN J;  2UUA J;  3D3B J;  2MQ8 A;  2VQE J;  4LFC J;  4B3T J;  3T1H J;  4LF8 J;  4NXM J; 
#chains in the Genus database with same CATH topology
 2JLG A;  4X4R A;  2GS8 A;  2I9S A;  3AFG A;  3MR5 A;  2BQR A;  1IKV A;  5A6W A;  3AY0 A;  4PXB A;  4J9R A;  3RAQ A;  3ZTQ A;  2XS5 A;  1AUD A;  4ZPW R;  1UPM B;  2BE2 A;  2HVD A;  1HL6 A;  4LRB A;  2GAG C;  1HD1 A;  1QVG R;  1Y5N B;  1OIA A;  4DL4 A;  3GJT B;  4IFV B;  3IRX B;  4G65 A;  3KNG A;  3N5F A;  4ZLP A;  1M90 T;  1P27 B;  2Z2M A;  3K8W A;  1M1H A;  2VAS A;  4DUZ J;  5HLF A;  3FKB A;  3OL7 A;  4WFZ A;  5DLG A;  2MKC A;  1NUE A;  3FFI B;  5IC4 B;  2ASJ A;  3FK4 A;  1WF2 A;  1NSA A;  4EO6 A;  3QZ7 A;  2PI4 A;  3QRQ A;  2OPQ B;  3BR8 A;  1RT3 A;  1C0T A;  1LWE B;  3JYT A;  2VQF F;  2UXC F;  1DAR A;  2VBW A;  3DM2 B;  1C0T B;  1LWE A;  2GO8 A;  2LMI A;  3HT0 A;  1NSQ A;  3MCM A;  5T41 A;  4JI8 F;  2HBY B;  2UUC F;  2BAN B;  1SKS A;  2W2O P;  1TL3 A;  2DXF A;  2IRX A;  2C2D A;  1FER A;  1FFW B;  5C2C A;  2CJB A;  1RTD A;  2A3J A;  5D4N A;  2X1A A;  1WNE A;  4K4Z A;  4EBE A;  3B6B A;  3BB5 A;  3F56 A;  4QU7 A;  1QAJ A;  3Q83 A;  3NMA A;  3FDS A;  1GMV A;  1RHM B;  1YBA A;  2ZOF A;  1UET A;  4I2P B;  3ZTP A;  4YME A;  2W7O A;  4ED2 A;  4LF9 F;  2KZZ A;  2LQJ A;  2XG8 A;  4ZN3 A;  1NEE A;  2YNG A;  2YNH B;  4ZA1 A;  3PV8 A;  2B6A A;  4DR4 J;  4IOB A;  2GO9 A;  2XO6 A;  2WSC C;  2YKO A;  2Y1J A;  3WC2 A;  2YXL A;  3P3D A;  5ETV A;  3KK1 B;  3DRS B;  2HK2 A;  2HHT A;  4F50 A;  4WE1 A;  2X3G A;  2A18 A;  4QYR A;  1FRK A;  1YTY A;  1HHQ A;  1X8D A;  3G86 A;  4F7V A;  4ZVF A;  4M1K A;  3V2U C;  1SH2 A;  1YDL A;  3CO0 P;  4ZJO A;  3S1T A;  3GG0 A;  4Y6I A;  1JJH A;  4ZP8 A;  3S6E A;  3M2V A;  1K73 T;  2Y8Y A;  1S12 A;  2BJ3 A;  2DGV A;  2FUG 9;  3M8P A;  3Q0A A;  2H5E A;  3KHR A;  1AYE A;  4ZCI A;  4X66 F;  3A8K A;  1DTQ B;  5IV3 A;  5K8N A;  2CPJ A;  4J9O A;  4DQR A;  4NLY A;  1N32 J;  5KFT A;  4RBU A;  3HHD A;  2UXD J;  3X3U A;  3T1Y F;  4BWJ A;  1SKR A;  2NLW A;  1LKZ A;  1U7L A;  3QMQ A;  1L3T A;  3Q86 A;  4ETX A;  1XTZ A;  4X4T A;  1JNZ B;  4IG3 A;  4DL3 A;  4JV5 J;  3VCD A;  3UDL A;  3J81 j;  4LRF A;  1HA1 A;  2AGP A;  2GMJ A;  2PFD A;  3KJV A;  1VC5 A;  3KOA A;  2KYX A;  2QYC A;  3D66 A;  4AT1 B;  2W9C B;  1FNX H;  1HHS A;  1SH0 A;  3H4D A;  2YQ3 A;  2FVP A;  1FK9 B;  2CPZ A;  3R2C J;  3ITH B;  1SQE A;  2R8H A;  4ZP9 A;  2XYG B;  2UXB J;  2N3L A;  3EMT A;  4I68 A;  2B4P A;  3UD5 A;  5A8W A;  1G2E A;  3CJ2 A;  1TKT B;  4QZV B;  3H25 A;  3FZ2 A;  2JWN A;  4K7Q A;  1RI7 A;  3RRH A;  4I7F A;  3PY8 A;  3HI9 A;  4URQ U;  1YZ6 A;  3IRX A;  4NI2 A;  4CO0 A;  3J7Y U;  2MGZ B;  2E5H A;  2VOO A;  2YX1 A;  3NS7 B;  1BMQ B;  1NH8 A;  1HBO A;  2GVZ A;  1CUL B;  1PBA A;  1S1W B;  4FXD A;  4U8V A;  4MK9 A;  2VQF J;  4FXW A;  4KKO B;  3TI0 A;  3OR2 B;  2U1A A;  2CAJ A;  2VUG A;  1V5I B;  2FHO B;  2QA2 A;  3D6F B;  4Q45 A;  1WOO A;  1YLX A;  4PWW A;  4RR5 A;  2ADC A;  2PC6 A;  4GC6 A;  3UN3 A;  1TL7 A;  3DLG A;  1TK8 A;  4IDK A;  4LRA A;  1RCX B;  2CNN B;  1VQY A;  4A48 A;  4KAI A;  4CQ1 A;  4CO5 A;  3R6G B;  4IR1 A;  4ECX A;  1DFD A;  2VBX A;  3VAH A;  5A8R A;  2N7C A;  1GMW A;  1M5S A;  1RT6 B;  2HBQ B;  2YNF A;  2NXJ A;  2JRS A;  4CM2 A;  1L5U A;  3QAT A;  2ZBR A;  3M8Y A;  3LWL A;  2XY5 A;  4KV8 A;  3DRP A;  3V4I B;  2V8V A;  1E6V A;  2DY9 A;  1WKL A;  1YJN S;  4NCG B;  2MMY A;  1UP1 A;  1UEK A;  3C2P A;  1QTN B;  1JLA B;  3EVW A;  3PM9 A;  4LIR A;  3HZE A;  3TZY A;  2EFG A;  2ILZ A;  3J81 U;  3FBE A;  2F4V F;  2E29 A;  2BA9 A;  5KT4 A;  5D6G A;  4ELU A;  2QSW A;  2HNY A;  4R25 A;  4FVM A;  3UR0 A;  1HBN A;  4KGK A;  3NRB A;  1NB2 A;  3GU0 A;  2GX8 A;  4ECT A;  1G1X A;  4DR3 J;  3PJ9 A;  3UWT A;  1R6V A;  2Y1I A;  2FVR A;  1HYS B;  5I3U A;  3CW2 C;  2WVD A;  3T5K A;  2EFV A;  3RBD A;  3RB4 A;  2DT9 A;  4FPI A;  1VQK S;  4D3H A;  1WTB A;  2Q66 A;  4HH1 A;  2DCU B;  4PPD A;  5GAG I;  1CJU A;  3MEC B;  2OFH X;  3A1Y G;  3QIP A;  3LPE A;  4OIX A;  3W2V A;  1RT4 B;  4AD6 A;  2ZIT A;  4B3M F;  3M7V A;  2DY1 A;  3MOZ A;  3R8Y A;  3PW4 A;  2NCK L;  3L7P A;  1VBZ A;  2PO4 A;  2MHN A;  2CQ1 A;  3LOU A;  3U7J A;  3ELH A;  1GXU A;  3QLH A;  3TEH B;  3IG1 B;  3V6H A;  4YP3 A;  2CNK B;  2BE7 D;  3MM8 A;  1S6P A;  1R0C B;  4UOG A;  2OKQ A;  2AJ4 A;  3MAA B;  3I0R B;  3PIO Q;  1O5J A;  1B0V A;  4F0M A;  2MQN A;  4WKY A;  2YKP A;  4C3L A;  2LCW A;  2BQU A;  4USI A;  4ECZ A;  1UJ6 A;  3DRP B;  4U96 A;  3V4I A;  2UVU A;  1KNZ A;  2RDJ A;  3SBM A;  5F9L A;  2G1H A;  1JNR B;  3CIZ A;  2DNR A;  5J1N A;  2QLW A;  1OS5 A;  2XMT A;  1FDD A;  1CLF A;  4JB8 B;  3CJ3 A;  1TVR B;  2V6A A;  4OYI A;  3POT B;  2MHE A;  2FGO A;  1TU0 B;  3GB0 A;  3QFW A;  4OX8 A;  4PPZ A;  2DGO A;  3AB4 B;  3OFG A;  1RKJ A;  2ZOM A;  4DV2 F;  3TAQ A;  3G96 A;  4EWT A;  5DET A;  3ISZ A;  1Y9O A;  1NPP A;  4LSL B;  2OEK A;  2WVE A;  3AT1 B;  2IVM A;  3MOJ B;  2W2P P;  5EGY A;  1QAY A;  4MFB B;  3G82 A;  3KJN B;  3ENA A;  3NCR A;  4OJ1 A;  2AJ0 A;  1IN0 A;  2DEI A;  1RWK B;  4EEY A;  4O44 B;  1VQM S;  4B3S J;  2HHH F;  1TUV A;  4WYL A;  2NZ4 A;  3TX0 A;  4ZIV A;  2WSF C;  5IWA J;  1NH7 A;  3SCJ E;  2E5G A;  2HRT A;  1Q8K A;  4G1Q A;  3W62 A;  1KEK A;  5HMW A;  1NK7 A;  1DAX A;  3WX4 A;  2XGQ A;  3LO3 A;  1GT8 A;  4OX6 A;  1RWM B;  2XLI A;  4KH0 B;  3KDO A;  2BOA A;  3BDE A;  3GYX B;  3HHL B;  4TVA B;  3N28 A;  4NLG A;  2VV5 A;  2MKK A;  4B9M A;  2QO3 A;  3AXK A;  4DV1 J;  2VB6 A;  3FBB A;  3OVS A;  1KC8 T;  1HWU A;  2QLJ B;  2HHP A;  3KFW X;  3NGR A;  5KFI A;  4MMO A;  5B0D A;  1FK9 A;  1S1X B;  1U49 A;  4DCJ B;  2N82 B;  4B9V A;  4UY8 5;  1NB7 A;  2HQG A;  1QUV A;  3OL8 A;  1U1L A;  2IYI A;  3JB9 k;  1M1K T;  5J2Q B;  3MMC B;  3PEJ A;  5KFQ A;  1UL3 A;  1UFW A;  3MPV A;  2A2C A;  5LSR A;  1DJ0 A;  3M2U B;  1XBW A;  2A0F B;  4DG1 A;  2RRA A;  4KTQ A;  2CG8 A;  3MEG A;  3JSY A;  4MIW A;  3KLG A;  2XUL A;  2IM1 A;  4CYU B;  2KI2 A;  1TK5 A;  2NYH A;  1PKU A;  4NMX A;  3OSN A;  4LFC J;  1YG0 A;  4FKX A;  1U1R A;  2Q3P A;  2F5G A;  3QZ8 A;  3I0S B;  4LF4 F;  4XIU A;  3M8P B;  4LF8 J;  2BKP A;  1EAR A;  2PMW A;  1BQM B;  1MWQ A;  3M8Z A;  2QL9 B;  3ENQ A;  2FZG B;  2ZC4 A;  3PYG A;  4P72 A;  3AOC A;  3RBX A;  1R7I A;  4CH7 A;  3OL6 A;  4DFM A;  3CCM S;  4JI4 F;  1HNX F;  2H54 B;  1FFG B;  2EI5 A;  2X7I A;  2PMH A;  4C8M A;  3PX4 A;  3HKW A;  4JI5 J;  4IQM A;  1IKX B;  2YQ0 A;  3DU5 A;  1MG7 A;  1PIE A;  2OAU A;  3I5A A;  1VCT A;  4U7C A;  3KLH B;  3M8S A;  4OYA A;  4WZQ A;  4F4A A;  4P7V A;  1HYS A;  5KG1 A;  1Q8B A;  1S49 A;  3M6U A;  3AH6 A;  3NGT A;  3UN2 A;  4EBC A;  3D1Q A;  1HMV B;  4YR3 A;  4EZ9 A;  1QSY A;  2GIF A;  3ZZP A;  3DGP A;  2DYA A;  4LBI A;  3TA1 A;  1FNO A;  2V2Q A;  4BBY A;  2R2U A;  3KWM A;  1YJV A;  3W64 A;  3VAK A;  1JLB A;  5ETP A;  1CG2 A;  2COL A;  2J9E A;  3O6Q A;  3PCO B;  2XMV A;  2D7S A;  1SCJ B;  4G1I A;  1S1T B;  3H0P A;  5ETS A;  2PT0 A;  3R7S B;  3VZI A;  1U1N A;  1YQH A;  5J2M A;  1NDP A;  4PWD A;  4EMD A;  1RSC A;  1SJF A;  3GJQ B;  4OZ0 A;  4QIV A;  2FLL A;  4ZMM A;  2HRY A;  4P74 A;  4F36 A;  3BF4 A;  4PCQ A;  2ACM A;  4PG6 A;  4JI3 J;  2WB1 D;  2KXF A;  3TAP A;  3FBC A;  4P7T A;  2KB2 A;  2YVS A;  4C8Z A;  2CZ4 A;  1V6H A;  5T7L A;  1FEH A;  1T03 A;  3V6K A;  1UEV A;  2VL1 A;  2OJ3 A;  5C2G A;  2ZOG A;  4ZVO B;  3ZZR A;  1KFS A;  3A8J A;  3EDQ B;  4C11 A;  4DZD A;  4B17 A;  3K5O A;  1IWG A;  4QR1 A;  3JQK A;  3ETO A;  1C2P A;  3CD7 A;  1RWU A;  1LW0 B;  3ONQ A;  2XMJ A;  2WOM A;  4MK7 A;  5H9F J;  5KT2 A;  1BGX T;  4PXD A;  3VVU A;  1N5T A;  5F8G A;  1U45 A;  3R9L A;  1CBK A;  1OYD A;  4QW8 A;  1VJW A;  2V8D A;  3TO8 A;  1I94 J;  4DUT A;  4N41 A;  5L9N A;  5B7W A;  5D77 A;  5DRK A;  1LFP A;  3H42 A;  4GVB B;  4OFZ A;  3NY0 A;  3HVR A;  4L72 B;  4ECV A;  3CCZ A;  2K1R A;  3ISN D;  5F0U A;  5BR8 F;  2W7P A;  5BXI A;  1NKB A;  2W4D A;  3J80 Y;  4F2R A;  1AZS B;  1O51 A;  1HNW F;  3CUN A;  4WP8 A;  1W2B R;  4QU6 A;  3PYF A;  4ZN1 A;  2XMA A;  3NNH A;  4TU7 A;  4CM0 A;  2M7S A;  3LH2 S;  1RTH B;  3CNQ P;  3US5 A;  3LQV A;  1NJW A;  5B0E A;  1KVK A;  2DNP A;  4NLR A;  1N52 B;  2CQI A;  4R8U A;  5A6P A;  3IWN C;  1Q1K A;  3DYA B;  1RA7 A;  2QZ8 A;  3O44 A;  4HT5 A;  1HQ2 A;  1ZET A;  5CAB A;  5CA5 A;  4YB1 P;  1Q7Y T;  2VDH A;  2KFN A;  1RB0 A;  1R8C A;  4JI4 J;  1BE4 A;  1JLB B;  2NXN A;  4DR5 F;  3L95 X;  4ZOS A;  1NK8 A;  1YJT A;  4R0J A;  4OHY A;  4TYB A;  3QT5 A;  5DM7 Q;  2KYZ A;  1HI1 A;  3AOB A;  2OPP B;  5DQH A;  2HGN A;  3DLL Q;  8AT1 B;  1WKJ A;  2R2R A;  3BKF A;  2GJI A;  4XDC A;  1PGZ A;  1SJ1 A;  2YKA A;  5AE3 A;  1I94 F;  1U2C A;  3CJT A;  2XYH B;  1F9E B;  5D4O A;  3BQ2 A;  1JMT A;  2CPY A;  4N56 A;  3GIM A;  2W2Q P;  4F25 A;  4CO2 A;  4ITS A;  1IBL F;  2FB0 A;  3BO4 A;  1YWX A;  4GKK F;  3OW2 R;  2OD4 A;  1BWV A;  3DI6 B;  4LVO P;  3WQP A;  5KFU A;  4CLL A;  1TKX B;  2ZFH A;  2VG7 B;  2HHU A;  1Y5I B;  3GTY X;  4OZ1 A;  1ZM9 A;  4U6P A;  1O8B A;  3JAM Y;  4DUY F;  1UVM A;  1K44 A;  3W61 A;  1MN9 A;  4CWB A;  3W9I A;  1GXL A;  3ILL A;  3PIP Q;  4NZ0 A;  2OFG X;  1X9M A;  3S01 A;  2DEJ A;  2ATL A;  2ZUA A;  3MDF A;  4CNY A;  4NXM J;  4LFB F;  1LWX A;  1R8A A;  2W2M P;  1XR5 A;  2YKM B;  2K06 A;  1S4F A;  4RBV A;  4RW8 A;  1VIS A;  4CYU A;  4DSE A;  4NCA A;  4DMZ A;  1EZZ B;  1URR A;  3QSI A;  2OHD A;  3TZZ A;  4A8O A;  3KK2 A;  4TY8 A;  1VQS A;  3WHI A;  2V4J B;  5IT9 Y;  4NML A;  5GAG U;  5CZX A;  1VIX A;  2E9R X;  4RWX A;  4C97 A;  3T19 A;  1J5O A;  4KR0 B;  2MKH A;  5CD4 H;  3HVT B;  5GAH I;  3MCN A;  3DC2 A;  1PYO B;  3DM2 A;  3EE3 A;  3LP1 B;  3OTC A;  4U9R A;  4CLK A;  1EHW A;  4PUO A;  3PR4 A;  1RDR A;  3QWU A;  3SEO A;  4LF1 A;  1HHT P;  4DSI A;  2QIF A;  3G6Y A;  2QLF B;  4DBQ A;  4MKY A;  2OPS B;  4DJB A;  4ED6 A;  1UA0 A;  1C1C B;  1WC6 A;  2IYG A;  3AJ2 A;  3CF5 Q;  3GFY A;  3QGH A;  1T05 A;  1UEU A;  2RJZ A;  3ZZ0 A;  3PFE A;  3GIK A;  1P1L A;  3F41 A;  4AXI A;  1F9F A;  2WSE C;  1J2V A;  4ICL B;  4QIG A;  2B8P A;  3G6X A;  3X1L B;  3PW7 A;  4K5R A;  3TVZ A;  2WVF A;  5HJY A;  4Y2A A;  2R2T A;  5FDL A;  4G6V B;  3BN7 A;  4NYZ A;  2HSE B;  5ITH A;  5L1L A;  1RQ0 A;  5IS2 A;  2B9E A;  5IT4 A;  1FNM A;  2FJD B;  4L75 A;  3QRR A;  1Y3J A;  1G4C A;  2QMU B;  2CQ3 A;  1Q4R A;  2RRN A;  3KYL A;  4TN2 A;  2DKO B;  3ZZU A;  1NZA A;  1UPP A;  4JUZ A;  4HYK A;  2M9K A;  3BGL A;  4M5N A;  4DV7 J;  1FJC A;  1MMD A;  2FYX A;  2GMH A;  4IG0 B;  2B4U A;  1FKP A;  3TP2 A;  2DJW A;  2IJR A;  2J7K A;  3GSI A;  1WG4 A;  3BBF A;  5IV4 A;  2VA3 A;  1KD1 T;  2LXI A;  5H9E K;  3LTO A;  3PO5 A;  4Q0B A;  1Q78 A;  2YY3 A;  3RU0 A;  4Q43 A;  2MZS A;  2RU9 A;  3HVT A;  3GV5 B;  3TJ8 A;  4BDP A;  3ZZY A;  3FVY A;  2HPU A;  3PKM A;  2R8K A;  1HNI B;  1IQZ A;  1JXV A;  1NDK A;  2EKY A;  3CCQ S;  2GA7 A;  3BRE A;  5E2Q A;  1SBR A;  1VQL S;  5CH7 B;  4Q8F A;  2W7A A;  4DPU A;  2EC0 A;  2IY5 B;  4P52 A;  3VAI A;  4O3R A;  3PDN A;  2ZH2 A;  3NNA A;  4B3O B;  1NSP A;  2AKW B;  2OP5 A;  3F44 A;  1Q16 B;  3CJK B;  2G2O A;  2IIH A;  3D0H E;  4Q8E A;  5C24 A;  1PYT A;  1SH3 A;  2EBG A;  2G1D A;  2W25 A;  2RF2 A;  1Q5V A;  2H4W B;  2PMZ D;  2KG0 A;  1H98 A;  3ICL A;  4C98 A;  4OMF G;  3C15 A;  2ALZ A;  3L3C A;  3KLF B;  5KG6 A;  4RZR A;  3MEE A;  4ANC A;  5BR8 J;  3G4S S;  2W8L A;  3UVJ B;  2KTQ A;  1IJE B;  4N5S A;  4CH1 A;  4YFU A;  1TTH B;  3UVJ A;  1S9F A;  1YHQ S;  3F0N A;  4O0I A;  4JI5 F;  3BZQ A;  4NXM F;  2RAQ A;  2C2R A;  3G8S A;  1HPZ B;  4LRD A;  3M6W A;  4PQU A;  3ISN C;  2IAJ B;  4KO0 B;  1VYA A;  2VKZ G;  4EI2 A;  5H9F K;  2XO7 A;  3MPD A;  3OFH A;  4LSZ B;  4ED5 A;  1A7G E;  4WXO A;  3SDE B;  4TNO A;  4ICL A;  3R5J B;  2XHC A;  2BYC A;  2P6S A;  1TL5 A;  5KG4 A;  2HVZ A;  5HBM B;  3R5G A;  2O3D A;  1FXD A;  2YBV A;  3BV8 A;  3GCW P;  2CRL A;  4KT0 C;  1U6B A;  3K0J A;  2OTJ S;  2DIU A;  3D6T B;  5E3C A;  2HLT A;  1D9F A;  3QJL A;  5EWE A;  1TFW A;  4NXN J;  5DO2 A;  3TA2 A;  4M63 A;  1VK3 A;  2DHA A;  1U1O A;  2B9Y A;  3V4M A;  1J5E F;  2ZDO A;  2C2K B;  3VR1 A;  2YNF B;  5J2N A;  3AD9 C;  2HQD A;  2MQ8 A;  1UFK A;  1NSK L;  3IC1 A;  2ZH9 A;  3DYA A;  4UY8 T;  1S0V A;  5HSP A;  2W9C A;  4F0H A;  4ATN A;  1K8A T;  2EG2 A;  1XMO F;  1T3N A;  3VF0 B;  5HI7 A;  1OWX A;  4AUK A;  5CYM B;  1T95 A;  3THP A;  1GAO A;  2G0C A;  9ATC B;  3KJQ B;  4DFK A;  2HHX A;  2IBO A;  5ETM A;  1AXQ A;  3UFC X;  1SUQ A;  2VC1 A;  4N47 A;  7FD1 A;  3OLB A;  5BYS A;  3CCS S;  2VJV A;  2YWE A;  1HBU A;  3EGN A;  3PTW A;  4DV1 F;  2DR9 A;  3UCG A;  4A8Q A;  4RW8 B;  3CUL A;  1YKW A;  4NZ6 A;  4AYB D;  2VHG A;  1SL0 A;  4RL1 A;  2GVZ B;  2ROG A;  2ASY A;  4OI1 A;  1NCL A;  4DX6 A;  2VIC A;  3R7N B;  2Y8W A;  3M8Q B;  3I31 A;  4DS4 A;  3I56 S;  2QA1 A;  5FLX U;  3Q8Q B;  1X9W A;  3GV7 B;  2M2B A;  2AQ4 A;  4I6A A;  2EW9 A;  4RUH A;  2AYE A;  1VDH A;  1NBE B;  2MJU A;  5E3R A;  1YRX A;  4ZCK A;  2BVZ A;  2G13 A;  5IT9 U;  2RSQ A;  1H2V Z;  1KLM B;  3I6P A;  3EM1 A;  5A8W B;  2C3Y A;  2RUG A;  3BDP A;  1CJT B;  5A76 A;  1VHI A;  3H5X A;  3C6T B;  2HVE A;  1PJ7 A;  1S4E A;  3FSY A;  4USM A;  4URS A;  3KG0 A;  2DGU A;  3L09 A;  1JQG A;  4Y2K A;  1FWL A;  2CQD A;  2VJU A;  3OSP A;  3JSR A;  3U1L A;  1X9S A;  1FJG J;  1ROF A;  2F40 A;  2M8H A;  4CZC A;  1S7H A;  2AMC B;  3FUY A;  5DDQ C;  4FF2 A;  3I55 S;  3MPU B;  1RYS A;  2HG4 A;  3NL0 A;  3HFK A;  5C25 A;  1VC0 A;  1M5K C;  4FPR A;  3DLB A;  2GQQ A;  5DZ7 A;  4OYB A;  2IA0 A;  1U0H B;  4N7T A;  2HND A;  3M9M B;  4HLB A;  1WEL A;  4AFF A;  5KFN A;  3V81 A;  1XQI A;  2HNZ B;  4DCO B;  2MQL A;  1FHT A;  2PII A;  3KDN A;  4DN0 A;  2HFO A;  1U2F A;  2GJ2 A;  2DR7 A;  1N6Q A;  2YX7 A;  1PSD A;  3OFF A;  4B02 A;  2AEF A;  4J37 A;  1WDT A;  2I6W A;  3SCL E;  1TKD A;  1R3N A;  4FBT A;  1Q5Y A;  4PKD B;  5M2P A;  4IG0 A;  1SI9 A;  2X3D A;  3G6V A;  4WCE Q;  1EET A;  1VI7 A;  2A10 A;  5F41 A;  3J7Y I;  1R8P A;  1QJH A;  2F4F A;  4P6Q A;  5HK4 A;  2OI2 A;  2LQ5 A;  2CFX A;  4NA3 A;  1U47 A;  2BRL A;  3BH6 B;  1RYR A;  4M94 A;  4FS1 A;  3DLE A;  4YB5 A;  4M5I A;  4DHV A;  4ETZ A;  2WTF A;  3EGV A;  1NJZ A;  3JTP A;  2V9K A;  2XYP B;  3G2X A;  4CI0 B;  1CJK B;  2J6S A;  4PXE A;  1EX8 A;  1TZ0 A;  2R42 A;  4BLG A;  4ZIT A;  3Q8Y A;  3DLJ A;  1TL4 A;  4PWU A;  5EX3 A;  4AQY F;  3KLV A;  4MAK A;  3CPW R;  4PYD A;  1DQ8 A;  4NLO A;  1T05 B;  1RUS A;  1RAD B;  3P5T L;  3KUE A;  5KFV A;  2ERR A;  2LFV A;  4XDD A;  1RWV B;  2KM8 B;  3UPF A;  3BSA A;  3D1H A;  3K8V A;  2KRR A;  2FZC B;  2W4P A;  4F4Y A;  4CNZ A;  2QA4 G;  3A3P B;  2HZC A;  2OMO A;  3OV7 A;  3R1L A;  4NZ7 A;  3CCV S;  1PYS B;  2C2O B;  1M1G A;  1WI6 A;  5H9E J;  2QRR A;  2RKI A;  2D3Z A;  1Z4U A;  3EZO A;  3LPY A;  5DDP C;  2W9B A;  1AFI A;  4OYX A;  3BGF A;  4FYY B;  1SC3 B;  5E3A A;  2AJQ A;  2C3O A;  1ZAW A;  4K4W A;  1D3W A;  3C8Y A;  4M5M A;  1MN7 A;  1RWN B;  5HQL A;  1R0A A;  4FBU A;  2VON A;  2M88 A;  5KFZ A;  2FLN A;  3MGJ A;  2ACY A;  4P9S A;  3TAR A;  2CJK A;  2GQ2 A;  1LK5 A;  2UVW A;  5JJB A;  3SIP B;  1RT2 B;  2KZM A;  5KFE A;  2EFO A;  3RB0 A;  4ILL A;  2E66 A;  2N4D A;  3OR1 A;  2O67 A;  1RJJ A;  3CDA A;  4R5P B;  5I42 A;  1UVN A;  1NDL A;  1SIZ A;  1RT7 A;  2CQ2 A;  3C6U B;  1CPZ A;  4JV0 A;  4QWA A;  1VRQ C;  3KXD A;  1WKK A;  3TNV A;  1HQE A;  1IBC B;  2ADB A;  1S0O A;  1AUS L;  5EHH A;  2A6O A;  2HZA A;  3BSN A;  2OGU A;  3M6X A;  2LU2 A;  4IFY B;  7FDR A;  3C3L A;  2ZH5 A;  2D3U A;  3ET6 B;  5JVH Q;  4JI0 J;  3OD2 A;  1ZBT A;  2DNQ A;  3T5H A;  3Q2S C;  2AYG A;  3J7A 1;  3C14 A;  2V8P A;  3MEG B;  3OHB A;  1I5O B;  4BS2 A;  1U1K A;  4FF1 A;  3ENV A;  1U48 A;  3CDE A;  2XB2 D;  4JV5 F;  5CXT A;  1URN A;  4CT9 A;  2YWF A;  5KFX A;  5F0W A;  3HK2 A;  3A12 A;  2E7V A;  2GHW A;  4XAK A;  5L39 A;  4RBT A;  3RB6 A;  4ZLN A;  2WB4 A;  1HNX J;  3HKZ D;  3HJV A;  4DQS A;  4CLW A;  3VZH A;  5KFB A;  1RT3 B;  4OJG A;  3JYT B;  4RUC A;  3E01 A;  2ZNZ A;  4DR1 J;  2LXF A;  3BKT A;  1QM9 A;  3MCO A;  4RU2 A;  2FPH X;  3UR3 C;  2PSZ A;  4KGV B;  3LGM A;  4NYP A;  3AA9 A;  2R9L A;  4DV6 F;  2OH2 A;  1QVF R;  5J2M B;  1WOP A;  3DRR A;  4DU7 A;  1X0P A;  2EVZ A;  5C7P A;  4I6W A;  1S9G B;  2WON A;  4HI2 A;  2VZ9 A;  4YS2 A;  1HWI A;  2DO0 A;  4YHH J;  4B9N A;  3KMQ A;  3B78 A;  1LWF B;  1F60 B;  1WEX A;  5KOX A;  2AEM A;  2AU0 A;  1WEZ A;  1X4G A;  8RUC A;  4C8L A;  2GIR A;  1NND A;  2NS1 B;  4LQ9 A;  4P10 A;  5DS7 A;  1TKZ A;  2BW2 A;  4CO4 A;  5MLC V;  5HQM A;  3DLE B;  4IUF A;  1Q53 A;  2CNL B;  3B4D A;  3DGV A;  1PBU A;  1LW0 A;  3FEY B;  4NEY A;  4WIQ A;  4XK8 C;  4KGM A;  4ZVU B;  2CPH A;  3HM9 A;  4OI3 A;  1WC3 A;  3IP0 A;  1SL1 A;  4KYZ A;  1N33 J;  1QDU B;  2DNM A;  3PHT A;  4HKQ A;  4Z7Y A;  3MHY A;  1UWB A;  4UUW A;  1MML A;  1RTJ A;  3DHW C;  4J5O A;  4AXJ A;  3CE8 A;  1UTA A;  2L08 A;  4I69 A;  4E98 A;  3D6H B;  5FD1 A;  5C24 B;  2GAH C;  4YEA A;  2CZ9 A;  1GTH A;  1FTR A;  2LQB A;  1FKP B;  3O3L A;  1N5Q A;  5KOW A;  3M30 A;  5KFO A;  2VIH A;  3RRK A;  1N54 B;  3EXC X;  2QGF B;  1RT5 A;  3I4H X;  4HHH A;  1U09 A;  4WP9 A;  4C48 A;  5D0R A;  3J80 U;  1EB0 A;  1RP5 A;  2HIY A;  2F65 A;  3GIJ A;  2B5J A;  3GQC A;  1FRX A;  7AT1 B;  1N32 F;  4I4B A;  1ZZF A;  3HHL A;  4AL7 A;  4U7U D;  1JJC B;  4B3R J;  1U6F A;  4QR2 A;  4UOC A;  4X66 J;  5AE1 A;  5F3Z A;  4ZPV R;  4QOT A;  4ER8 A;  2CG4 A;  4YN3 B;  2R7V A;  3IWX A;  3LUY A;  3JQJ A;  5K5M A;  4DV2 J;  3KMS A;  4J9S A;  3M2R B;  1X5P A;  2RQC A;  1QLN A;  2QSF A;  3Q8S B;  4RW7 A;  2ZUG A;  1Z1Z A;  4CRJ A;  2FLP A;  2Q6B A;  2R7O A;  1KHV A;  2WZ1 A;  4YB7 A;  3G82 B;  3N0V A;  4YQW A;  3QIP B;  3TZW A;  2W8K A;  3ZFV A;  3A13 A;  4I7F B;  1S72 S;  3IWL A;  1TUG B;  2RH3 A;  2MLZ A;  2XI2 A;  4CLT A;  3TJA A;  1C4A A;  1HD0 A;  4K59 A;  3IBC B;  4I2Q B;  5HMZ A;  2PD1 A;  1U4B A;  4ED0 A;  1HW8 A;  5CCL A;  4M95 A;  4UTG A;  4X2B A;  1WAC A;  3D68 A;  1FF2 A;  2BM1 A;  2M3D A;  2Y9H A;  3I82 A;  4OYZ A;  1BD6 A;  3HVW A;  3T6B A;  3I0S A;  4N8O A;  3C46 A;  1S76 D;  2XS7 A;  4K2X A;  1GMW D;  1L3U A;  3LP2 B;  2J7U A;  2D9P A;  2RRB A;  3NG8 A;  1RHR B;  4H4K A;  3MEK A;  2P5V A;  4S0M A;  4W92 B;  4QYZ K;  1RT5 B;  1SUQ B;  2BKO A;  1LW2 A;  3WIU A;  3CCR S;  4CLY A;  2YKM A;  4UQG A;  2Q6C A;  2V2V A;  5ETN A;  5B0A A;  3EPI A;  2ZHB A;  4DL6 A;  5KG3 A;  1RT6 A;  2B9X A;  2O1P A;  4DWI A;  1NO8 A;  5HN0 A;  2AD9 A;  3CC2 S;  4DSJ A;  1T02 A;  3L4B C;  3FGV A;  4C8K A;  4JI6 J;  1DTT A;  3ZC4 A;  3W8G A;  3PJW A;  2JOQ A;  3GFZ A;  1X60 A;  2J8A A;  2ZKT A;  4K4V A;  1RWP B;  2O5D A;  3BH7 B;  3DI6 A;  3TJ9 A;  1RT4 A;  2V5H G;  4F8R A;  3MXH P;  1CS4 B;  3W8P A;  4F3Q A;  5KFM A;  2CA9 A;  3G8Q A;  5L8R C;  2UUB J;  1NK0 A;  1IVZ A;  1WC0 A;  5IQ6 A;  2AGO A;  1EKR A;  2XHW A;  2VA2 A;  4KRW A;  4P75 A;  2C2E A;  1H2U X;  2AT1 B;  3BM7 A;  2XTJ P;  1CSJ A;  3UDV A;  3KJF B;  1RAI B;  2B8Q A;  2IMO A;  4OQJ A;  2OSQ A;  4PQU B;  2BUN A;  5GME A;  2BDP A;  3PVX A;  2AX1 A;  4PAA A;  1ITP A;  4U67 Q;  2FC8 A;  2YKQ A;  4U8Y A;  2R7T A;  2L9N A;  1TKT A;  1L3V A;  4B9S A;  3HSZ A;  3CDU A;  1XNR J;  3KHG A;  4OV1 A;  2JFK A;  1I6J A;  1F2G A;  1S7I A;  2ZBC A;  4UW2 A;  1DZ5 A;  3W5Y A;  4YY3 F;  3MR2 A;  5THW A;  5GMK a;  1TVR A;  2QG9 B;  2MKY A;  3OUY A;  2ZM6 F;  1CJV A;  4DPW A;  2AZ3 A;  3DFE A;  4OX9 F;  5DG8 A;  4J9V A;  2QA4 S;  1PCA A;  1RKI A;  3GR1 A;  1M5P C;  1WDD A;  1F5A A;  5A8R B;  2I38 A;  1N33 F;  3H8Y A;  2AGQ A;  2G0I A;  2R7U A;  2NZC A;  3IS9 A;  1UCN A;  3DRY A;  4OI4 A;  4A8K A;  5HVG A;  4PAB A;  2XBP A;  2Y1L B;  2VFT A;  4ZCM A;  3QJP A;  2V4J A;  1DTQ A;  2AZ1 A;  1ICE B;  4HTI A;  3VGT A;  2V4Q A;  5E0O A;  1UMJ A;  1CEZ A;  1HLW A;  3FSX A;  2MDA A;  2RE1 A;  4B08 A;  5ETK A;  2G0J A;  2MY7 A;  3JSM B;  4ED4 A;  4IRK A;  2WAQ D;  3QGI A;  4J90 A;  5MAO A;  5KG5 A;  2DXD A;  2V50 A;  1U2R A;  4B3T F;  2V63 A;  1O6X A;  3I9Z A;  5LM7 E;  3CCE S;  5F8I A;  2KJV A;  2WOM B;  4F4X A;  4ZVT B;  3G6E S;  4IOA Q;  5D3G B;  4DSK A;  2IRU A;  2LVW A;  4IH6 A;  5I42 B;  4DV6 J;  1VQ5 S;  5KFP A;  2KT2 A;  3O2I A;  3WDO A;  2C2N A;  3W2V B;  1RAG B;  2WW4 A;  4NL5 A;  2GHV C;  3S8S A;  3M32 A;  2UUW A;  2DR8 A;  3SMZ A;  2WVB A;  4DR1 F;  1GNK A;  3NAI A;  4DSL A;  3DLG B;  3KHL A;  3A3N B;  4F02 A;  4A8S A;  1RBA A;  2R8I A;  1JWW A;  3KLE A;  4WU2 A;  4ZIW A;  4FN5 A;  4BHQ A;  2CVI A;  2Z8Q A;  3MFI A;  1HQU B;  2YNI A;  1P1T A;  4WYW A;  1ZZN A;  1ZM4 A;  5HVH A;  4O4R A;  4DX5 A;  1S1W A;  1TAQ A;  2E7X A;  1S6U A;  1U26 A;  5ETO A;  4A46 A;  1TL1 A;  3NOC A;  3QAE A;  4ZVG A;  4OHZ A;  4CO3 A;  4PG4 A;  3K5N A;  4C0B A;  2HLU A;  1WEY A;  5L46 A;  2D9O A;  1KOO A;  3UDC A;  5C25 B;  2JEF A;  4GO5 X;  5EDW A;  1FO1 A;  3NXZ A;  2AYB A;  2HW3 A;  2YWK A;  2V2K A;  2KXN B;  2JC0 A;  1QAX A;  2I5J B;  3G8T A;  2EC2 A;  3O5T B;  2JEJ A;  4X4V A;  2KU7 A;  4CDI A;  3OUY B;  4IRC A;  3AA8 A;  3N6L A;  3NBP A;  5F9N A;  1QSL A;  2FDN A;  3OXF A;  2XSJ A;  1YJ7 A;  4EYI B;  4DFP A;  4JI3 F;  2DTJ A;  3BS9 A;  3DDN A;  4WE1 B;  4O3O A;  1U02 A;  1S48 A;  3BQ0 A;  1WSV A;  4C8O A;  5D0H A;  1U0S A;  4OYP A;  3H5U A;  3IA0 A;  5GAE I;  1T9W A;  3OR2 A;  3ILO A;  2JLE A;  1FRJ A;  4WPA A;  1UWA A;  3HSJ A;  1KOH A;  1QY7 A;  2FHK A;  4YY3 J;  3I4P A;  3E51 A;  2RQ4 A;  4I64 A;  5L1I A;  5K9F A;  4LF7 J;  2LA4 A;  4JP8 A;  2UUA F;  1XNR F;  2B51 A;  2J0X A;  1TP7 A;  2D3O R;  3M05 A;  4TQS A;  4C0H A;  3BBC A;  1KON A;  4IO1 A;  4DQP A;  2P9E A;  3AXM A;  4DG1 B;  2FJA B;  3DRX A;  3OTO F;  5KFC A;  3CC4 S;  2Z56 B;  3D1O A;  3GMG A;  4PR6 A;  2ZVS A;  2LEC A;  4NLP A;  3CIM A;  3TZX A;  1FE4 A;  2H5I B;  3C66 A;  1OY9 A;  1A6L A;  3UN5 A;  4LFA F;  1DTT B;  1UJ4 A;  1JJ2 R;  1XNQ F;  4RW6 A;  1M0S A;  3CTR A;  3AOA A;  2ZC3 A;  4X64 J;  2YNG B;  1H6K X;  3JSM A;  2UUB F;  1S9E A;  1VR6 A;  3R5A A;  1JKH B;  4FZV A;  4MYT A;  4DPT A;  4N77 A;  4ZLJ A;  2C42 A;  2ZHA A;  3UD4 P;  3V81 B;  4IG3 B;  2KRB A;  1XR7 A;  1HBM A;  2OPP A;  1I1G A;  1UVK A;  2BRK A;  2MZR A;  3HHE A;  3QNW B;  4BC7 A;  4PWD B;  1F3V A;  3OPK A;  4LF5 J;  3HFV A;  1F6T A;  3PRV A;  2EFN A;  3M2U A;  3THV A;  3QYY A;  4EZ6 A;  4ZK7 M;  4A47 A;  4J9M A;  2DRA A;  1HNV A;  4ZVR B;  4PG5 A;  4Y0F A;  4JV1 A;  2F8H A;  1D8Z A;  1APS A;  3B4M A;  4NLU A;  3FJ2 A;  4LF7 F;  4B9U A;  3PW0 A;  3R2D J;  4ILR A;  1R43 A;  4EU0 A;  4A8X A;  2H3E B;  5D0E A;  1FTC A;  2XWX A;  3IGV A;  4PG8 A;  3MMB B;  3IAS 9;  4JI2 J;  1RXO B;  4K0K F;  5L1K A;  1SC6 A;  3T5L A;  3MWB A;  2J9C A;  4FP9 A;  2QLB B;  4EFA C;  1YVF A;  2QTW A;  1RA6 A;  2OLW A;  3FBF A;  1TR0 A;  3S7R A;  5HQ8 A;  5J1E B;  3IRW P;  3V6D A;  4OX7 A;  3D54 A;  2HQF A;  2RHQ B;  3K5P A;  1P8G A;  2W9A A;  3LAM A;  3T9N A;  4JI8 J;  3H2V E;  4USW A;  1QSS A;  3QID A;  5ETT A;  4PEO A;  5AJ3 J;  5EN1 A;  1N36 J;  2ZNY A;  2E1R A;  3OT9 A;  1RWO B;  1WUU A;  4PQA A;  5DJB A;  2O01 C;  2KH9 A;  4EBD A;  1IBK J;  3HJF A;  4LR9 A;  2BAN A;  3GP9 A;  4DOZ A;  4F3M A;  2IM3 A;  2E1C A;  1FES A;  4WTO B;  5LMN F;  1S77 D;  3MTJ A;  1G6B A;  4GKJ F;  3HT3 A;  4FNI A;  1QTM A;  1ZM3 A;  3H5Y A;  4K2J A;  1HI0 P;  4ECY A;  2IC3 B;  4Y2C A;  1IBM J;  2XWY A;  1LWC A;  1W25 A;  4NLW A;  5GAD I;  2MZ1 A;  4DV5 J;  3CDB A;  1XN9 A;  4DFJ A;  2HYI B;  2QFJ A;  4USU A;  1SQF A;  2OSR A;  2V94 A;  4OHX A;  5KT3 A;  4UT4 A;  1L3S A;  3W5Z A;  3TVY A;  4F04 B;  3UCU P;  5AJ3 F;  5B0C A;  4ZPT R;  3OTO J;  3W2W A;  3MM7 A;  1MU2 B;  3T9Z A;  3TVK A;  1QE1 A;  5LOQ A;  2VQE F;  3KK3 B;  5JVG Q;  1N48 A;  4W90 B;  1FXR A;  2IFX A;  5D78 A;  1KQS R;  5HAT A;  2UUA J;  3N79 A;  3M8Q A;  3QO9 A;  5AT1 B;  2APO A;  5CCM A;  4QW9 A;  4DV0 F;  5KFF A;  1IXK A;  2VFS A;  4N76 A;  1IQT A;  1NK5 A;  1VK8 A;  2AWZ A;  2WON B;  4OI2 A;  4WP3 A;  2GV1 A;  4LF6 J;  3HHK A;  4MFB A;  4Y34 A;  2XLJ A;  4TU8 A;  2ZH4 A;  1FVS A;  1WHV A;  3MUT P;  4DR6 F;  4XPE A;  4NRT A;  1SXL A;  4B3M J;  3D0I E;  4LRC A;  1X4F A;  4ECW A;  4RW9 B;  4YUD A;  3MUV P;  3CWJ A;  4M5D B;  2DHS A;  3NWR A;  1N5Y B;  3POT A;  4YHH F;  4GMK A;  4DLG A;  5A2Q U;  4Y2I A;  2X1B A;  2NSC A;  4OX9 J;  2IHR 1;  2RNE A;  4LF5 F;  2ZM6 J;  4UST A;  5HO4 A;  1AW0 A;  2BMB A;  2DHX A;  2J9D E;  3JXO A;  2MQQ A;  1YK9 A;  5FJ4 A;  1REV A;  1VLO A;  1JLA A;  1RU1 A;  2OPR A;  1T9Y A;  2GVD B;  4CTA A;  4NCG A;  3FCH A;  1U1P A;  1BQX A;  3BGR B;  1S59 A;  1RBO B;  3MD3 A;  3T5J A;  1U1Q A;  1X5T A;  3M30 B;  3TAM B;  3ZNU A;  5LJ5 Y;  3QT8 A;  2MY8 A;  3D5M A;  3FZB A;  4WZM A;  2VG6 A;  3BEG B;  2C1E B;  1MRO A;  4K5S A;  2MGZ A;  3H5S A;  2D41 A;  2C22 A;  3O8W A;  4ZS6 A;  1N5Y A;  5E33 A;  2D3O 1;  1GMU A;  2BJ7 A;  2F3J A;  2BJ8 A;  3CT9 A;  2GCF A;  4I56 A;  5SUH A;  5J2N B;  5E41 A;  2I2Y A;  3Q89 A;  4HDG A;  4USV A;  2VC0 A;  5KT6 A;  2HQ3 A;  3CED A;  4K50 A;  3E3X A;  3MEC A;  3BO3 A;  2E7W A;  2IM0 A;  5IM0 A;  1FDB A;  1TKZ B;  5DZ6 A;  5DDO C;  1HWL A;  1Y5L B;  1WHX A;  4WFN Q;  5AXK A;  2P8I A;  1WOR A;  3LP0 A;  1N36 F;  5HJX A;  4QQB A;  3MM7 B;  2CPD A;  3EYZ A;  3CCU S;  1NZ8 A;  2ROE A;  5C42 B;  1XER A;  2ZBI A;  1HPZ A;  3H7H B;  3MCS A;  3C14 B;  1EP4 A;  2M5Y A;  4KHP F;  2MST A;  4H4M B;  1RT1 A;  2WRM A;  4X62 F;  3FQL A;  1S1V A;  4HL9 A;  4OYM A;  1VHF A;  3ADA C;  3DLK B;  4ZJL A;  2QEX S;  1RTI A;  3CC7 S;  2LLZ A;  1NXI A;  4IFY A;  1SV5 B;  3OHA A;  4RO0 A;  2B0G A;  1C1B B;  2RQM A;  2BEF A;  4XTT A;  4PUO B;  1IR2 A;  4Q0B B;  3T3F A;  1RCO B;  2PDA A;  2R7W A;  1T9T A;  1RTH A;  3HX9 A;  4KBI A;  4WTY A;  3TQE A;  2QMX A;  4ID8 A;  4KHM A;  2BZ2 A;  4RW9 A;  2DRB A;  5E3P A;  1REG X;  4G1P A;  3I5C A;  3CCL S;  2JC1 A;  4TY8 B;  4DR2 F;  1SJ3 P;  1ZH5 A;  4FYD A;  1UWB B;  3OXG A;  3KUH A;  3CJR A;  2K8G A;  3HMJ G;  2GVD A;  3NKY A;  4CTA B;  3MED B;  1W26 A;  2RU3 A;  3WC0 A;  3GIL A;  4O3P A;  1MWZ A;  5HRO B;  3TWZ A;  3T1Y J;  2ZWP A;  4BWM A;  3CCT A;  4YR0 A;  3IBF B;  4NLX A;  4OZ5 A;  5K14 A;  3QLH B;  2K3I A;  2V4R A;  4J9N A;  4FDF A;  3Q8R B;  5FDL B;  1S6Q B;  4DV3 J;  1HBO B;  3MUM P;  1Q8L A;  2CWX A;  4I2Q A;  4E8U A;  4ECU A;  3NS6 A;  1S9G A;  3OR1 B;  1P9Y A;  2VFR A;  4JI0 F;  2ZE2 A;  3CDW A;  2VBZ A;  2IPO B;  1NJX A;  5KG7 A;  2V69 A;  4JOU A;  1KFD A;  2H65 B;  1I51 B;  5I3P A;  2X51 A;  2GHP A;  3EZU A;  1B70 B;  2IC3 A;  4ID5 A;  2YPY A;  5D4P A;  1B7Y B;  2KO1 A;  3TYT A;  2RQK A;  4J9Q A;  2EK6 A;  2J6U A;  2IVY A;  4WK3 A;  3ILJ A;  4OYO A;  2N7Y A;  4QJV A;  4R0E A;  5KFS A;  3NGD A;  2ATC B;  4Y2M A;  2F7V A;  2B9W A;  4DR7 F;  3SFU A;  4IFV A;  2BJ9 A;  4DPO A;  1RAF B;  1Q0N A;  2E1M C;  3H4B A;  1S0M A;  3KTQ A;  4OL8 A;  3J7Z T;  2DNY A;  2OD6 A;  1E6V B;  4IOC Q;  1X4A A;  5IFM A;  3DGP B;  4WFX A;  3A3O B;  3VTI A;  2OPQ A;  2KT3 A;  3OQ2 A;  2HWT A;  1T9X A;  2CDQ A;  4NRU A;  4RU9 A;  4YR2 A;  4L76 A;  4C3K A;  1JKH A;  2RS2 A;  2YH1 A;  4L74 A;  2N3O A;  2EWH A;  2UXC J;  2JSX A;  3D3C J;  2NYI A;  2HIQ A;  1I3O B;  3C6T A;  2CWK A;  3FNN A;  1Y7P A;  4LQ3 A;  3RBE A;  4MH8 A;  3CD0 A;  2AJF E;  2MQO A;  1X31 C;  2PA3 A;  2ZJR Q;  2JFD A;  2PN6 A;  2IM2 A;  4HTJ A;  2HFV A;  4DF8 A;  3EX7 B;  1S97 A;  1WC1 A;  3EUN A;  3QGP A;  1U6Z A;  3EDR B;  2CQB A;  2Q43 A;  3ZTS A;  1PJ6 A;  2L48 A;  2W4C A;  3D28 A;  4DL0 C;  3O1L A;  1V5V A;  1VOM A;  4NAS A;  1T9V A;  1S1U A;  4DI6 A;  4Z37 A;  1SKW A;  4RX6 A;  3NOG A;  3V5R A;  1U0H A;  4ZP7 A;  3DCA A;  5J2P B;  3NNC A;  5G4D A;  2FVC A;  3I96 A;  4OZJ A;  4NX9 A;  1ZYQ A;  4FVC A;  3UD3 P;  4K4X A;  3AB2 B;  1N88 A;  2GML A;  1F9H A;  4JI6 F;  5I4M A;  4F4K A;  5KAK A;  1LXJ A;  1K0V A;  2GJF A;  1TV6 A;  4UOH A;  3MPW A;  3OJU A;  5DGA A;  1LQ9 A;  3WX8 A;  3BGO P;  2MZQ A;  2AV5 A;  1WWH A;  3MTK A;  4C6A A;  3BJY A;  1FDN A;  2QYG A;  1RTI B;  3GE9 A;  1HIY A;  2JJ4 D;  4D3G A;  2KM8 C;  1D9D A;  3NGU A;  4CLF A;  4J7C A;  3HLU A;  1LNQ A;  3RW6 A;  4JI7 F;  4PXC A;  1WF0 A;  5EUH A;  2MTL A;  1WHY A;  1VQ9 S;  1TL1 B;  4F2S A;  1OPI A;  2RVJ A;  4LMZ A;  4WFY A;  5AXM A;  1IKW A;  3M1V A;  1GTE A;  3GR0 A;  1SQG A;  1TMJ A;  1UFL A;  3PX6 A;  3H2L A;  2IAJ A;  4L6V 3;  1DBD A;  4U7U K;  4HT7 A;  1Q81 T;  1J5E J;  3RYL A;  3GII A;  2R8J A;  2CNO B;  3HD2 A;  3R97 A;  1EQM A;  2Z58 B;  2MYF A;  2QC3 A;  4NA1 A;  2MZT A;  2NPI A;  4Q2L A;  4P2X A;  2F63 A;  5DG9 A;  3R1H A;  2VOD A;  1GK8 A;  1IM6 A;  3C19 A;  4FYW B;  2H51 B;  1IR1 A;  3K89 A;  1N0V C;  2KL8 A;  1AZS A;  2HRU A;  1S99 A;  5EX0 A;  1RAJ A;  2XSJ B;  3VGV A;  1X4H A;  1S6Q A;  3SXL A;  3TA0 A;  1NPK A;  1XK8 A;  2W01 A;  1RBL A;  1GXT A;  5CHC B;  1VMB A;  1UW9 A;  2Q79 A;  4ZPD A;  5IQQ A;  4ZHR A;  5BJR A;  4X65 F;  1GEH A;  2DHG A;  2OEL A;  3DN9 A;  3PFO A;  5CYQ A;  1FJG F;  5AE2 A;  3QWP A;  3P4U B;  5HAO A;  2BM0 A;  3VHQ A;  2HNZ A;  3CVK A;  2AIR B;  4IH5 A;  4LJM A;  2ZDP A;  2VU5 A;  3K17 A;  4ES3 A;  2MJN A;  3MMC A;  4ELT A;  4CLZ A;  2G2Y A;  2J0W A;  3PKY A;  1X4D A;  3NBP B;  2YNI B;  5H1S V;  4FF4 A;  1KDN A;  1H38 A;  1JLQ B;  3MM6 B;  2FJE B;  3GYN A;  2HUR A;  4CLP A;  4KGX B;  4A8W A;  1UAW A;  4J91 A;  4J9L A;  1S5Z A;  1VC6 A;  1NK9 A;  4E0D A;  2DRD A;  3OLA A;  2Y3Y A;  5B08 A;  3ILI A;  4GO7 X;  2ILY A;  3BBB A;  4RNH A;  5LMU F;  2OML A;  5E5N A;  5KG0 A;  2GGP A;  5F8N A;  3W5X A;  1CJT A;  1IKY B;  2RD5 C;  4HAC B;  3SDE A;  1XMQ F;  4LF4 J;  2PI5 A;  2Y0B B;  3TUJ C;  4RNM A;  1NKC A;  1FFS B;  1IR0 A;  1RLD A;  4LRE A;  3RG6 A;  1FD2 A;  1HQU A;  1WTF A;  4RPF A;  1ZTW A;  4M5K A;  1WJ9 A;  1FDA A;  2KHC A;  3VQS A;  1D8Y A;  5ETQ A;  1SJQ A;  4HVZ A;  1H74 A;  1MMN A;  5JXS A;  1A9N B;  2QL7 B;  2CVE A;  4QCL A;  1JLE A;  1RTZ A;  5A8K A;  5HMY A;  3MMA B;  1W7W A;  3W60 A;  2MKS A;  2POK A;  3BKU A;  2JHE A;  1K0T A;  2UVR A;  1A0O B;  1NDC A;  1UW4 A;  2BAB A;  2IRY A;  2JX2 A;  2LQ8 A;  2VG6 B;  4U95 A;  5KTQ A;  2KKH A;  1S0N A;  2UU9 J;  3VAF A;  4B9L A;  2DHH A;  4JYA J;  4HDH A;  4LT6 A;  3GJS B;  1JLF B;  1MLA A;  2RDI A;  2V2Z A;  3W9H A;  2OTL S;  5KFK A;  2DIV A;  3MAA A;  2Z30 B;  4EO8 A;  2MPU A;  2FVS A;  3M4X A;  1HWJ A;  4H4K C;  1Z2Z A;  2DH7 A;  3J7A N;  4KJI A;  3KK2 B;  1OSC A;  4C8N A;  4B3R F;  1AT1 B;  2KT5 A;  2DH9 A;  3SQO P;  2HHH J;  2HWH A;  1FKO A;  1UZD A;  4L3K A;  1EJ7 L;  5C5J A;  4AQY J;  1UVI A;  1OSD A;  2NQP A;  2GIQ A;  2MKJ A;  4OZ3 A;  4H4O A;  5JUM A;  3GJR B;  3VQT A;  2Z57 B;  1JXE A;  3LP0 B;  4NWB A;  1XR6 A;  2Z0G A;  1CJV B;  3CJ8 A;  1JJ4 A;  3IXQ A;  3BSC A;  1NHV A;  3AQP A;  1RLC L;  2VF3 A;  3DRR B;  3TX8 A;  2CJX B;  3IGN A;  1NHK L;  2HFZ A;  3EWG A;  1KVI A;  1FI4 A;  3DNC A;  4YDD B;  5I3U B;  1PIL A;  2VPY B;  1MNE A;  3AHP A;  2FIU A;  3K59 A;  4TY9 A;  3KHH A;  2JH3 A;  4KFB B;  2IDL A;  1ULR A;  1N0U A;  2Q1L A;  4DV4 J;  2NRE A;  3L7O A;  3CD6 S;  4C9D A;  5F8L A;  3FRZ A;  3EGZ A;  4DPY A;  2DCL A;  5K8M A;  3KK3 A;  1XMO J;  1PJ5 A;  1R31 A;  1KSP A;  4CCH A;  2UV8 G;  4O23 A;  2X1F A;  1OYE A;  2D74 B;  2DNH A;  5B0G A;  4MT1 A;  4ZPB A;  5CQG A;  4GKK J;  2XLK A;  1XWL A;  2XY7 A;  3IMQ J;  4OJH A;  3DU6 A;  1RAE B;  3SSS A;  2OPR B;  4NXN F;  1LWC B;  1WG5 A;  1K47 A;  2DGT A;  3IBW A;  4DCP B;  1FWK A;  1QUP A;  1S9E B;  2CQ0 A;  2HK3 A;  4A8M P;  3DOM B;  1S10 A;  4YB6 A;  2IA6 A;  3CME S;  1HI8 A;  2DK2 A;  1TK0 A;  3QJJ A;  5A8K B;  3D67 A;  1GH8 A;  1SV5 A;  1WOS A;  2N4C A;  3GZ7 A;  2R4F A;  2HS0 A;  1RAB B;  3UCZ P;  3G71 S;  2M0G B;  3CJQ A;  4ZKA A;  1OMS A;  3W66 A;  3DRS A;  3SV3 A;  1RIS A;  2L3M A;  1NAQ A;  3NCQ A;  1IWA A;  3R27 A;  2J7W A;  4ENO A;  3GON A;  4YOE A;  4IKA A;  4P2F A;  4XPC A;  4KKO A;  3CCW A;  5C42 A;  2VBY A;  2C2M B;  2VFV A;  1FA0 A;  3MD1 A;  2D69 A;  3R3T A;  4I6Y A;  4NLT A;  2BW7 A;  5DG7 A;  2J76 E;  4RW7 B;  1DRZ A;  4GVB A;  2FHJ A;  2EG1 A;  3M2R A;  4V19 J;  1U25 A;  2HFS A;  1K1Q A;  2KG1 A;  1BHN A;  2RS8 A;  5F8H A;  2ZZN A;  4KFB A;  2Z2Z A;  3PW2 A;  3IN5 A;  1DQ9 A;  4LIW A;  3GSD A;  2DVI A;  2VG5 A;  1QE1 B;  2PA8 D;  2RIJ A;  1X4B A;  1Y4Z B;  3B8H A;  3PJX A;  4OI0 A;  3W2W B;  3DOK A;  3KLI B;  2DGS A;  2DNL A;  2HAF A;  2BV3 A;  5B0F A;  1VFJ A;  2BQ3 A;  2JL9 A;  2B43 A;  2AX0 A;  2LEA A;  2XZD B;  2E9Z A;  3DXB A;  1ZTT A;  1FRI A;  1KN6 A;  3P5B P;  1JLG B;  1OQ3 A;  1YRU A;  1H7X A;  2YKN A;  3BN4 A;  2AEJ A;  2WBM A;  2ASD A;  2ZH1 A;  3FFI A;  1E6Y B;  3PYE A;  2VH7 A;  2EFP A;  3VAM A;  1B64 A;  3H40 A;  4N8N A;  4EGL A;  1D1U A;  3A8I A;  3LP1 A;  2FJX A;  4LF2 A;  1NRK A;  1S1T A;  3D6M B;  3BGU A;  4EK2 A;  2CJ9 A;  2AJ2 A;  2OEJ A;  3G87 A;  4F4W A;  1BXN A;  1HNI A;  3GFH A;  3RB3 A;  3MM5 A;  3TW0 A;  3NGK A;  2NPF A;  3UO0 A;  4LSN B;  1ZAV A;  2RIL A;  3RZA A;  3NS5 A;  3PZP A;  4AE5 A;  2DR5 A;  2PE8 A;  4M5H A;  5G0R A;  2LP4 A;  5CYQ B;  1FJE B;  4Z2X A;  3NP5 A;  3VGS A;  5CD4 A;  4UF4 A;  4C4W A;  3K2Y A;  3VAJ A;  1DLO A;  4URG A;  3EGW B;  1ACM B;  4C11 B;  2R7Q A;  1HQE B;  1LEO A;  3T41 A;  4PYA A;  4NPO A;  1KP6 A;  2GZO A;  3IR5 B;  5J2P A;  4DZ6 A;  1NHU A;  1JB0 C;  3HF5 A;  5D3G A;  4ZCL A;  2YX4 A;  1AFJ A;  1IKW B;  3M1V B;  1JLC B;  4TKT A;  4ECS A;  4TYA A;  2HGM A;  2JEG A;  1X5S A;  3EVM A;  5G0R B;  3JTN A;  4KGZ B;  4ECR A;  1XJW B;  1WC5 A;  2BKN A;  2LU1 A;  4OZ2 A;  2V67 A;  3QQC D;  4J9U E;  5L9X A;  2R8G A;  1LWF A;  4GVL A;  3PRD A;  1SL2 A;  1IKY A;  1HAR A;  4HAC A;  2XC9 A;  3BO2 A;  3NLC A;  1FRL A;  2KFZ A;  4QIW D;  3I87 A;  1VBK A;  3LW5 C;  3JTO A;  1C4C A;  1V3S A;  4F67 A;  1PC4 A;  4CP5 A;  2UUT A;  4MJK A;  4J9K A;  1Y3K A;  3W63 A;  1UA1 A;  3OVA A;  4Y28 C;  1VRT B;  1JLG A;  2YKN B;  1CC7 A;  4LBH A;  4I1T A;  4ED7 A;  1HNZ J;  3CMQ A;  5F8J A;  3OJS A;  3C16 B;  1S1X A;  4F26 A;  4LFB J;  4IH7 A;  2PEH A;  1C0U B;  3RRG A;  2GFF A;  1T11 A;  5IZH A;  3KG1 A;  4R5P A;  3ZXW A;  3LAN A;  2YWH A;  1U24 A;  3RAM A;  5K20 B;  1Y00 A;  1VGY A;  2KVI A;  3MAH A;  3ZO7 A;  3D7S B;  5DDR C;  2RB7 A;  2AYM A;  1KKH A;  4DQI A;  2DR6 A;  3HZG A;  4DV4 F;  2ZBP A;  1BC6 A;  3ET6 A;  2MKI A;  1RK8 A;  1BQN B;  1CJK A;  4L73 A;  1NLK L;  3AOD A;  2J0Q D;  4FF3 A;  4I2P A;  1TUW A;  1NKE A;  1N34 J;  4Z7C A;  4ZVQ B;  3D0G E;  1FXL A;  1KS2 A;  2EEY A;  4ED3 A;  2U2F A;  2V68 A;  2VG7 A;  1XMQ J;  2ALY B;  2ZBQ A;  1EAY C;  2J0S D;  2NXU A;  1GFW B;  2CQH A;  3JS9 A;  3QFH A;  3BPS P;  5KFR A;  2B7B B;  4IO9 Q;  2HAI A;  4UOF A;  3FEZ A;  4P2S A;  3KK1 A;  4Y65 A;  3Q8V A;  1H0H B;  4ZPA A;  4FYV B;  1H72 C;  5ETR A;  3JSB A;  3BYR A;  2MLY A;  5AXN A;  4F3O A;  1T3O A;  3W1Y C;  2CJQ A;  2G2Z A;  4GRS A;  4DU8 A;  3LAK A;  5KFW A;  4PRF A;  4LVN P;  2CJA A;  4HHJ A;  4KQZ A;  3SQG B;  2V9W A;  3U1N A;  5KFY A;  4A4J A;  3TAN A;  4QYZ J;  1P9Q C;  5K8P A;  4O0N A;  1N6Q B;  1R27 B;  1BWE A;  2ZHO A;  2FD2 A;  4USK A;  2JLF A;  1KQF B;  1Q95 G;  5KT7 A;  3T1H J;  3NGS A;  1KVJ A;  2ZWO A;  3IS9 B;  2YWW A;  3DHX A;  4P2M A;  2I0X A;  2CIM A;  2HND B;  1B0T A;  2H48 B;  2DNK A;  3PEH A;  4JYA F;  1LV5 A;  1R6Y A;  2LA6 A;  5HL7 Q;  5KFA A;  4O44 A;  1H7W A;  3IG1 A;  3IO1 A;  4ZVE A;  2YPZ A;  1N34 F;  1KLN A;  3P49 B;  3TUP A;  1RHK B;  4I0W A;  2P2C B;  4RUA A;  3BSO A;  1VRT A;  3VV2 B;  1KHW A;  3QBC A;  4ALZ A;  5LXY A;  4DV7 F;  1TV6 B;  2M52 A;  2ZKU A;  2XNR A;  4W98 A;  3SSQ A;  5LXR A;  2HBZ B;  1S1V B;  3P6Y C;  1JK9 B;  1NJY A;  2HWI A;  3AD7 C;  3FEX B;  2CKW A;  4KHR A;  2QMW A;  1CC8 A;  4OZL A;  5DQG A;  4ELV A;  4OZN A;  1NPR A;  1FEE A;  3E8O A;  1XIQ A;  4ED1 A;  2RML A;  5HAN A;  1VQO S;  2FY1 A;  1KLM A;  4JV2 A;  4ZVS B;  1KQK A;  4UQT A;  4X4U A;  2ZH8 A;  3HXM A;  2DO4 A;  3MPY A;  2F1F A;  2F9D A;  1RAH B;  4QWD A;  1YBU A;  4RUB A;  3CJS A;  1HBU B;  4A8Y A;  1JLC A;  1V3R A;  1N5S A;  2WW8 A;  4KHP J;  4DR7 J;  2P9C A;  3FQK A;  4LSL A;  3I0R A;  2G9O A;  5LMU J;  3DMJ B;  5KG2 A;  1AA1 B;  5SZT A;  3RR7 A;  3MED A;  3ZZZ A;  3KLG B;  2R3V A;  3TQ1 A;  3TOQ A;  2EPI A;  3IR7 B;  1YI2 S;  2SXL A;  2FVQ A;  3K5L A;  2PGC A;  3LWM A;  2ZEJ A;  3T1A A;  8ATC B;  1C1B A;  3HDS A;  1UJ5 A;  1DLO B;  4IR9 A;  5D4L A;  2MQP A;  4NCB A;  1TAU A;  2LEB A;  3DDI A;  1VIO A;  1T7P A;  2I5J A;  3D2W A;  3LAL A;  5IOL A;  2WK4 A;  1YX2 A;  2QN6 B;  3CJ4 A;  2JVR A;  1D0E A;  1F0X A;  1Q7L B;  3HSG A;  4MIA A;  4ZP6 A;  3UE2 A;  3VVT A;  2CPF A;  2FHJ D;  2L9W A;  4UZC A;  2PEB A;  2R7X A;  4I67 A;  3MR6 A;  2C2Z B;  1O0P A;  3ITH A;  4HHU A;  2KVQ E;  3FMW A;  2DD8 S;  4QWB A;  2KFY A;  3MM8 B;  4DS5 A;  2Z4P A;  1L3K A;  2ABY A;  5T14 A;  1EP4 B;  2XQC A;  2NR0 A;  4X65 J;  1ZA2 B;  2YH0 A;  1Q79 A;  2XCA A;  1OPZ A;  2ZD1 B;  4X4P A;  1KWM A;  2ZD1 A;  1BUX A;  5HBM A;  1YJ9 S;  4OJ3 A;  5A0Y A;  5HMX A;  4DUY J;  4M5J A;  1E6Y A;  3SI8 A;  2ZVI A;  1YGY A;  2RUS A;  3H2U B;  1MU2 A;  2IMW P;  3MUR P;  2W2N P;  4DR2 J;  2ZJP Q;  4LF8 F;  3AD8 C;  3ULH A;  3I5B A;  4HR2 A;  1SPB P;  2XY6 A;  1IM4 A;  2P9G A;  1C1C A;  3CJ0 A;  2ZE2 B;  2PFF B;  3HSD A;  4KV8 B;  4EUV A;  1F1B B;  1N4L A;  4M5G A;  1MRO B;  1R8H A;  2XM3 A;  2XCP A;  2HS3 A;  3OTE A;  5GVQ A;  4PZV A;  3FSI A;  1JXL A;  1KR4 A;  4B9T A;  3CJK A;  1BQM A;  4KY3 A;  3F73 A;  4DEZ A;  3J7Z 5;  3LA0 A;  2LXU A;  2DH8 A;  2WCX A;  2CQC A;  4FXV A;  5HP1 B;  2VPX B;  2CQ4 A;  2MLX A;  1DUR A;  4MYU A;  4Q2M A;  2H5J B;  2KDO A;  4X84 A;  3ZZO A;  4X4Q A;  4LF6 F;  5IC6 B;  2VPZ B;  3FCW A;  1OQ6 A;  2FLO A;  4DN9 A;  2I8E A;  3GWC A;  4O3S A;  2DNN A;  1Q8I A;  3PR5 B;  2FGC A;  4EYH B;  1K1S A;  3EZ5 A;  4QBU A;  2YWG A;  2XEX A;  4UUX A;  4DL5 A;  1TMM A;  2X1G A;  4M8L A;  1SB6 A;  1B4S A;  1VBY A;  3PHE A;  4NE9 C;  2Z2L A;  5F8M A;  3M8W A;  4MKA A;  5D15 A;  2F4V J;  5GMD A;  3HD1 A;  2LYV A;  5IWA F;  3QPI A;  4BC9 A;  4WFA Q;  3U02 A;  3DKD A;  4IDK B;  4G3I A;  4DPX A;  4QIF A;  4B3T J;  2KXH A;  3KG4 A;  2VG5 B;  2DGW A;  1RAO A;  1D09 B;  4QWE A;  4DL7 A;  1DY3 A;  4NLS A;  4V1A k;  5BYQ A;  4DXL A;  6FD1 A;  5LT5 A;  4USH A;  4ED8 A;  1Q86 T;  2MB0 B;  3IFE A;  2IJN A;  3L9Z A;  4FNH A;  3VGU A;  5M2U A;  2MXY A;  4MK8 A;  2A6M A;  5A0Y B;  5LJ3 Y;  4Q7A A;  4O3Q A;  2Z2Y B;  3OTD A;  3N9U C;  2GGP B;  1B3T A;  2UU9 F;  5IM0 B;  3K58 A;  3SV4 A;  3PRB A;  1Z2L A;  1KTQ A;  2CJY B;  2JEI A;  5J1P A;  1CS4 A;  2ASL A;  1RHJ B;  3D9B A;  1PC5 A;  3MR7 A;  3RJM B;  3Q23 A;  1TL3 B;  3OBI A;  2ZZM A;  2VOP A;  1SC4 B;  3T1H F;  1FRM A;  3C15 B;  4X4O A;  4W4M A;  4DQQ A;  3PX0 A;  4JI1 J;  1ELO A;  2IVF B;  2AP6 A;  1MW7 A;  2H9Z A;  4KPC A;  2M70 A;  4Q5V A;  2FZK B;  4M5L A;  4XO0 A;  1FCA A;  1FKA F;  4C2M A;  2LDI A;  2XZW A;  1T8E A;  2BJE A;  1G3O A;  2HKE A;  1JLE B;  4OI6 A;  5KFH A;  3N4W A;  1J27 A;  1TL7 B;  1HBM B;  5HVF A;  4QIE A;  1T94 A;  1CVJ A;  1BQN A;  3UNG C;  2BE2 B;  1T0T V;  2VKR A;  3CB4 A;  4RLE A;  4A8F A;  4LUB A;  2HHW A;  1P6T A;  2QL5 B;  3DLH A;  3NWG A;  4PG7 A;  3M2V B;  3RW7 A;  2HFN A;  3N5B A;  4ZPC A;  3PXG a;  2H1Y A;  4RNN A;  1TKX A;  3SFG A;  5KFL A;  2YQ1 A;  3QGG A;  1YRT A;  4KB7 A;  2A2D A;  1H2T Z;  4RJV A;  1CJU B;  2OIH A;  1IBM F;  3UI3 A;  2GQC A;  1PAE X;  2MEW A;  2W24 A;  3H90 A;  4WWS A;  2B4V A;  4QR0 A;  2ZH7 A;  2BX6 A;  1HR0 J;  4OYW A;  2B6A B;  3NAH A;  4O3N A;  1OJ4 A;  3IAM 9;  2HHS A;  3THT A;  3MMB A;  1N5V A;  3A4T A;  1F5B A;  1RWW B;  5BYR A;  5LMN J;  1QAI A;  1HNW J;  3W9J A;  2E9T A;  2HS4 A;  2MQM A;  3QO9 B;  4HEA 9;  1HBN B;  2K2P A;  1NU4 A;  3DXS X;  3FCV A;  2WHO A;  1OY8 A;  4K4S A;  4RKU C;  1WI8 A;  2BJ1 A;  1U8S A;  4TXS A;  3KJV B;  2CPX A;  4DF4 A;  4X4N A;  1HNV B;  1LOU A;  2DGQ A;  3CO9 A;  2RHS B;  4LBP A;  3AJ1 A;  4Y3C A;  1OO0 B;  1R8B A;  2NXC A;  2FTR A;  2RDD A;  2UXB F;  2HBR B;  1WC4 A;  2P6T A;  4KE5 A;  2DBB A;  4MKB A;  3PYD A;  3CMA S;  2HMI B;  3R7B B;  3HP6 A;  4FS2 A;  3CSK A;  1IBL J;  1SJR A;  3SQG A;  1PG5 B;  3UQS A;  1G7C B;  1FD8 A;  2FQQ B;  4TLQ A;  4K4T A;  2L41 A;  1HNZ F;  2HZV A;  2B7C B;  4JI2 F;  2EKN A;  5EWG A;  1DQA A;  3UDE A;  5JMN A;  4WJB A;  1RT7 B;  3C6U A;  3U27 A;  5DGB A;  2EK1 A;  3I32 A;  2E5L J;  2O66 A;  2DGX A;  1S1U B;  3N01 A;  3E2E A;  1HWK A;  1R89 A;  1RHQ B;  3H20 A;  1U8W A;  2XSF A;  3W7B A;  1WHW A;  1MWY A;  4Q44 A;  2CDR B;  2K1R B;  2ZH3 A;  3EJM A;  1U1M A;  4B3S F;  3HO1 A;  2JVO A;  2WBR A;  1KBR A;  1FX4 A;  4JBC A;  5GAH U;  4DUZ F;  4DV0 J;  1FT8 A;  4DR3 F;  2ZZT A;  4DR5 J;  2KHD A;  1Y0H A;  5CYJ A;  1KRP A;  2Y0S D;  3UNY A;  3M6V A;  5LSO A;  3M8R A;  1KTV A;  1PO6 A;  3Q24 A;  3DDK A;  2E1A A;  1QD1 A;  2VQE J;  3LF0 A;  4DLE A;  3LGN A;  2QX0 A;  1TEL A;  4X64 F;  1T03 B;  2VD3 A;  2B4O A;  4DX8 H;  1X4E A;  2DIT A;  3K57 A;  1VQ8 S;  3MM9 A;  3B54 A;  2V8H A;  3GIR A;  5CYM A;  1BY9 A;  5DQI A;  3HHL C;  4LFA J;  1YIJ S;  1LXN A;  2VPW B;  2QT7 A;  4CLU A;  4DV5 F;  1FWP A;  2HGL A;  2XMK A;  4V19 X;  3TRG A;  2C3U A;  4L3N A;  4KIA A;  4LSN A;  2ZH6 A;  1WSR A;  4GKJ J;  1EQ0 A;  3MM5 B;  2CPE A;  3DOK B;  2YTC A;  3KLI A;  4J9P A;  1XC9 A;  5D0G A;  5HLF B;  1YSJ A;  2DNG A;  3CGI A;  4H4M A;  3Q22 A;  1WF1 A;  3KNA A;  2XMU A;  1IUJ A;  3OL9 A;  2CZV C;  1HMV A;  1PAU B;  3FRY A;  2XGP A;  2MZJ A;  3HPO A;  3AQO A;  2QE5 A;  3CCJ S;  2XS2 A;  1DHM A;  4ERD A;  3ZTR A;  4ID5 B;  3AJD A;  5RUB A;  2JZ5 A;  1B0P A;  1IKV B;  3GYG A;  4O4G B;  4P73 A;  1NM2 A;  1CQN A;  3RUB L;  3PAC A;  3EIC A;  3VAG A;  1RGV A;  1W2I A;  2CYY A;  4KC5 A;  4DX7 A;  1FX2 A;  1H3D A;  3A8E A;  3FMB A;  2XNQ A;  3R5C A;  3QRP A;  4RW4 A;  3TEG A;  1V3Z A;  1RE1 B;  4JI7 J;  1VQ6 S;  3GV8 B;  3M32 B;  5L38 A;  1X4C A;  3VAL A;  2NXE A;  2YNH A;  3MR3 A;  5K14 B;  3BYP A;  3QSY B;  2UUC J;  1B7F A;  1Y11 A;  4NLQ A;  3I9V 9;  1M5H A;  1RAC B;  2K7J A;  3LGH A;  4ZJQ A;  4C3M A;  5KFD A;  3RTV A;  2K7K A;  4KPY A;  3EPG A;  3G9C A;  3CD5 A;  4RWW A;  2FC9 A;  4C0O C;  5K8O A;  1JIH A;  3H98 A;  3R6L B;  3UW1 A;  5LSL A;  3RAX A;  3N6N A;  1RTD B;  1S6P B;  2RKI B;  3DOL B;  1GX6 A;  2OUG A;  4KSE B;  2BR0 A;  2HVH A;  4P71 A;  4ES2 A;  3M9N B;  2HHQ A;  2E5I A;  3C16 A;  2OEM A;  4AND A;  2GC8 A;  3JAM U;  1R0B G;  5F3T A;  3DOM A;  3HHL D;  2BBE A;  2EXU A;  1YZ7 A;  3J81 Y;  1HR0 F;  3EXY A;  4YDX A;  5J2Q A;  1NK6 A;  3WBZ A;  4Y00 A;  1UKU A;  1ARO P;  1SKU B;  1LW2 B;  1X5O A;  3P96 A;  3QAU A;  3PW5 A;  2HMI A;  1XNQ J;  1RWX B;  1VJQ A;  2R7S A;  2HFU A;  1IKX A;  3CJ5 A;  5B0B A;  3K7R A;  2AW0 A;  4HH0 A;  1NJI T;  4LFC F;  4ZLL A;  1F3F A;  1KQG B;  1T9U A;  4IRD A;  2W1B A;  1ZPV A;  1B99 A;  3MFH A;  1XEZ A;  2LEP A;  3B82 A;  4F0K A;  5CAA A;  2GNK A;  2M4M A;  9RUB A;  4KO0 A;  1VRU B;  3R5B A;  4QWC A;  4CO1 A;  4LR7 A;  1FVQ A;  4USJ C;  4CT8 A;  1VRU A;  4F4Z A;  2D1C A;  2CPI A;  3GCX P;  1SJ4 P;  3NEK A;  4TLR A;  2IJF A;  4FYX B;  1YIT S;  4DR6 J;  3OTB A;  4WBF A;  5HRO A;  5IT0 A;  2XZT B;  2NUU G;  3H59 A;  2V34 A;  3IM9 A;  4AL6 A;  2FJW A;  4K4U A;  4ZDN A;  4WK1 A;  1RAA B;  3PNI A;  2KJW A;  3EVO A;  5A2Q Y;  1LFW A;  3KLF A;  5ETL A;  4BCA A;  1JX4 A;  3OVB A;  3IR6 B;  2J5A A;  2CQG A;  1N8R T;  2OPS A;  2NSB A;  2FY8 A;  2XMW A;  1LK7 A;  1ZS6 A;  4HI1 A;  3W65 A;  1HFE L;  4C8Y A;  1VQP S;  4X62 J;  4WF9 Q;  4H54 A;  1F5C A;  1OY6 A;  4JI1 F;  2F8E X;  4OV6 A;  2HQI A;  2EBE A;  1F2H A;  1XMB A;  1ZA1 B;  2BE9 B;  4ZVH A;  3VWS A;  1S57 A;  3TR5 A;  3MF5 A;  3MMA A;  3QT7 A;  4RNO A;  4B3O A;  2XMM A;  3HVA A;  1EKS A;  4TQR A;  3GPA A;  3M9O B;  3K5M A;  5KFG A;  2DXE A;  3OXL A;  1J5O B;  1EIY B;  3OFE A;  3LP2 A;  3FC9 A;  2QJ3 A;  4DDF A;  1RU2 A;  4X4S A;  2RT3 A;  1UZH A;  5FII A;  1AB8 A;  4NYO A;  4ANE A;  1NME B;  3R5D A;  2VDI A;  4G1Q B;  4NLV A;  3MAQ A;  4UZB A;  3HHN B;  2DPI A;  2IDE A;  5B09 A;  4AL5 A;  2I1R A;  4DV3 F;  1M5O C;  1CUL A;  4C7Q A;  1ZOT A;  4ILM A;  1YBT A;  4LR8 A;  2CUY A;  3D4J A;  2AF6 A;  1VS3 A;  4CH0 S;  1RTJ B;  4OHV A;  3ZTO A;  1ZPW X;  2LDY A;  2GW8 A;  5IXU A;  4WU3 A;  1VBX A;  1Y10 A;  2AJ1 A;  3DLK A;  3SCK E;  3MMJ A;  2JDJ A;  2K3K A;  3RBZ A;  5L1J A;  3MEE B;  3MI7 X;  3BQ1 A;  2BXJ A;  2CQP A;  5DM6 Q;  3T6J A;  4LF9 J;  1SIW B;  2KN4 A;  3WZ0 A;  2DPJ A;  2WVC A;  1N56 A;  2G4B A;  4TU9 A;  3ETM A;  3JQM A;  4OLP A;  5EWF A;  1Q82 T;  2QV6 A;  2B3T B;  3GFX A;  3GLJ A;  5ADZ A;  3AAW B;  2F9J A;  1K9M T;  1X7V A;  1FKO B;  2F8M A;  4KH1 B;  2A1B A;  2DIS A;  3BGR A;  3KUG A;  3RR8 A;  2C3P A;  2CAD A;  1HKA A;  4OLO A;  3V6J A;  1MSW D;  2B5J B;  2QFI A;  1RHU B;  1S6O A;  5HP1 A;  1HW9 A;  2HEK A;  2XI3 A;  4ZHR B;  4RNF A;  1JLF A;  4WFB Q;  2DNZ A;  4R8U B;  3HFZ B;  3PO4 A;  4DSF A;  4M5D A;  1CQM A;  2V8G A;  2L9D A;  3MM9 B;  2R2S A;  1WG1 A;  1RT1 B;  3ZNJ 1;  1YJU A;  2B56 A;  1M5V C;  1VQ4 S;  4IQX A;  4CLS A;  3WIV A;  4NLD A;  3BPD A;  5LL6 d;  4FKY A;  1YJR A;  4WII A;  2MSS A;  5KT5 A;  4IYQ A;  1S79 A;  3N6M A;  3QT6 A;  4NOH A;  2J6T A;  2BAC A;  4K8R A;  2UXD F;  1R0A B;  5CZV A;  2VFU A;  3TUZ C;  4MTP A;  2UP1 A;  5E3Q A;  5J1E A;  2Y1R I;  3V6D B;  2UVV A;  3P45 B;  2JNJ A;  2E5J A;  2DB1 A;  6FDR A;  1FRH A;  2LQ9 A;  2E44 A;  4ZVP B;  3TUI C;  4RW4 B;  5U47 A;  1SC1 B;  3ZZT A;  2J8S A;  2R7R A;  2HQC A;  2QLX A;  1ZAX A;  3BR9 A;  3SYZ A;  1TQL A;  1C0U A;  2OO4 A;  1IBK F;  2J9D A;  2BJD A;  2NUH A;  2UZA A;  4O4G A;  5T7L B;  3RGI A;  1D9A A;  3Q8U A;  4E2F B;  4NEZ A;  4CIO A;  3Q8P B;  5DLF A;  2RF2 B;  1VQ7 S;  1YJW S;  2M8D B;  1VQN S;  1V9O A;  5M2R A;  2EFQ A;  3W3S A;  1GX5 A;  4H4O B;  3E01 B;  4ES1 A;  3HUL A;  2IBK A;  4DR4 F;  1JLQ A;  3ENW A;  3MM6 A;  3TAM A;  3Q2T C;  6AT1 B;  5FLX Y;  2HNY B;  5I3Q A;  3SSR A;  5GAE U;  2E5L F;  1FE0 A;  2V0N A;  2DNO A;  2UV8 A;  4K4Y A;  1VLY A;  3NMR A;  2HVI A;  1GQE A;  4DL2 A;  1UVJ A;  3DOL A;  2W9B B;  1REV B;  4NA2 A;  3DMJ A;  5KFJ A;  1IJF B;  3PG9 A;  5AXL A;  3SZ2 A;  1TFY A;  1ZM2 A;  2CXE A;  3GG1 A;  1NK4 A;  2C3M A;  2BOP A;  2AHO B;  3HCX A;  4K0K J;  4MIB A;  2FJV A;  5D8H B;  4RW6 B;  4MKV A;  2LKZ A;  3KKF A;  3U1M A;  3P8B B;  3MZI A;  3SCI E;  4QPX A;  4GC7 A;  3KLE B;  2E1P A;  1X0F A;  3IM8 A;  3CXC R;  1FJ7 A;  4NI2 B;  1UVL A;  3KLH A;  2HHV A;  4WXW A;  2FHM A;  4QPT A;  2ZJQ Q;  2C28 A;  4ECQ A;  1RT2 A;  2FJB B;  1EET B;  1RZM A;  1SVD A;  3D3B J;  1WD6 A;  3NCP A;  4OHW A;  1BLU A;  5E7O B;  5GAD U;  2ROP A;  4WKR A;  2H4Y B;  3L7U A;  1H73 A; 
#chains in the Genus database with same CATH homology
 4LF6 J;  4LFA J;  4V1A k;  4B3M J;  4LF4 J;  4GKJ J;  4JI5 J;  3J81 U;  4YY3 J;  5A2Q U;  4DUZ J;  2UXC J;  3D3C J;  4LF7 J;  4OX9 J;  4JI6 J;  2ZM6 J;  5FLX U;  4JI0 J;  4LF9 J;  4JI1 J;  4DR3 J;  3R2D J;  5IT9 U;  2UUB J;  2UU9 J;  4JYA J;  4KHP J;  1HNX J;  4X64 J;  4DR7 J;  5LMU J;  4JI7 J;  4JI3 J;  1FJG J;  4DR1 J;  3J7A N;  4LF5 J;  2HHH J;  2UUC J;  1XNR J;  4AQY J;  4DR4 J;  4DV7 J;  4YHH J;  2UXB J;  4RJV A;  1I94 J;  2MEW A;  4HHU A;  1HR0 J;  2KVQ E;  4NEY A;  4JI2 J;  3JAM U;  1HNW J;  5LMN J;  4X65 J;  4KYZ A;  2MTL A;  1N33 J;  4DUY J;  4DV4 J;  1N32 J;  2UXD J;  1HNZ J;  1XNQ J;  4DR2 J;  1XMO J;  4LFB J;  4JI8 J;  1J5E J;  4JV5 J;  5LM7 E;  5AJ3 J;  4B3S J;  4GKK J;  1N36 J;  4DV6 J;  4NEZ A;  3IMQ J;  2KL8 A;  5IWA J;  3J80 U;  3R2C J;  1IBK J;  1IBL J;  4KY3 A;  5BR8 J;  4JI4 J;  4DR6 J;  3T1Y J;  4B3R J;  4X66 J;  1N34 J;  4DV1 J;  4DV2 J;  1IBM J;  2E5L J;  4DV3 J;  4DV5 J;  1XMQ J;  4K0K J;  4X62 J;  3OTO J;  2VQF J;  4DR5 J;  2F4V J;  4DV0 J;  3W1Y C;  4PWW A;  4NXN J;  2UUA J;  3D3B J;  2MQ8 A;  2VQE J;  4LFC J;  4B3T J;  3T1H J;  4LF8 J;  4NXM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...