2KL8A

Solution nmr structure of de novo designed ferredoxin-like fold protein, northeast structural genomics consortium target or15
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
MEMDIRFRGDDLEAFEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OR15
publication title Principles for designing ideal protein structures.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 20
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2kl8A00
4DV4J 2UU9J 4NEYA 4NEZA 4DV2J 4AQYJ 1XMOJ 2HHHJ 4B3RJ 3D3CJ 2F4VJ 4K0KJ 1HNXJ 1J5EJ 2VQFJ 4DV7J 2UUAJ 4YY3J 4X62J 2E5LJ 3IMQJ 4LF4J 1FJGJ 5AJ3J 4LF8J 2UXBJ 4GKJJ 4JV5J 2UXCJ 2KVQE 4X66J 4HHUA 4JI7J 2VQEJ 4LFAJ 3J81U 4JI5J 5LMNJ 4KY3A 4DR7J 1IBLJ 4LF5J 1HR0J 5LM7E 4X65J 1IBMJ 4JI3J 4DV5J 3R2CJ 4RJVA 4B3SJ 1HNWJ 1N33J 1XNRJ 4DR2J 4YHHJ 4DR6J 2UUBJ 4B3TJ 4JI0J 3T1HJ 4V1Ak 4NXNJ 1XNQJ 5IT9U 5FLXU 4JI4J 4NXMJ 3J80U 2MQ8A 4GKKJ 4B3MJ 4LF6J 4DV0J 4KHPJ 1XMQJ 4KYZA 4JYAJ 1N32J 4LFCJ 2MEWA 3J7AN 4DV1J 1IBKJ 4JI2J 4DV6J 4LFBJ 2UXDJ 4DR1J 4DR4J 4JI8J 4JI1J 1HNZJ 4X64J 1N34J 3R2DJ 3JAMU 2MTLA 4DR5J 4LF9J 4OX9J 2KL8A 3OTOJ 4JI6J 2UUCJ 3D3BJ 2ZM6J 5IWAJ 5BR8J 1I94J 5LMUJ 4PWWA 3T1YJ 4DR3J 4DUYJ 3W1YC 4LF7J 1N36J 4DV3J 5A2QU 4DUZJ
chains in the Genus database with same CATH superfamily
5CA5A 1HI0P 4ZOSA 3KWMA 4QWEA 3RGIA 1Y3KA 2W8KA 3RRHA 3QGPA 3JSBA 2CXEA 2QZ8A 2CQ1A 1Q4RA 4HDGA 4KHPF 2AJFE 3OR1A 4WKYA 4OLOA 1HW8A 3I0RB 5J1PA 3O44A 2LMIA 2MKYA 2OHDA 4C3KA 1F3FA 3DU6A 2Y1RI 5I3UB 2A18A 1WORA 2BJ7A 4M1KA 4CT8A 2HK2A 1BQMA 3QSYB 2C22A 4I1TA 4XDCA 1T03B 3QRQA 2FQQB 3GE9A 4U7UK 2CKWA 1TL3A 1DTTB 4LVNP 5KG5A 4YN3B 1LWCA 3UN5A 3IG1A 2VQFF 1IVZA 2B7BB 3THPA 2OP5A 2ZH8A 5CXTA 3TOQA 1LXJA 2FZCB 3U1LA 4WYWA 3OTBA 1GX6A 4B9UA 2BJ3A 3KLIB 2AEFA 4DR6F 5IS2A 1DZ5A 1IBCB 2J7WA 4KGXB 2CJQA 1WF0A 2LXIA 1BLUA 1M5HA 3M1VA 3MM7A 5K14A 2QA4S 4XAKA 2ZUAA 1TKDA 2UUTA 3HX9A 4NA3A 3LWLA 3FFIB 1NB7A 5C25B 5IWAF 2HFUA 4Y00A 1TL7B 2IMOA 3RUBL 1S9EB 2RS2A 1TL1B 4A48A 3RU0A 1H3DA 2MEWA 5E3QA 2GMJA 4ZJQA 3QLHA 2CUYA 4CI0B 1S6PA 1X5TA 5GAGU 2H1YA 1FRMA 4DF4A 1D09B 3DRPA 3OR2B 2I2YA 4URGA 3JSYA 5H9EK 4ED6A 3CDAA 4ANEA 2CJAA 3QT8A 4ZPBA 4UOFA 5KT7A 3CTRA 1YX2A 3HKWA 5F8LA 3MUTP 4NZ0A 5KG6A 3VF0B 4O0IA 1PO6A 4WWSA 3MPDA 3HHLA 3CJKB 3MPVA 2BJ1A 4KC5A 4B9TA 2MB0B 1ICEB 1IR1A 1U6FA 5LMNJ 1P8GA 4DR7J 1ZAXA 2C2RA 3KHLA 2DGOA 4AUKA 3JYTA 2CQIA 5L9XA 2WW8A 1KWMA 3KDNA 3TEHB 4NLPA 2VB6A 4K4ZA 1FEEA 2NYHA 2GJFA 3OTDA 4JYAJ 3UCUP 2UUAF 3NS7B 1V9OA 2YQ1A 2HG4A 2BZ2A 4ED5A 2V8GA 3WQPA 5IM0A 1RWXB 3WIVA 4QIGA 3G82A 3ULHA 2Z56B 3OBIA 3S8SA 3N9UC 3ILIA 1JLFB 3ZTOA 3IR5B 3N79A 2UVVA 2HVHA 3EDQB 3RB3A 4DUZJ 3BO2A 3KLVA 1YRUA 4ECUA 4KR0B 4B3RJ 2GZOA 4K0KJ 1FXDA 1NRKA 2B8QA 3AQPA 1Y5LB 1RUSA 1RTHA 4DL0C 1RYSA 5H9EJ 4BHQA 3FMWA 3QRPA 2D1CA 1UEKA 4ILLA 2V8PA 5KFBA 2KHDA 4HHHA 4DL4A 3ADAC 3VVUA 5F8MA 2VG7B 2G1DA 1MG7A 1B64A 4Y6IA 4K4YA 4OZJA 2D3OR 5F0WA 1BE4A 3BH6B 4ITSA 4WXWA 4TU9A 2R3VA 2ACYA 3FRYA 3C6TA 1NEEA 1CSJA 2KJWA 5SZTA 2MQLA 1SKRA 1RLCL 1SL1A 3H40A 1U1LA 3NLCA 2Y9HA 3NMRA 2XY6A 4LFBJ 4RKUC 1SL2A 1TKTA 2AYGA 3LP1B 2WB4A 4BS2A 4G1QB 3EICA 4DQIA 3W2VA 2UP1A 4JI6J 1DJ0A 2BKNA 4CLWA 4O3OA 4O3PA 2OLWA 3BBFA 5LMUJ 1RTJB 5KFWA 2FY8A 3IM9A 3NBPB 4DPOA 3MM6B 3CNQP 2C3YA 3MPWA 1XMOJ 2FLOA 5DLGA 3DLJA 3SCJE 4ILRA 4CO4A 1URRA 1DARA 1JLEB 4LQ3A 5D0RA 4Y0FA 2HVDA 4OLPA 4YDXA 4X4PA 3FGVA 1MLAA 2H3EB 4OJGA 3VV2B 4V19X 1X5SA 2M2BA 4DCOB 1B3TA 3C15A 3MAHA 1MWYA 3H42A 3VQSA 3AD7C 4ZK7M 1HBOA 2IRYA 3ITHA 4OYAA 2DXEA 5LM7E 1ZH5A 4K4VA 3CUNA 3H5XA 1NHVA 2OH2A 3HLUA 3UD4P 4IO9Q 1X4DA 1FDAA 1K1SA 2XI3A 3P3DA 2IRUA 4QR1A 4QYZK 3UQSA 2ZE2B 3NNHA 2HQCA 2MKJA 3QFWA 4A8YA 4LBHA 1KP6A 3MCMA 3MDFA 1CS4A 2YKMB 3HKZD 3MMAA 4F3QA 3TX8A 4CLKA 3MEGB 3H4BA 5IC4B 3HHLC 1S9GA 4GRSA 1T9TA 2V5HG 3X1LB 3W62A 4CTAA 3MGJA 5KT4A 2DYAA 1RWUA 2IMWP 3CB4A 5D3GA 3AOCA 3FBFA 1F5BA 3A12A 3PW0A 5KG3A 1Q0NA 2NREA 4ELUA 2XMVA 2ZWPA 2HQIA 2M88A 2ZZMA 4H4OA 3J81U 3V6HA 1NSPA 5B7WA 4QJVA 1ULRA 3A8JA 1SQGA 4IOCQ 1FKOB 5C24A 1VQ5S 2WVFA 5CZXA 4J9OA 3DLLQ 1QD1A 4YHHJ 1RA6A 4I2QA 4J9LA 3OXLA 4O44B 2J6TA 4EYHB 1T7PA 4RO0A 3BYRA 3ZZOA 1YZ6A 1YRTA 5B0FA 3FQKA 5B0DA 3J80Y 4S0MA 2Z4PA 4DSFA 3JAMU 1WEXA 3WX4A 4B3OA 2GAHC 4DQSA 5GVQA 3HT3A 1EKSA 1VRUB 2MKSA 4QYZJ 3PTWA 1PBUA 1N36J 2FJWA 4QWCA 4EGLA 4CO2A 3AQOA 1VRTB 2QA1A 1WACA 1NXIA 1PC5A 3IXQA 4RW6A 2AKWB 5KFUA 2WONA 1MROA 4JI8F 4JI1F 4LFAJ 1Y5IB 1T05A 1LEOA 2UUCF 2PMHA 1ZAWA 2NR0A 2A10A 2XHCA 4X4SA 2NQPA 2QLWA 4I2PB 4ED7A 3LUYA 4LSLB 3O8WA 3VGTA 2AX1A 2P9CA 4RUCA 3SV4A 1YJTA 4P7TA 2PI4A 3N01A 3HM9A 1WKJA 1NK8A 2CDRB 3GIIA 2J7KA 3BR9A 1HL6A 4R8UA 1FKAF 2B4OA 4P2SA 4NLXA 6FD1A 3NGUA 2RDJA 3GFXA 5A6WA 1IBLF 4QPXA 2HFSA 2HMIB 1PBAA 2DHSA 1QVFR 2RRNA 1V5VA 4QW8A 1LQ9A 4E8UA 4F25A 4AD6A 4B3TF 2B56A 1DLOA 1IWGA 2JEFA 3P4UB 4PG4A 1RAAB 1UCNA 3IA0A 3IMQJ 4FVCA 1GTHA 2XY7A 2FVPA 3BDPA 2NS1B 2AMCB 3OXGA 4F3MA 4NLDA 5DDPC 1CJVA 4ZHRB 3HK2A 1JXLA 2JX2A 3BGOP 8ATCB 3TZWA 3Q23A 1RLDA 3OFHA 4FYWB 1UWAA 1I94F 2ASDA 1FRXA 1BY9A 2IC3A 1JJHA 1RT7B 1KC8T 2ALYB 1C0UB 2MZQA 4OMFG 5BXIA 3D54A 3BM7A 3J7Z5 2IHR1 3TZXA 2APOA 3K7RA 3KHHA 4NLRA 2B9YA 3IAS9 4P9SA 4OX9J 3JSMA 1K8AT 2V8HA 3EMTA 3R97A 5DGAA 2X3GA 4QOTA 1ZYQA 2BKPA 4N76A 3TAPA 3SSSA 3ETOA 4NXNF 2P6SA 4FPRA 3NY0A 3QBCA 1OQ6A 2VA2A 5F8IA 3AOBA 2BANA 3UR3C 4D3GA 2Y1JA 3A3OB 1MMNA 1YKWA 1MU2A 2PI5A 2X3DA 3R6GB 4J37A 4RW8A 1Y9OA 5I42B 2RS8A 4OZ2A 1U25A 1PJ6A 3DNCA 1F60B 1XNRJ 3HFZB 2Z58B 4ZN3A 4OL8A 5ETPA 3CJ4A 4M5DA 4DCJB 2HW3A 4F36A 1HIYA 4QWDA 2HHTA 1KFSA 1LFWA 4OYMA 4NI2A 5J2QA 3DGVA 4OZ1A 3CJ2A 2VFVA 2FHJA 3GG1A 3M2RB 3OQ2A 2R7RA 3M8QB 4M5HA 2K3IA 4HH0A 3KJQB 2DY9A 3N28A 4J9PA 4JI7F 4Q8FA 2V8DA 4LF5F 2DR9A 4MIAA 5KFHA 1KTQA 1NHKL 4NCAA 2NPFA 3B4DA 2R8KA 4DUYJ 4ZVRB 4G65A 1EAYC 2WOMB 1LWFA 1PYSB 3PDNA 1U0HB 4N5SA 2P5VA 1VGYA 2DK2A 2G1HA 2DGXA 3NGTA 1REGX 3A8EA 2MGZB 3CXCR 1JNZB 4FXDA 3GONA 3LANA 4F4AA 3F56A 2KXNB 3PY8A 5THWA 4HDHA 4DG1A 1FRJA 2G9OA 4ES1A 3WHIA 1QAJA 1FVSA 4NCGA 3G8SA 4U6PA 4B3SJ 3MCNA 3SIPB 1RTDA 3PYDA 1VBXA 3G2XA 5LJ3Y 3SYZA 2C3PA 2OPSA 3C16B 3MXHP 2UU9F 2HNZA 4MFBB 4WFAQ 2DRAA 4GO5X 1CLFA 2IBOA 4B9NA 1FA0A 2QFJA 2RNEA 5HSPA 4LMZA 1NK6A 2BDPA 2BVZA 3F0NA 3AOAA 5LXYA 3OFEA 4K2XA 5HN0A 2AHOB 1NJWA 5GAHU 3FBEA 3PIPQ 3ENWA 1QUPA 3DU5A 5E3PA 2CPHA 3RB6A 2VG6B 2W9AA 4ZPCA 2YKAA 4TY8B 2B43A 2KB2A 1S97A 4WU3A 1VQNS 4DV7J 4FYXB 1UJ5A 4UZCA 2DGTA 4LF6F 3KMQA 2IIHA 5BJRA 1HBUA 1M5KC 3KLFB 3OUYA 2KZMA 4RLEA 2VQEJ 1WKKA 4UOCA 2RAQA 1C4AA 5JJBA 1IBMJ 3FEZA 4IRDA 1IKXA 2RMLA 3KLHA 1FDDA 3CDWA 1SUQA 3LTOA 4CLPA 4DQQA 3T5JA 2XMUA 4YFUA 1Q79A 2COLA 3WIUA 1RHQB 2RHQB 4EBCA 3K5NA 1VHFA 3KHRA 3MEEB 1AB8A 2PFDA 2DNYA 3OL9A 4YQWA 1QAIA 2AJ2A 1VQ6S 2UXDJ 2W7OA 1S5ZA 4JUZA 3CO0P 1OMSA 5K8MA 2B9XA 1MW7A 3AFGA 2FLPA 5CABA 4B17A 2C28A 2Q1LA 1NZ8A 2H4YB 1KN6A 1N0UA 3AHPA 1ZM2A 3QPIA 3C8YA 2CPIA 4C0OC 4OZ0A 4DMZA 1NH8A 3VAKA 2YPZA 1HD0A 1U48A 2W4DA 2FDNA 1DBDA 1NZAA 3QGIA 1S1UB 3ZZUA 1PG5B 3Q8PB 1XR5A 4DV6F 2DPIA 2CQHA 3MOJB 3Q2SC 1FESA 2XYGB 3IS9B 5IQ6A 3RB0A 1AFIA 3DMJA 2HHQA 2YY3A 1VBKA 5KFSA 5L1JA 5K8OA 2XZWA 5HK4A 3L09A 4B9MA 5K9FA 3ISZA 4HTIA 3W5XA 1HA1A 3B78A 3FC9A 3I96A 3Q8QB 1X4EA 2Y1IA 2KFYA 5F8NA 1VRQC 3D0IE 3W3SA 1AYEA 1RGVA 2FTRA 3KG4A 4B9LA 5AJ3F 3DOMA 2ZH1A 3I5AA 3CDEA 3V6DA 1FXLA 1F6TA 3QJLA 1N5YB 1FFGB 4KQZA 4X66F 4YMEA 1LW2A 4MT1A 4C48A 1P1TA 5HROB 1KBRA 4ZITA 1SQEA 3DOLB 1Q1KA 4EWTA 3RJMB 3K0JA 5ETKA 2DIVA 5F9NA 4BLGA 3V4IB 2BJ9A 4CLLA 3OFFA 2NCKL 2VKRA 2LXUA 4NWBA 4L3NA 2YTCA 4K4TA 1FRIA 2C3UA 3MFIA 2F9DA 4JBCA 4C8OA 1NJIT 1WC4A 2J9CA 4USJC 2DNQA 3VCDA 4JI4J 4NXMJ 4I7FA 4WK3A 2OAUA 4ILMA 1IM6A 2B0GA 1C2PA 4AQYF 4M94A 1NM2A 3LGMA 1IKYA 5K20B 3PRBA 1J5OA 2DD8S 4DR4J 4Q43A 1S1VB 1I1GA 1EP4B 2AWZA 1RT5B 1Q7LB 3GWCA 3KK3A 2ZBQA 2PN6A 3MM9A 3G6ES 3ZTQA 1CPZA 1LWEA 3MUVP 2RUGA 3P8BB 1RAJA 1HW9A 2OPPB 5CYJA 2OGUA 3Q8UA 5LSLA 3T9NA 2MQPA 5D4OA 3UNYA 1M5OC 5DRKA 3R6LB 4KGKA 2EVZA 1YJUA 3QIPA 4A47A 2AQ4A 2CWKA 2HIYA 3R27A 5J2PA 2K1RB 4AL7A 2CJ9A 1APSA 4JV5J 1VMBA 2LU2A 3BN7A 2DBBA 2BJDA 2R8JA 4UOHA 1T0TV 3MM8A 4LF9F 2M8DB 4C3LA 3D4JA 4RJVA 2YNFA 4EYIB 4ZVSB 1AZSB 4RNHA 5IT4A 4CP5A 3MMBA 3IBWA 4PPZA 4QIWD 2B6AA 4DFKA 2VBWA 3DXBA 2RSQA 3TAMB 4AE5A 5J2NA 3PNIA 3TEGA 3CD7A 2QYGA 5B09A 1JNRB 1TVRA 4Q0BA 1HQEB 3MMCB 3AY0A 5L1KA 1LV5A 2LVWA 3BB5A 1IKWB 1U2CA 2RE1A 1JLAA 2FIUA 5M2RA 4JP8A 3LF0A 1VQ7S 5A2QU 4ECTA 3M30A 3DFEA 5GAEI 3CD5A 2DH7A 2CG8A 4GO7X 5CAAA 1TAQA 3POTA 2GGPA 3DXSX 3AA9A 1CJKB 2G2OA 5FDLB 1KS2A 3IC1A 1CG2A 1REVB 2CQDA 1HNZF 3CDBA 3Q86A 1YRXA 1NSKL 2HBYB 4DV5J 3W7BA 2VZ9A 1SKSA 1YQHA 3D28A 1RA7A 5E0OA 3HVTB 3CE8A 4LT6A 4KHRA 5A76A 3DDKA 1S1XA 4IDKB 4J91A 1CJUB 1Q82T 4HYKA 5IC6B 3GPAA 3IBCB 4ZVOB 4URQU 2C2OB 4A4JA 2ZH3A 4JI2J 3M6VA 4L74A 3UN3A 1AA1B 3D9BA 2F1FA 3D0HE 1BQXA 2H51B 9ATCB 4KV8B 2B4VA 1EJ7L 2HWIA 2QL9B 2CIMA 2CPYA 2LEAA 3CJ5A 5G4DA 3QWUA 3L95X 2I1RA 4FS1A 2ADBA 1RT1B 4M5MA 5E5NA 1S9FA 1RKIA 3GIKA 1R89A 4UQGA 4QR2A 2A2DA 5GMKa 4AL5A 3OR1B 4ZVUB 3D1QA 2V67A 1KHWA 1UVKA 2DISA 1BGXT 3UO0A 3NWGA 3OL7A 1L3KA 4FZVA 4DSKA 3IRXA 1D8YA 3N4WA 2VIHA 2BX6A 4CLSA 4ZMMA 3K5MA 4RNNA 3KK2A 2FY1A 2XSJA 2ATLA 2VDIA 1U6ZA 3NKYA 4OYXA 3RRKA 3PJWA 1B7YB 2PFFB 3TJ9A 3JTPA 2POKA 2RDIA 4F4KA 3H8YA 2ABYA 3IR7B 5SUHA 2R7WA 1ZZFA 2QSFA 2X1GA 1WG4A 1QSLA 4R5PB 1GX5A 2RU3A 4MIWA 1KQSR 1SIWB 3PRDA 3GYGA 1UKUA 2VOOA 4ELTA 4HI1A 1JLQB 3E01B 1TK0A 4Y2CA 2QC3A 3BBCA 3M1VB 2IAJB 5L46A 2DNNA 1HPZB 3HPOA 3K57A 2ZVSA 3MM7B 5K14B 2YKNB 1U26A 4LSNA 5LSRA 2J0SD 2X1AA 4ZP9A 3D67A 3TWZA 3NCRA 4YP3A 2N7YA 1OO0B 4U7CA 3LGHA 4RUAA 2L9DA 4L76A 2AYEA 1ITPA 2LEBA 3KNAA 2R4FA 5B0CA 2N4CA 2VPXB 4TQRA 5B0BA 4A46A 3QLHB 3ENQA 2IYGA 1JLGB 2JLFA 4A8KA 3DM2A 2M52A 1FD2A 2YNGA 5HP1A 4XDDA 4B08A 2VC1A 2J0QD 5A8WB 4WFXA 2PC6A 3MCSA 2OMLA 1LK5A 1RQ0A 1SC6A 2GHVC 4MK8A 1JXVA 1RP5A 2BRLA 1WHXA 2RH3A 1JB0C 5ETRA 3BGFA 2FGOA 3PJ9A 2MLZA 3TI0A 4WTYA 3CMAS 1DTQA 2IVYA 4QR0A 5A8RB 2HRYA 4G3IA 5F8GA 4LF1A 1UVNA 4DV0J 4J7CA 3W61A 2KG1A 4TN2A 4JV0A 5IV3A 2R8IA 1RCXB 2VHGA 4ZS6A 1VC0A 3U1NA 2MPUA 2KM8B 4OHWA 2W24A 3KLGA 1TKZB 3CVKA 1S6OA 2CPDA 3KJFB 5E2QA 3JQKA 2WVBA 4IRKA 1S7IA 2AZ1A 1J27A 3H2VE 1HBMA 3QZ8A 5KAKA 2E1AA 2CQ3A 3K2YA 4DV2J 2CQ2A 4WFZA 4PG8A 2HHVA 4HKQA 3DDNA 1GQEA 5D6GA 2E1CA 4H4MB 3KYLA 3BO4A 1YBAA 5DETA 4HEA9 1NDKA 5E41A 2YX7A 1M1HA 5I4MA 3CCJS 4RWWA 2VBZA 3OVSA 1VQKS 2QL7B 3JXOA 2HHPA 1NKCA 2PEBA 2RIJA 1ROFA 4ER8A 4HH1A 2OEKA 4W4MA 3DLEA 3L7PA 5CD4H 2GO9A 1U02A 4FKYA 4GKKJ 5C5JA 1MWQA 3W2WA 5GMEA 2QSWA 4FYVB 4LF4F 1VJQA 3OT9A 3Q89A 2FUG9 1GT8A 3C6TB 3CCTA 5CYQA 3NNCA 3N0VA 1XR7A 4AXJA 4OV6A 1TK8A 1RT6A 1TKTB 5KG2A 4N47A 1C4CA 3HD2A 3HI9A 1YTYA 5A6PA 4PWWA 1PJ7A 2HVZA 3UD3P 2F40A 3W2VB 2DT9A 4ATNA 1R0BG 1S0NA 4ZJOA 2CPJA 3BKFA 1RWOB 3CCVS 5IXUA 3SFUA 4U67Q 4C3MA 4EZ9A 3A1YG 2XNRA 2E7VA 2V0NA 4MKVA 2VD3A 3OTCA 4ENOA 1AUSL 1AW0A 3R1LA 5CH7B 2F8HA 3I5CA 1TR0A 3ITHB 2XMAA 4CO1A 4DV3F 3BREA 3FDSA 4DV4F 4WXOA 4WFNQ 4NL5A 2F4VF 3DCAA 4O3QA 5IOLA 3HMJG 2P9GA 1GMWA 3G71S 2MY8A 3T6BA 1TMMA 4RNOA 4ZLPA 2MQNA 4L73A 4DR3J 2XMKA 4C11A 4CNYA 1L3SA 4IUFA 2I0XA 2WCXA 1FO1A 3LP2A 1I51B 2K3KA 1HNXJ 2W25A 3DI6A 3W65A 4X62J 4OI3A 3GR1A 3GIMA 4PWDA 2GJ2A 1CQNA 1N32F 2ZH7A 2HVEA 1BQNA 2U1AA 1WTBA 3MURP 5EWEA 2J6SA 2W4PA 3HT0A 1VQ9S 3PHEA 2YWKA 4X62F 3HJFA 4NYPA 4KGZB 2XG8A 1FK9B 3RW7A 5L38A 1KOHA 5IT0A 3MPYA 1XMBA 5C24B 2N3LA 1T3OA 4JV2A 1R0AB 2W2PP 4RNMA 1P1LA 3N6NA 2W8LA 1A9NB 4LFCJ 1KOOA 1WI8A 1S1TA 2Z30B 2HAFA 1VS3A 1SJ4P 2BOPA 2IA0A 1UTAA 2CJYB 2HNDA 3UN2A 1NB2A 4QU7A 5J1EA 1U49A 4EU0A 3LW5C 3KJVB 3I6PA 2DH8A 4DF8A 1H6KX 3S6EA 1FEHA 5BR8J 3EVOA 5IQQA 5HLFB 1VK3A 2NYIA 1TV6A 3EPGA 1SKUB 4B3OB 4I6WA 4USTA 4P10A 2K06A 3IN5A 4PYDA 1E6VA 2FJVA 4DL7A 2XY5A 1T02A 2OD4A 3JQMA 4OQJA 4QPTA 2MZTA 5HANA 1R6VA 4RX6A 4RU2A 1G6BA 1FX2A 4KGVB 1T3NA 1X60A 3GJSB 4RW6B 1L3VA 4WJBA 1U7LA 1IJFB 1RCOB 2C2ZB 1H2VZ 2WONB 2JEGA 2YBVA 3M2VA 1MROB 2IBKA 2YQ0A 1VQYA 4DDFA 2ZOGA 1JWWA 2BUNA 4F2RA 1UJ4A 3EZUA 2I6WA 5KOXA 4DWIA 3QMQA 5FLXU 1B0VA 4FXWA 1SH2A 2IPOB 1RT3A 2YVSA 4C9DA 2H48B 2VASA 3LO3A 3EVMA 4WPAA 4F2SA 2B5JA 2X7IA 3CCSS 3PW7A 2XWXA 2D69A 1VFJA 3Q8RB 3KLEB 5HBMB 1FDBA 3UDVA 1FI4A 1U1RA 1QUVA 1IWAA 3VR1A 2VG5A 2WSEC 3GFHA 1XJWB 4K2JA 2FHOB 4K59A 1GK8A 4PXEA 3HVWA 2DJWA 2R7TA 2OUGA 2AD9A 5J1NA 4OJ1A 5DO2A 2C3MA 3I0RA 3K5LA 3FMBA 1ZETA 1KNZA 3R2CJ 2KXFA 2XGQA 3EE3A 1F9HA 4BC7A 1JK9B 1CJVB 2PO4A 2XQCA 4MH8A 4ZIVA 2QA2A 3P6YC 3GFYA 5E3CA 1T03A 1C1CB 3R9LA 1WI6A 1B7FA 4OX8A 2OKQA 2J5AA 1IBKJ 2J9EA 2DNLA 1NPRA 3OHBA 2V2ZA 1WDDA 1SV5B 1H72C 3PW4A 3B6BA 3ILLA 4RL1A 1RAEB 4JI5F 4CDIA 2CNNB 4C98A 1HHTP 2HPUA 1SIZA 3NGRA 1X5OA 1JMTA 1NU4A 4ALZA 1QTNB 1WG5A 3TARA 4DV1F 1WHVA 1KKHA 4J9QA 1XWLA 1LXNA 3QIDA 2BQUA 3DLBA 3D0GE 4C8KA 2WAQD 4DN9A 2BRKA 3OTEA 3UD5A 1MU2B 5HO4A 3MCOA 1QDUB 4RW8B 1VJWA 1HBNA 4ANCA 1FX4A 4KJIA 1TL7A 1BWEA 1S4EA 4KSEB 1VQPS 4M5DB 2OTJS 1S9EA 2MY7A 4K5SA 5D4LA 1YLXA 2OPRB 1H2UX 4F7VA 1VQMS 3P49B 2JOQA 5ETNA 2Z2ZA 2DNHA 3BH7B 4OJHA 3D2WA 5HQLA 4USVA 2YXLA 2VDHA 4J5OA 2BA9A 3A8KA 4FP9A 2JEIA 1GTEA 2GCFA 4FPIA 1YJRA 1WHWA 3OLBA 1LWFB 2LU1A 3MAAA 1Y5NB 3EDRB 2XS2A 4M5KA 4P71A 2V50A 3CIZA 4C4WA 4LRAA 3QWPA 1KQFB 2WVEA 1VOMA 4DG1B 1N33J 3ZXWA 1B0TA 2UUBJ 2DY1A 5HL7Q 2CADA 3A8IA 1I3OB 3ICLA 1FE0A 8RUCA 1VLOA 1RTDB 2ZJRQ 4PG5A 1TAUA 4Z2XA 2QIFA 4KH0B 4C7QA 3T6JA 1U09A 3H0PA 3HJVA 1WOPA 4YEAA 1FT8A 2OMOA 2KL8A 4I0WA 4F4ZA 4OHYA 1UL3A 4B9VA 2JDJA 5A0YB 3FJ2A 1GFWB 4UQTA 1K9MT 4JI0F 2XYHB 1SJ3P 2PE8A 1VC5A 2O66A 2R2TA 2IJNA 3SQGB 3N6MA 4OYBA 2IRXA 3PR5B 4LF8J 4FDFA 3M9MB 2VV5A 1U1QA 1XEZA 4CH1A 1SKWA 4WP8A 2KVQE 4HHUA 1Q78A 1FJEB 2RU9A 3H90A 1KLMA 4NRUA 1N48A 2AYBA 3JQJA 3EUNA 1CC8A 3CDUA 1X4FA 5HMZA 2A2CA 4LF2A 4USWA 3TVZA 2HZAA 2NZ4A 1YBUA 4HI2A 2WW4A 4QCLA 1JLCA 1RWKB 1IKXB 3KLHB 4DPUA 2F7VA 1HI8A 1SUQB 2PGCA 3GLJA 1KEKA 1VBYA 2CQPA 1N34J 1RBAA 3KG0A 3L9ZA 2WSFC 3D3BJ 3LP1A 1JLBA 1HR0F 3HULA 2C2DA 4G1QA 4Y65A 4JI3F 5A8KA 4RZRA 3PYEA 2XTJP 4ZN1A 2XWYA 2W9CB 4DL6A 5BYQA 2VUGA 1JX4A 2HQGA 3EGZA 1RTJA 1TUVA 3MTJA 4YB7A 5AXKA 4DX7A 3NBPA 1R43A 4J9SA 2P9EA 3M8PA 1N52B 2Y0SD 4XK8C 2XMMA 3E8OA 3DKDA 2W2NP 2XLJA 1JLEA 2KYZA 1CBKA 4HVZA 4RWXA 4EZ6A 2CYYA 5LXRA 4DFPA 4ZLJA 3FQLA 4A8XA 2HLTA 2MSSA 1RZMA 1HNWJ 3EZ5A 4ZCLA 4KTQA 2CAJA 4FNIA 2RRAA 4LF7F 4NYOA 1SVDA 3DMJB 1B70B 1Q5YA 2FZKB 3PW5A 4KHPJ 5LT5A 4XO0A 3T5LA 7FDRA 1HNVA 5KFEA 3GR0A 3O1LA 2ROEA 2P8IA 3DOMB 3AB2B 4X65F 4B9SA 3V6DB 2V2QA 4UOGA 4DSJA 2MJUA 3THVA 1SC1B 2GNKA 2KU7A 3M32B 5D15A 1FXRA 1LW2B 2AEMA 1BUXA 5DG8A 3IRWP 5KFQA 1RAOA 3MEGA 4HLBA 2ZJQQ 4IFVA 4TU8A 2YWFA 2VQFJ 2AJ0A 1V3ZA 5EWFA 4CRJA 3PRVA 1BMQB 4H54A 4M8LA 3SCKE 2BABA 1SH0A 1KQKA 3GIRA 2VF3A 4XIUA 1TL5A 1X7VA 2F65A 2QLFB 2CNOB 4ICLA 2ZM6F 1ZA1B 3O2IA 1E6YB 4DR6J 4J9KA 4O4GB 1HQUA 1LOUA 7AT1B 4XPCA 4AFFA 2BW7A 1YG0A 3MM5A 1J5EF 3ISNC 2ZKTA 1C0TA 4O44A 1UFLA 4ED3A 1LK7A 4I7FB 3M8ZA 2BE2A 1VIOA 4HR2A 2IA6A 3K5PA 4ANDA 4OI4A 1BC6A 3PR4A 4WP3A 2LDIA 3J7YI 3FCHA 1S6QA 3RB4A 1Q7YT 4MTPA 2V4JA 3DC2A 5IWAJ 4WK1A 4W98A 2ZZTA 1U24A 3KK3B 1EKRA 2ZDPA 4CT9A 3GCWP 4NZ7A 3MMJA 1IKVB 4F50A 2YPYA 2MZRA 3GSDA 3R8YA 2OI2A 2MKKA 3DYAB 4NE9C 5MLCV 4YOEA 2CNKB 2A6MA 2WBRA 5HMWA 4GC7A 1RBLA 4OHZA 1VRTA 3RRGA 2Y8WA 1FRKA 1SJRA 2J9DA 2Z2MA 2B8PA 4F04B 2OFHX 4DR5F 4DSLA 1U1KA 3FSYA 1KONA 1RAGB 2DHHA 3SZ2A 3F44A 3IAM9 5D0GA 3J81Y 3FRZA 2CNLB 3FCWA 2VU5A 2YNFB 4I2PA 1XQIA 3TVYA 4QWAA 2G13A 2QV6A 5DG9A 3TUIC 1EARA 1SPBP 2VFSA 2Q6BA 1S12A 2UXBF 3TO8A 3DDIA 4USMA 3OVBA 1X4GA 3OVAA 2VOPA 4IH6A 5DS7A 1TVRB 3CCES 4KKOA 3PO5A 3JAMY 2V34A 1IM4A 4KRWA 3ZO7A 1NUEA 4DR2F 2HMIA 5KFDA 2E5GA 1FTRA 5JVGQ 2HKEA 3PVXA 1QM9A 5H1SV 2UUAJ 3KJNB 2WBMA 1W7WA 2EFGA 2MZSA 2BACA 2ZDOA 3S7RA 1N0VC 3QJJA 1ZOTA 2ZH5A 3CCWA 4QU6A 5U47A 2RF2A 3TA1A 4ERDA 2ZWOA 2IM3A 1NAQA 1YJVA 4UY85 4IKAA 2XS5A 4M5JA 3CIMA 2R2UA 4PABA 3M05A 3NS6A 1R8AA 3DRRA 2OPQA 1FNMA 2HVIA 2HHHF 2G4BA 4BC9A 3FKBA 1RACB 1NLKL 4YY3F 4F4YA 1C0UA 4ED1A 4Q7AA 1S1XB 4C8MA 2DXDA 4X4QA 2OEMA 1GXUA 1Q8IA 2XCAA 4GVLA 3DRSB 7FD1A 2LQJA 2DGSA 3CC4S 3I9ZA 4LR7A 3W64A 2HRUA 2JLEA 3MR7A 1S99A 4DZDA 3BKUA 2LQ5A 3L4BC 2YNHB 1RXOB 2F63A 2HGLA 2R8GA 2HSEB 3ZFVA 2GHPA 5HJYA 3R5CA 3ZZ0A 1MN9A 1P9QC 4RR5A 2CJXB 1QSSA 3NOCA 2HBZB 2BJ8A 4NLTA 2EI5A 1S6UA 2KDOA 5I42A 1KHVA 5FJ4A 1RSCA 4DCPB 5C7PA 2OFGX 1FWPA 1LFPA 5DZ6A 2RHSB 3AAWB 2EKYA 3N5FA 4KYZA 4AT1B 2H9ZA 2VFRA 4NYZA 4NA2A 3NGKA 4ECWA 3NEKA 2OEJA 5DZ7A 3TJ8A 3M8QA 5DG7A 2BR0A 4EFAC 3H25A 1LKZA 3W60A 1EHWA 4NA1A 2X1FA 4NMXA 1SL0A 4RUHA 4WZMA 2ZD1A 2XMJA 1XNQF 4WF9Q 5KFAA 3CMQA 2B9EA 2WOMA 1G7CB 3HHKA 3Q0AA 4NLWA 2MGZA 2LQ9A 5LSOA 3THTA 2DCUB 2DHXA 2UVRA 4TLRA 2L41A 4MK7A 5HAOA 1OYDA 3LAKA 1YK9A 2AEJA 1L3TA 4ZVPB 1FNXH 4WE1B 2JRSA 5IT9U 5DDQC 1NHUA 2KJVA 3G96A 3G6VA 2ZBRA 2ZITA 2OD6A 2KZZA 1FF2A 4TXSA 1BD6A 1ZZNA 1HNIB 1C1BB 1FJCA 2LLZA 4L75A 4PXCA 4CQ1A 4DPXA 1NMEB 2P2CB 1YWXA 4G1PA 3DOKA 4KT0C 2OTLS 2CQ4A 1O6XA 2EBEA 1WOSA 1DQAA 5CYMB 3H2UB 2XMTA 4F3OA 4JB8B 1L3UA 4G6VB 2OSQA 5HMYA 1LW0A 2VG6A 2HS0A 2Q6CA 4A8MP 2V9WA 2D9OA 4TY8A 4WIIA 1S7HA 2MXYA 1FCAA 2PSZA 2JL9A 2JHEA 3T19A 3NAIA 3OL8A 3KLFA 1OWXA 2YNIA 1UA1A 5T14A 4CYUA 2EC0A 5LOQA 3QGGA 3OTOF 1MMLA 1RU1A 5HMXA 3V4MA 1HWKA 3US5A 4PCQA 3CJRA 3SI8A 1DHMA 4JI8J 4BWMA 3MEEA 4JI1J 2PT0A 1X9MA 2UUCJ 2AGOA 5JUMA 3DLKA 1X4CA 1NDPA 2AIRB 2WHOA 3ETMA 4QIEA 3KLGB 3T1HF 4LIRA 3TJAA 3CC7S 5HVHA 1UW9A 4CO3A 4MMOA 1HBMB 1HYSB 5D8HB 1M5SA 2BJEA 2ZNYA 4LRBA 4B02A 3TZYA 3CULA 3KTQA 3V81B 3HVRA 1U2FA 1T11A 1IBLJ 1VIXA 1S1UA 4WIQA 4L6V3 1OQ3A 4EK2A 2M8HA 2VONA 4MYUA 1U45A 2IM2A 5L1IA 4B3TJ 2GC8A 3PW2A 3LOUA 2MSTA 2FPHX 5J2MB 3KG1A 1OS5A 3VGSA 3K58A 4IRCA 3WDOA 3VWSA 2JEJA 2RDDA 3TUZC 2HYIB 1QE1A 4M63A 3BSAA 4TLQA 2HLUA 4RUBA 2LQ8A 5DM7Q 1FDNA 1NJXA 3MEDB 3PCOB 2FZGB 3CO9A 4LREA 1N5YA 3T5HA 3G8TA 1I94J 4CM0A 3QT5A 3TANA 3BSOA 1D9FA 3GV7B 1RT6B 3HCXA 1EIYB 4IQXA 5AE3A 1HI1A 4PAAA 3L7OA 4P7VA 3CSKA 1JQGA 2IM1A 4IFYA 1HHQA 4MKBA 3H2LA 4R0JA 1S72S 3IWNC 1RTIB 3V4IA 2YKQA 3SXLA 1U1MA 1Y00A 3FEYB 3V5RA 1H2TZ 4USHA 1RABB 4IR1A 4I67A 2EK6A 4IO1A 1K0VA 3CT9A 1ZM3A 3FK4A 2MHNA 2UZAA 1SBRA 2HWTA 4NXNJ 1S1WA 1KTVA 4UZBA 4DHVA 1TZ0A 3EM1A 1WDTA 1B99A 1WWHA 1RB0A 3CGIA 2E5LF 1FJGF 2NXUA 2I8EA 4N8OA 1KLNA 4V19J 5DGBA 2JJ4D 4CCHA 2XB2D 2RQCA 4D3HA 4DL2A 1EP4A 1RT2A 3ZZRA 3W63A 4Y3CA 1JKHB 2IVFB 3MR2A 1NO8A 1U4BA 1F1BB 5KFNA 4URSA 3HP6A 1M5PC 2CA9A 5L8RC 2DR5A 4B3MF 4YR3A 5ETTA 5KFJA 3NNAA 2F4FA 3ZC4A 4DR1F 2J9DE 3DI6B 4JI7J 4X64F 1EETA 4LF5J 3EXCX 2HHWA 4KAIA 1CJTB 2DKOB 4RW9B 2EWHA 2KI2A 1UZHA 1PAEX 2VFTA 1TUGB 2AX0A 4WYLA 2Z0GA 3RAMA 2E5IA 3RBEA 1AZSA 2CVIA 3IBFB 1VI7A 4F0MA 5GADI 1XN9A 4DI6A 1PILA 1PKUA 2DCLA 2O3DA 5KFKA 2V68A 2CPXA 4K4XA 2E1RA 2V6AA 1RDRA 5DQGA 3TAMA 1SC4B 4DLEA 1EQ0A 2DNMA 1U1NA 1S1TB 4PUOA 2J0XA 3MMCA 2GMHA 5G0RA 3DLHA 4P2XA 5KFMA 2NSBA 1RHJB 1XTZA 2BEFA 2UU9J 1S0OA 4MAKA 6FDRA 1NNDA 2KFZA 3UI3A 2ZUGA 1U2RA 2V8VA 3MECA 1LWXA 1XMQF 1N6QB 1OJ4A 3Q22A 1NKBA 1NSQA 3DRYA 2HS4A 2EFQA 3SV3A 1CJKA 1KDNA 5EGYA 5FDLA 1HARA 3LP0A 1AUDA 2FJEB 3H5SA 1REVA 1HWIA 2EFOA 1WNEA 3QGHA 2QLBB 2HBRB 1WSVA 2GVZA 1TTHB 3C3LA 5KFCA 4V1Ak 2QG9B 3LGNA 1RAFB 3M2VB 2D3O1 2RKIA 4Y2IA 1SJ1A 2I5JB 4LF6J 3BDEA 4OI2A 3CJQA 1KSPA 3CJ8A 2DNPA 1Q16B 1CJUA 4GKJF 3GTYX 4WTOB 3TVKA 1T8EA 4Z37A 2W9BA 1AFJA 1UWBA 1YI2S 3GILA 2OO4A 4LR8A 3P45B 1Q53A 2B5JB 1N8RT 3TZZA 4OZ5A 5T7LB 3B82A 4U95A 2XLIA 2Z2YB 5HVGA 2F5GA 4DS4A 2HRTA 3KHGA 3KOAA 5A2QY 5DM6Q 3C6UA 1RT1A 2H5JB 3K5OA 3PJXA 1IQTA 2PD1A 2KG0A 4Z7CA 4X4OA 4P6QA 1HD1A 3UCZP 3MF5A 3JTOA 3WZ0A 3N5BA 3T1YF 1WC1A 1O0PA 2GVDA 4X4RA 4DSEA 5C42A 1IR2A 4P72A 2KH9A 3CC2S 2ZEJA 3R7BB 4DBQA 2EBGA 1DFDA 1Q95G 1T9WA 3D6MB 4HHJA 5EX3A 1ZPVA 4ID5B 1FVQA 4DV6J 4PG6A 2N3OA 3BGRA 4Y2AA 1H73A 1Z1ZA 2GW8A 5ETSA 5DQIA 2HZVA 1WOOA 3D1HA 3U1MA 2XI2A 2HQDA 3IGNA 3K8WA 3MD1A 2ZH4A 2HHUA 2DR8A 1UMJA 3MTKA 1KQGB 1TFWA 2KRBA 4U9RA 2MQMA 3D1OA 5KT2A 3MR6A 4DQPA 3W5ZA 3UNGC 4ES2A 4KGMA 5AJ3J 4R5PA 2NXNA 3BV8A 2FJAB 2DIUA 4X66J 5CQGA 4ZCKA 1JLQA 5B0AA 5ETOA 2GIQA 5CCMA 1RWVB 1N5QA 3E01A 4Q2LA 3LAMA 3QNWB 3RR7A 4AYBD 1D3WA 4RW4B 4DL3A 2L9WA 2IAJA 3ZZZA 2R7UA 1HPZA 4CLTA 5E3AA 4IG0B 3EWGA 3NGDA 2YKNA 1Q81T 3LALA 1HBNB 2M0GB 4PQUB 3LA0A 1G2EA 5JVHQ 1TKXB 3ZZPA 3CD6S 2A3JA 3I0SB 5ETLA 3V6KA 1UEUA 5DDOC 1VQLS 2JFDA 1FKPA 3D66A 4CH0S 4ZCMA 2C2NA 4OHXA 5ETMA 2GIFA 4ECZA 2BV3A 2E29A 1JLGA 4KO0B 1WHYA 3ZNUA 4AQYJ 3M6XA 2GQ2A 2NUHA 3M2UA 5D77A 3Q8YA 1VISA 4R0EA 3BKTA 4KE5A 1YDLA 5A8WA 4HT7A 3M7VA 5KFYA 3MAAB 4A8WA 1OYEA 4C6AA 5I3QA 2UV8A 2MLXA 3BO3A 3BQ0A 2Y8YA 1FERA 4I6AA 3ZNJ1 3W9HA 1VDHA 1QJHA 5EWGA 1QSYA 3NCQA 5A8RA 2UVUA 5K8NA 2AP6A 5GAGI 1T9XA 4Q8EA 1PC4A 1ZBTA 4ED0A 2LECA 3EZOA 4LF9J 5LMNF 4DR7F 1YJ9S 2EPIA 5EUHA 5KFGA 2K7KA 2LCWA 2AGPA 4CLYA 1TKZA 1FTCA 4UW2A 4OI0A 3V2UC 2U2FA 2IM0A 3SDEB 1NPKA 4O3SA 4TY9A 1K1QA 4NASA 1TL4A 1WUUA 1OIAA 5GAEU 3IWLA 3MWBA 4KB7A 4JYAF 3I82A 2UV8G 3H5UA 2BM0A 2DO4A 2BE7D 2ZJPQ 1X4AA 4H4MA 2JZ5A 4NCBA 3AT1B 2NXEA 4LUBA 3M8WA 4I69A 2DR6A 1QAYA 4ZPWR 2IY5B 1KLMB 1RHMB 4HACA 3HSJA 5F41A 2VL1A 1NK5A 3AODA 2DVIA 4DUZF 3DLGB 4B3RF 1UP1A 4K0KF 1NDCA 2PMWA 4O4RA 4ZLLA 3M8SA 1JLCB 2ZBIA 1KFDA 1VK8A 4O3NA 3BQ1A 3I55S 1B4SA 2KTQA 1T9UA 1HNZJ 3S1TA 5E7OB 1M1KT 4OFZA 3J7ZT 2QTWA 3QJPA 1Y11A 2QRRA 4IYQA 1YJNS 2QMUB 1D9AA 1JLBB 1R0CB 2GV1A 1Z2ZA 1XR6A 2EEYA 2LYVA 3GV5B 2XZDB 4YB1P 5A8KB 1HWJA 1X0FA 1Z4UA 3GP9A 3HHLD 2ZC4A 3FBCA 4ZVFA 4C97A 4LFBF 2GMLA 3M8PB 3NL0A 5ETQA 4Y2MA 1OPZA 5CZVA 1UJ6A 8AT1B 4FF2A 5EN1A 4GVBA 2B7CB 4WFBQ 4IH7A 4JI6F 5AE2A 4QIVA 2ZH9A 4QYRA 4ZPVR 5LMUF 4CWBA 3O5TB 4ECRA 3GFZA 4KPCA 2MQ8A 1OY8A 3CD0A 1R3NA 1XMOF 3I87A 1SH3A 4ZVGA 1YHQS 2Q79A 4U7UD 3Q83A 2AV5A 3UVJA 2R8HA 1S79A 1TU0B 3OXFA 5CHCB 2NXCA 2ZVIA 5CCLA 2J0WA 1HNVB 1CVJA 1PGZA 3GIJA 2V2VA 1L5UA 3K8VA 2ASJA 5L39A 1MNEA 4FF3A 2EFNA 1R7IA 1NSAA 1WD6A 3B8HA 1N5TA 4XTTA 2R2RA 2FJXA 1EB0A 1WEZA 4IFVB 2H5IB 4F26A 1RT4A 4HL9A 1BQMB 2JWNA 3TUJC 2B51A 3HDSA 1HKAA 4J9NA 2CPEA 3DGPA 3W66A 2HQ3A 2QL5B 1TL3B 1VQ8S 1A0OB 1UETA 2VC0A 1LWCB 3IG1B 4F02A 2FLLA 4ICLB 2G0IA 3FVYA 1FK9A 2MQOA 1TUWA 9RUBA 2Z2LA 1HQUB 1R0AA 2KYXA 1CQMA 4IOAQ 3L3CA 2KM8C 3AJ1A 2CQ0A 3H5YA 3MM5B 1C0TB 3NAHA 2KO1A 2ROPA 2KHCA 4H4KA 2BE2B 1RHUB 3AD8C 3QQCD 4KFBA 3CWJA 5AT1B 3G8QA 2LQBA 3KJVA 1S6QB 4YHHF 4TQSA 3A4TA 5HLFA 2HNYA 2V4JB 2AYMA 1RTZA 4DN0A 4ZPTR 4ZCIA 3D3CJ 6AT1B 3IO1A 2Q3PA 2J8AA 4PRFA 2AJQA 3AA8A 3UR0A 1RAIB 3QSIA 2DEIA 2CQCA 2QE5A 4M95A 4ECSA 1H0HB 1ZM4A 3NMAA 4FF1A 1IJEB 1N36F 3TQEA 1QY7A 2YQ3A 1N56A 4EO8A 2ACMA 3LPYA 4W92B 1Q8BA 3H98A 3GYXB 2QA4G 3S01A 4G1IA 1S6PB 3BBBA 3UFCX 1VCTA 4OX7A 2FJDB 3JB9k 2VJUA 3FEXB 3DRPB 1S4FA 3GYNA 2JFKA 2DEJA 1G1XA 4LFAF 3KUGA 1FRHA 2CG4A 2RD5C 1T95A 4P73A 2R7XA 3UDLA 3KLEA 1Y10A 5HBMA 3TP2A 5KG4A 4KKOB 2IDEA 3QO9A 3HHLB 2JC1A 2LXFA 4DJBA 4F0HA 5HATA 4O23A 4OJ3A 2H54B 3TUPA 5IZHA 4C2MA 2IJFA 3GCXP 1VHIA 5HJXA 1W26A 3JYTB 4HTJA 2P6TA 2CZ9A 4C8LA 2ZH6A 2GHWA 2E7XA 2CZVC 5FD1A 2RF2B 4X4UA 3FUYA 5KFIA 1EZZB 4FN5A 4N41A 4KH1B 3O6QA 2UUWA 2K7JA 1KVKA 3F41A 3R7SB 3CCUS 1P27B 2EXUA 4NLYA 5FLXY 5IM0B 5IFMA 3W5YA 3DRRB 3HXMA 1XC9A 1C1CA 2OPQB 2GQCA 3G82B 1R8CA 4ELVA 5IV4A 4K4SA 4DLGA 4UTGA 2G2ZA 1SV5A 1VYAA 4F8RA 2A0FB 2AT1B 3BGUA 1H7WA 1SQFA 3E51A 5KG0A 4ZVQB 4TNOA 2XC9A 1H74A 3SBMA 1RTHB 1CULA 3TR5A 4F4WA 1EQMA 4ES3A 4LF4J 2LA4A 4P52A 4DS5A 2ROGA 1YIJS 1R27B 3CW2C 5KTQA 2A6OA 2CVEA 2VBYA 3BS9A 3RW6A 4OX9F 4AL6A 1HMVA 2AZ3A 3AD9C 3AXMA 3NWRA 4K8RA 1IN0A 4YDDB 3EJMA 2XM3A 3ZTRA 5D0EA 2LKZA 3LQVA 3R5JB 2DTJA 1F5CA 3J7AN 3CCZA 1ZPWX 4H4KC 4ECQA 2AU0A 1D9DA 3NP5A 5T41A 1NDLA 1K73T 1V3RA 1UVIA 5KFLA 2L9NA 2VH7A 2PIIA 2W1BA 4CZCA 3OSPA 4P2FA 5CD4A 1NK4A 1XBWA 2DGQA 2OPRA 2ERRA 1X0PA 4CO5A 3ZZTA 1U1PA 1DQ9A 1XNRF 1F2HA 3VAJA 5FIIA 4RBVA 3CJTA 2GA7A 4DV3J 2EFVA 4DV4J 3CEDA 3LH2S 3JSRA 2D74B 2F4VJ 1HHSA 3C15B 4ZLNA 1WELA 2ZD1B 1HBOB 4GC6A 3T41A 2W7PA 4X4VA 3MD3A 2UXCJ 5K5MA 3GG0A 1SXLA 1CC7A 1BXNA 5DJBA 3RR8A 1UVMA 3ZTSA 4PPDA 2YWEA 1F2GA 3H59A 3HHDA 3NCPA 3CJSA 2LA6A 4OYZA 1PYTA 4DL5A 2MYFA 5MAOA 2MZ1A 2UXCF 4DUYF 3D5MA 3VTIA 4O3RA 3IM8A 3VQTA 3I9V9 1PAUB 3J80U 2WRMA 3SCIE 4E2FB 5ITHA 3OHAA 1JJ4A 1U8SA 4KPYA 4ZPAA 2W2OP 1N32J 3KNGA 4Q2MA 1CS4B 3I5BA 3MMAB 3EXYA 2ASLA 2VICA 3CCQS 3P5BP 3U02A 3PACA 1DRZA 1S9GB 3QFHA 1DQ8A 4NPOA 3DOKB 5F3TA 4B3SF 4CTAB 3KK1A 3TX0A 4PZVA 3W1YC 1RJJA 5D3GB 4E0DA 2QN6B 2ZBCA 5ADZA 5A0YA 3ET6A 2BBEA 4IG3A 2QT7A 5B08A 2JC0A 4YR0A 2R7QA 2HURA 5KFOA 1M1GA 1GH8A 3VHQA 4H4OB 4RW7A 3ENAA 1IR0A 4Q5VA 1LW0B 4I4BA 3SQGA 2YX1A 3FNNA 3R5GA 2HZCA 3C14A 2R7SA 2D3ZA 1NH7A 3PX0A 3CPWR 2MJNA 2FVRA 2BXJA 2C42A 5B0GA 4I2QB 2SXLA 3RBZA 4CH7A 4IH5A 3PEHA 3HD1A 4XPEA 1U1OA 3BSNA 1Y0HA 2E5JA 2M9KA 1ZTTA 2YNIB 4WCEQ 4CYUB 1NJZA 4DV7F 2FHJD 3NG8A 3G9CA 2J7UA 3CCLS 2ZOFA 3KMSA 2NPIA 5GAHI 2K2PA 1WEYA 3BR8A 3R2DJ 2VQEF 4P75A 2DXFA 5KOWA 2OELA 3AJDA 1IBMF 2DHAA 2E7WA 4CLZA 1GXTA 1FFSB 3UWTA 3WC0A 5KG1A 3Q2TC 4DUTA 2EK1A 2ZBPA 3I32A 3DLKB 1JIHA 1G4CA 2UVWA 4USKA 1WSRA 4WFYA 2HFNA 1K47A 1OY6A 2W9CA 3P5TL 4P74A 1T05B 2XHWA 1AROP 2UXDF 4ZKAA 5AXNA 1AXQA 1RISA 1Y7PA 4RBTA 5KT5A 1VBZA 3NS5A 1VQ4S 4X4NA 5D4PA 2GO8A 1D8ZA 4OYPA 2M70A 2AJ1A 3ELHA 2JLGA 1UVJA 2B3TB 1M0SA 2NLWA 2YX4A 1FWKA 4R8UB 4I56A 1RHRB 3PZPA 3F73A 1A7GE 2JH3A 3Q24A 3VZHA 4CO0A 2QLJB 4C0HA 2W01A 3TRGA 2HFOA 4DZ6A 1QE1B 3MR5A 3DN9A 1NK0A 3A3NB 2HQFA 1NCLA 1DLOB 4N56A 3VGUA 4TYAA 2N4DA 1WC6A 2I9SA 2Q66A 1VLYA 4ZP6A 2XBPA 3M32A 3PEJA 3MUMP 3PO4A 4ZDNA 3B4MA 5I3UA 2FVQA 3FBBA 4PEOA 3HHEA 1N54B 4J9MA 2O01C 2XGPA 4JI5J 3HZGA 4CLUA 1TQLA 4IFYB 5HI7A 5EHHA 2IC3B 2OSRA 2NSCA 3NOGA 4ZP7A 1DTTA 1P9YA 3TA2A 3J81j 1FRLA 1UZDA 4OX6A 1E6YA 3AXKA 4NLOA 4O4GA 3CMES 2FVSA 3X3UA 1S1WB 4DV1J 3JSMB 5I3PA 3R5DA 4TYBA 4OYOA 4IR9A 3OSNA 3KLIA 4CIOA 2CQGA 3LWMA 4L3KA 3HZEA 3R7NB 1SJFA 2IDLA 3EYZA 1I6JA 2DNGA 2J8SA 2BANB 1RT2B 2CRLA 4JI4F 4U96A 4NXMF 3M9OB 2KRRA 3RZAA 4KBIA 3BGLA 2Y1LB 1FWLA 2MHEA 2PA3A 1IKVA 2V63A 3DHXA 4ZVTB 1VQOS 3FFIA 3D6FB 3DYAA 2MMYA 5E3RA 5C25A 4DR4F 5H9FK 3MOZA 1U0SA 4CM2A 3AB4B 2XO6A 3NXZA 2ILYA 4QWBA 2YH0A 4IOBA 2YH1A 1TL1A 5EX0A 3IWXA 3CJ3A 1EETB 4NI2B 2HFVA 5J2QB 3HF5A 1LNQA 2NXJA 3T9ZA 3OR2A 2C1EB 4JV5F 4ECVA 2V4QA 2MTLA 2KN4A 3RTVA 2CPZA 4OV1A 2G0CA 5D78A 4LJMA 4PXDA 4USUA 3T1AA 3SCLE 1IXKA 4PUOB 3PHTA 5G0RB 3CJKA 1S57A 4BBYA 3VAHA 3SSQA 4YR2A 1R31A 1R8HA 3SSRA 3VAMA 2J6UA 4AXIA 2XZTB 4NCGB 4Y28C 4DU7A 2RQMA 5DLFA 2LP4A 3CJ0A 3MECB 1GNKA 3L7UA 1K0TA 4FNHA 1RBOB 1YBTA 2D3UA 4DX6A 4EBEA 4NMLA 2OPSB 4X2BA 2GAGC 2HNZB 3WX8A 3LP0B 4JI0J 2DNRA 3BZQA 3HVAA 2KT5A 3GV8B 3VZIA 5H9FJ 2DPJA 2QFIA 2H5EA 5HQMA 4NLSA 2GVZB 2MKCA 2B4UA 2DITA 2RKIB 4PKDB 4ZPDA 2KKHA 1RAHB 2AJ4A 2E9ZA 2RJZA 5D0HA 1JLFA 3AH6A 3PKMA 1KR4A 2MKHA 2DHGA 1NKEA 4W90B 4DV5F 4M5IA 3DRSA 2W9BB 2QGFB 4OI6A 2IJRA 1UWBB 4J9VA 5KT6A 3M8RA 1HBUB 3OUYB 3GSIA 4OIXA 1UPPA 2YNHA 2Z57B 3W9JA 1UA0A 4ED8A 4JI2F 2E5HA 1GMUA 2VG7A 4WKRA 3GMGA 1TP7A 4K5RA 1PJ5A 2YWWA 3C6UB 1I5OB 1HR0J 3DRXA 4JI3J 4WZQA 3T5KA 2ZZNA 2Y0BB 1U6BA 1NBEB 3BN4A 3VAGA 3GZ7A 4ECXA 3QYYA 4X84A 4HT5A 2XS7A 3VAIA 2ZHOA 2MDAA 4DXLA 2K8GA 1MN7A 3QAEA 2GVDB 1F3VA 5C42B 4Y2KA 5M2PA 3QT7A 2D9PA 4ZA1A 4I64A 5AE1A 4LRCA 2X1BA 3G6YA 2WTFA 1YSJA 5E33A 3MM6A 1SB6A 2QMWA 1S76D 3BGRB 4LF7J 4QIFA 3FZBA 1ZTWA 2VFUA 2XO7A 2N7CA 2MZJA 2XSFA 2XULA 1WF1A 2RQ4A 3JS9A 4UT4A 1W2BR 3AJ2A 1MSWD 3EGVA 1U47A 3QAUA 4X65J 2MKIA 4PR6A 1YVFA 4NLUA 4NX9A 1Z2LA 3RAQA 1Q8LA 5JXSA 3RG6A 1WG1A 3CCRS 2ZE2A 3EGWB 3HHNB 2ZNZA 1PIEA 2MLYA 4WE1A 2HAIA 2Z8QA 3KKFA 4LR9A 3H20A 2CZ4A 2V2KA 2YKMA 1ZS6A 2FJBB 4ID8A 4OYWA 4C8ZA 2MQQA 4EEYA 1HNIA 2E66A 1C1BA 3ILOA 2GFFA 1D0EA 3KDOA 2AF6A 1U8WA 2ZM6J 4DPTA 1MWZA 2QX0A 2I38A 3J7YU 1S0VA 1Q86T 4K7QA 2ZHBA 1FKPB 3RAXA 1T94A 5CYMA 4O0NA 1OPIA 4ZJLA 2BQRA 4WU2A 1J5EJ 1S59A 1Y3JA 3D7SB 3ZZYA 4OHVA 4ETZA 1HWUA 3QT6A 5KFXA 5KG7A 2C2MB 3DHWC 1O8BA 1FKOA 3M2UB 1J2VA 3I4HX 1X31C 4N7TA 4X4TA 4BWJA 3GJTB 4C0BA 4YS2A 1GXLA 1N4LA 1G3OA 2RILA 4Q45A 1FD8A 1HFEL 4FBUA 1IKYB 1J5OB 4M5GA 3SEOA 4QW9A 1VC6A 4IQMA 2EW9A 1N5SA 3I31A 2DO0A 1WTFA 2JNJA 5IT9Y 2QO3A 2C2EA 1SI9A 4YB6A 1RWMB 2GX8A 4NLQA 5B0EA 4RPFA 3MM9B 3OW2R 1QLNA 1VRUA 2AGQA 4MK9A 2M7SA 2HGMA 4DR5J 1NPPA 4F4XA 4EBDA 1LWEB 3MR3A 2VODA 4DSIA 4EMDA 1FE4A 5HQ8A 3TYTA 3R1HA 2F3JA 2L48A 3MHYA 2OJ3A 1K44A 1ZAVA 4LRDA 3QIPB 5J2PB 4DOZA 3WC2A 2FD2A 2W4CA 3HO1A 2EKNA 4MIBA 4DV0F 1HWLA 3C2PA 1UEVA 2Y3YA 3Q8VA 4FF4A 2UXBJ 3W8GA 2BKOA 3BSCA 3IP0A 3MM8B 1ZA2B 1HYSA 3NGSA 2BYCA 5F0UA 1RWWB 3TA0A 2HK3A 2E1PA 2N82B 1RADB 4LSLA 2E44A 1F9FA 3MMBB 3V81A 4ETXA 3BEGB 1W2IA 4M5NA 4Q44A 3OL6A 2B6AB 4DR2J 1FFWB 4FVMA 2ALZA 4K4WA 3ENVA 5J2NB 2VKZG 1V5IB 2J76E 1V6HA 2DH9A 4DV2F 2F9JA 4Q0BB 4L72B 3MI7X 4HACB 1ACMB 2JVOA 3OFGA 3D6TB 5J2MA 3E2EA 1ZM9A 2DRBA 1JLAB 3C19A 2PMZD 4J9UE 1H98A 1QAXA 4FYYB 2L08A 1QVGR 3M30B 4BCAA 2HS3A 4FXVA 3K89A 3MEDA 2VPZB 3K17A 3EGNA 3PFOA 1HQ2A 3A3PB 3GQCA 2BQ3A 2VJVA 3RYLA 4C8YA 1WC5A 2GGPB 3POTB 2ZFHA 4LQ9A 4FYDA 2HHHJ 2ZHAA 1TK5A 2D7SA 4GKKF 4YY3J 2VPWB 1YGYA 4ZHRA 4YUDA 1FHTA 1KVJA 1P6TA 2HIQA 4UUXA 3BJYA 3D6HB 4I6YA 2ATCB 3U27A 1IUJA 4Z7YA 2FYXA 2O1PA 4MKAA 4TVAB 1RT7A 1RTIA 4OZ3A 1Y4ZB 2EC2A 2FHMA 1S49A 1UW4A 3NRBA 2ILZA 2DNKA 4NLVA 1WF2A 2FGCA 4EI2A 3R5AA 4GVBB 1O51A 5BYRA 2NUUG 3KXDA 3BF4A 1RKJA 3A13A 4JOUA 2Q43A 3R3TA 2A1BA 2GIRA 2H4WB 4QBUA 1YJWS 3GJQB 5F8JA 3PFEA 3PKYA 3RBDA 2FB0A 2IVMA 5JMNA 3BYPA 3ILJA 2B9WA 4Y34A 2F8MA 3UVJB 2R7OA 2VPYB 4OYIA 3SMZA 3M9NB 2GQQA 3H7HB 2BE9B 4A8OA 4ECYA 2ZC3A 2YWGA 2HFZA 4OZLA 3QZ7A 3QRRA 3OPKA 3EPIA 3IFEA 5KFTA 1JKHA 2JSXA 2ZOMA 2LEPA 1XK8A 4BDPA 3Q8SB 2R9LA 3PM9A 3PYGA 2RVJA 1QTMA 3HSDA 4DX8H 4NLGA 4DFMA 3FZ2A 4QQBA 1O5JA 3PG9A 4RBUA 1WKLA 2WVDA 2LDYA 2YKOA 2LFVA 3IRXB 1RT4B 3TNVA 3PXGa 1CJTA 4DR3F 3M2RA 1XNQJ 3DGPB 1X9SA 2XEXA 4RW9A 1TFYA 4ZP8A 2B4PA 3KK2B 2XSJB 1M5VC 2CDQA 3LPEA 1HNXF 3TQ1A 1RE1B 4EO6A 4DEZA 2KT2A 2CQBA 1JXEA 1DY3A 3KUEA 5F9LA 1U0HA 3ZTPA 3G86A 2QYCA 2DNZA 3OD2A 4J90A 1GAOA 1V3SA 4NZ6A 3PX6A 2VA3A 5LJ5Y 4U8VA 4KFBB 1TMJA 1YZ7A 3PX4A 3KFWX 2HNYB 4LFCF 2RQKA 2FC9A 3BQ2A 1SCJB 3V6JA 2XNQA 1S77D 1N6QA 3G6XA 4LRFA 2RRBA 1JJCB 4LSNB 2KT3A 3C16A 2M4MA 4A8SA 3C66A 3MEKA 3BPSP 4MFBA 3VAFA 5BR8F 2XYPB 5AXMA 2X51A 1KD1T 4K50A 1XERA 4DPWA 4ED4A 1RYRA 2DR7A 3I56S 1NK7A 2IFXA 2I5JA 5K8PA 2G0JA 3G87A 1OY9A 3O3LA 1GMWD 1W25A 3UE2A 3IR6B 1X4BA 4WP9A 3DM2B 4M5LA 2YNGB 5HP1B 3UPFA 3UCGA 1A6LA 5AXLA 2QMXA 1M90T 4LBIA 4J9RA 3OTOJ 3PIOQ 4NEYA 1KRPA 5T7LA 2E1MC 2JVRA 5ETVA 3E3XA 4TU7A 1X8DA 1FJ7A 3QO9B 3WBZA 4K4UA 4C8NA 1URNA 3B54A 1DTQB 1Q8KA 3HSZA 2BMBA 1PYOB 3IGVA 1S48A 2E9TA 4DFJA 3SQOP 5F3ZA 4PYAA 2HHXA 5L1LA 3T1HJ 4FBTA 1TELA 2F8EX 2CJKA 4MYTA 1T9YA 1ELOA 3CCMS 4DU8A 2BW2A 4WBFA 2O5DA 5KFZA 2ADCA 4CLFA 1BWVA 2KXHA 1RWPB 1OSCA 5KFFA 5DQHA 3PV8A 3MPUB 1WJ9A 2PEHA 4ID5A 3GB0A 5LL6d 3PYFA 1SC3B 4ZIWA 5M2UA 2QLXA 4U8YA 4DQRA 2O67A 3TW0A 2HGNA 3KUHA 2FC8A 1JJ2R 3IS9A 2DB1A 2PA8D 2OIHA 3ONQA 1F5AA 1IBKF 4LIWA 4LSZB 2M3DA 1CULB 2FHKA 1X5PA 5KT3A 4KIAA 2HWHA 3DLEB 5KFRA 1GMVA 3U7JA 2BM1A 4RNFA 2W7AA 2BOAA 1HMVB 3W2WB 4RW4A 1VQSA 4LVOP 2PDAA 3P96A 2C3OA 4EUVA 1HLWA 2ZKUA 4IG0A 5CYQB 4ED2A 2EFPA 5HROA 2V4RA 4PQUA 3OLAA 3MZIA 4USIA 1S0MA 1F0XA 1IQZA 2L3MA 2XLKA 1TKXA 3DOLA 3I0SA 2VBXA 2RUSA 2V94A 1X4HA 4LBPA 4NRTA 1UAWA 1RHKB 2HHSA 4TKTA 2RT3A 4PWUA 3G4SS 3HSGA 2FVCA 2WSCC 5F8HA 4OI1A 2KFNA 1H38A 4DX5A 2W2QP 1EX8A 4KO0A 2ZH2A 2E5LJ 5EDWA 4CNZA 1DURA 1T9VA 1FJGJ 1BHNA 3M6UA 2CFXA 2CJBA 1UVLA 1D1UA 1RI7A 1RU2A 1AT1B 2DGUA 2V9KA 4KY3A 3RBXA 3SFGA 1YJ7A 3MFHA 3OJUA 3EX7B 3M6WA 4MJKA 2CWXA 3R5BA 3UDEA 3W9IA 3M8YA 4NOHA 4B3MJ 1S1VA 3W8PA 3J7A1 2EG2A 4ZVHA 3UW1A 2WB1D 1RT5A 1R6YA 2GS8A 5GADU 2M5YA 1CEZA 4DR1J 4FKXA 2R42A 4KHMA 5KFVA 2EG1A 4X64J 2OPPA 2KVIA 4YB5A 2QEXS 4C11B 1PCAA 3LP2B 1N33F 1F9EB 2AW0A 1RK8A 4OZNA 2K1RA 2UUBF 5BYSA 1RWNB 4QZVB 1DAXA 3BPDA 4PWDB 2DGWA 3KK1B 3FSXA 2V69A 4PG7A 2R2SA 1BQNB 3JTNA 2E9RX 1WC3A 3SDEA 3VVTA 3ET6B 4IG3B 3VALA 3FSIA 3D68A 4RW7B 4I68A 2XCPA 1N5VA 4P2MA 2DRDA 3C14B 3M4XA 3T3FA 1R8BA 4A8QA 1UFKA 3K59A 2R7VA 4UY8T 1HQEA 1XMQJ 1IKWA 2HNDB 3DLGA 5C2GA 2XMWA 4LF8F 3N6LA 5J1EB 1OSDA 2G2YA 3FCVA 4F0KA 2NZCA 1UFWA 5RUBA 1R8PA 3C46A 3OV7A 3UDCA 1YITS 1TV6B 5DDRC 2CPFA 3GU0A 4F67A 3HFVA 2HEKA 1N88A 1E6VB 4R25A 4N8NA 3I4PA 1UPMB 1VR6A 4MKYA 2ASYA 2H65B 2DNOA 5L9NA 4NEZA 4PXBA 5HVFA 3QATA 3VGVA 1KVIA 4GKJJ 3MAQA 4E98A 1SJQA 2QJ3A 1Q5VA 4RU9A 2FLNA 1PSDA 3EVWA 3TAQA 1B0PA 1WC0A 1GEHA 2C2KB 3GJRB 1N34F 4PQAA 3HVTA 5D4NA 2GJIA 4FS2A 4IDKA 2DGVA 4DPYA 3CF5Q 5C2CA 2RB7A 1RT3B 2W2MP 2WK4A 1MMDA 4GMKA 2IYIA 5GMDA 2WZ1A 2YWHA 3H4DA 2D41A 3OJSA 4ZVEA 1S10A 4KV8A 1XIQA 4A8FA 1H7XA 5KFPA 1FNOA 2HBQB 2WVCA 3HFKA 1X9WA 4UF4A 3ISND 1NK9A 4JV1A 1HNWF 3T1YJ 2YKPA 4N77A 2VG5B 1NJYA 4UUWA
chains in the Genus database with same CATH topology
4DV4J 2UU9J 4NEYA 4NEZA 4DV2J 4AQYJ 1XMOJ 2HHHJ 4B3RJ 3D3CJ 2F4VJ 4K0KJ 1HNXJ 1J5EJ 2VQFJ 4DV7J 2UUAJ 4YY3J 4X62J 2E5LJ 3IMQJ 4LF4J 1FJGJ 5AJ3J 4LF8J 2UXBJ 4GKJJ 4JV5J 2UXCJ 2KVQE 4X66J 4HHUA 4JI7J 2VQEJ 4LFAJ 3J81U 4JI5J 5LMNJ 4KY3A 4DR7J 1IBLJ 4LF5J 1HR0J 5LM7E 4X65J 1IBMJ 4JI3J 4DV5J 3R2CJ 4RJVA 4B3SJ 1HNWJ 1N33J 1XNRJ 4DR2J 4YHHJ 4DR6J 2UUBJ 4B3TJ 4JI0J 3T1HJ 4V1Ak 4NXNJ 1XNQJ 5IT9U 5FLXU 4JI4J 4NXMJ 3J80U 2MQ8A 4GKKJ 4B3MJ 4LF6J 4DV0J 4KHPJ 1XMQJ 4KYZA 4JYAJ 1N32J 4LFCJ 2MEWA 3J7AN 4DV1J 1IBKJ 4JI2J 4DV6J 4LFBJ 2UXDJ 4DR1J 4DR4J 4JI8J 4JI1J 1HNZJ 4X64J 1N34J 3R2DJ 3JAMU 2MTLA 4DR5J 4LF9J 4OX9J 2KL8A 3OTOJ 4JI6J 2UUCJ 3D3BJ 2ZM6J 5IWAJ 5BR8J 1I94J 5LMUJ 4PWWA 3T1YJ 4DR3J 4DUYJ 3W1YC 4LF7J 1N36J 4DV3J 5A2QU 4DUZJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 J;  2UU9 J;  4NEY A;  4NEZ A;  4DV2 J;  4AQY J;  1XMO J;  2HHH J;  4B3R J;  3D3C J;  2F4V J;  4K0K J;  1HNX J;  1J5E J;  2VQF J;  4DV7 J;  2UUA J;  4YY3 J;  4X62 J;  2E5L J;  3IMQ J;  4LF4 J;  1FJG J;  5AJ3 J;  4LF8 J;  2UXB J;  4GKJ J;  4JV5 J;  2UXC J;  2KVQ E;  4X66 J;  4HHU A;  4JI7 J;  2VQE J;  4LFA J;  3J81 U;  4JI5 J;  5LMN J;  4KY3 A;  4DR7 J;  1IBL J;  4LF5 J;  1HR0 J;  5LM7 E;  4X65 J;  1IBM J;  4JI3 J;  4DV5 J;  3R2C J;  4RJV A;  4B3S J;  1HNW J;  1N33 J;  1XNR J;  4DR2 J;  4YHH J;  4DR6 J;  2UUB J;  4B3T J;  4JI0 J;  3T1H J;  4V1A k;  4NXN J;  1XNQ J;  5IT9 U;  5FLX U;  4JI4 J;  4NXM J;  3J80 U;  2MQ8 A;  4GKK J;  4B3M J;  4LF6 J;  4DV0 J;  4KHP J;  1XMQ J;  4KYZ A;  4JYA J;  1N32 J;  4LFC J;  2MEW A;  3J7A N;  4DV1 J;  1IBK J;  4JI2 J;  4DV6 J;  4LFB J;  2UXD J;  4DR1 J;  4DR4 J;  4JI8 J;  4JI1 J;  1HNZ J;  4X64 J;  1N34 J;  3R2D J;  3JAM U;  2MTL A;  4DR5 J;  4LF9 J;  4OX9 J;  2KL8 A;  3OTO J;  4JI6 J;  2UUC J;  3D3B J;  2ZM6 J;  5IWA J;  5BR8 J;  1I94 J;  5LMU J;  4PWW A;  3T1Y J;  4DR3 J;  4DUY J;  3W1Y C;  4LF7 J;  1N36 J;  4DV3 J;  5A2Q U;  4DUZ J; 
#chains in the Genus database with same CATH topology
 5CA5 A;  1HI0 P;  4ZOS A;  3KWM A;  4QWE A;  3RGI A;  1Y3K A;  2W8K A;  3RRH A;  3QGP A;  3JSB A;  2CXE A;  2QZ8 A;  2CQ1 A;  1Q4R A;  4HDG A;  4KHP F;  2AJF E;  3OR1 A;  4WKY A;  4OLO A;  1HW8 A;  3I0R B;  5J1P A;  3O44 A;  2LMI A;  2MKY A;  2OHD A;  4C3K A;  1F3F A;  3DU6 A;  2Y1R I;  5I3U B;  2A18 A;  1WOR A;  2BJ7 A;  4M1K A;  4CT8 A;  2HK2 A;  1BQM A;  3QSY B;  2C22 A;  4I1T A;  4XDC A;  1T03 B;  3QRQ A;  2FQQ B;  3GE9 A;  4U7U K;  2CKW A;  1TL3 A;  1DTT B;  4LVN P;  5KG5 A;  4YN3 B;  1LWC A;  3UN5 A;  3IG1 A;  2VQF F;  1IVZ A;  2B7B B;  3THP A;  2OP5 A;  2ZH8 A;  5CXT A;  3TOQ A;  1LXJ A;  2FZC B;  3U1L A;  4WYW A;  3OTB A;  1GX6 A;  4B9U A;  2BJ3 A;  3KLI B;  2AEF A;  4DR6 F;  5IS2 A;  1DZ5 A;  1IBC B;  2J7W A;  4KGX B;  2CJQ A;  1WF0 A;  2LXI A;  1BLU A;  1M5H A;  3M1V A;  3MM7 A;  5K14 A;  2QA4 S;  4XAK A;  2ZUA A;  1TKD A;  2UUT A;  3HX9 A;  4NA3 A;  3LWL A;  3FFI B;  1NB7 A;  5C25 B;  5IWA F;  2HFU A;  4Y00 A;  1TL7 B;  2IMO A;  3RUB L;  1S9E B;  2RS2 A;  1TL1 B;  4A48 A;  3RU0 A;  1H3D A;  2MEW A;  5E3Q A;  2GMJ A;  4ZJQ A;  3QLH A;  2CUY A;  4CI0 B;  1S6P A;  1X5T A;  5GAG U;  2H1Y A;  1FRM A;  4DF4 A;  1D09 B;  3DRP A;  3OR2 B;  2I2Y A;  4URG A;  3JSY A;  5H9E K;  4ED6 A;  3CDA A;  4ANE A;  2CJA A;  3QT8 A;  4ZPB A;  4UOF A;  5KT7 A;  3CTR A;  1YX2 A;  3HKW A;  5F8L A;  3MUT P;  4NZ0 A;  5KG6 A;  3VF0 B;  4O0I A;  1PO6 A;  4WWS A;  3MPD A;  3HHL A;  3CJK B;  3MPV A;  2BJ1 A;  4KC5 A;  4B9T A;  2MB0 B;  1ICE B;  1IR1 A;  1U6F A;  5LMN J;  1P8G A;  4DR7 J;  1ZAX A;  2C2R A;  3KHL A;  2DGO A;  4AUK A;  3JYT A;  2CQI A;  5L9X A;  2WW8 A;  1KWM A;  3KDN A;  3TEH B;  4NLP A;  2VB6 A;  4K4Z A;  1FEE A;  2NYH A;  2GJF A;  3OTD A;  4JYA J;  3UCU P;  2UUA F;  3NS7 B;  1V9O A;  2YQ1 A;  2HG4 A;  2BZ2 A;  4ED5 A;  2V8G A;  3WQP A;  5IM0 A;  1RWX B;  3WIV A;  4QIG A;  3G82 A;  3ULH A;  2Z56 B;  3OBI A;  3S8S A;  3N9U C;  3ILI A;  1JLF B;  3ZTO A;  3IR5 B;  3N79 A;  2UVV A;  2HVH A;  3EDQ B;  3RB3 A;  4DUZ J;  3BO2 A;  3KLV A;  1YRU A;  4ECU A;  4KR0 B;  4B3R J;  2GZO A;  4K0K J;  1FXD A;  1NRK A;  2B8Q A;  3AQP A;  1Y5L B;  1RUS A;  1RTH A;  4DL0 C;  1RYS A;  5H9E J;  4BHQ A;  3FMW A;  3QRP A;  2D1C A;  1UEK A;  4ILL A;  2V8P A;  5KFB A;  2KHD A;  4HHH A;  4DL4 A;  3ADA C;  3VVU A;  5F8M A;  2VG7 B;  2G1D A;  1MG7 A;  1B64 A;  4Y6I A;  4K4Y A;  4OZJ A;  2D3O R;  5F0W A;  1BE4 A;  3BH6 B;  4ITS A;  4WXW A;  4TU9 A;  2R3V A;  2ACY A;  3FRY A;  3C6T A;  1NEE A;  1CSJ A;  2KJW A;  5SZT A;  2MQL A;  1SKR A;  1RLC L;  1SL1 A;  3H40 A;  1U1L A;  3NLC A;  2Y9H A;  3NMR A;  2XY6 A;  4LFB J;  4RKU C;  1SL2 A;  1TKT A;  2AYG A;  3LP1 B;  2WB4 A;  4BS2 A;  4G1Q B;  3EIC A;  4DQI A;  3W2V A;  2UP1 A;  4JI6 J;  1DJ0 A;  2BKN A;  4CLW A;  4O3O A;  4O3P A;  2OLW A;  3BBF A;  5LMU J;  1RTJ B;  5KFW A;  2FY8 A;  3IM9 A;  3NBP B;  4DPO A;  3MM6 B;  3CNQ P;  2C3Y A;  3MPW A;  1XMO J;  2FLO A;  5DLG A;  3DLJ A;  3SCJ E;  4ILR A;  4CO4 A;  1URR A;  1DAR A;  1JLE B;  4LQ3 A;  5D0R A;  4Y0F A;  2HVD A;  4OLP A;  4YDX A;  4X4P A;  3FGV A;  1MLA A;  2H3E B;  4OJG A;  3VV2 B;  4V19 X;  1X5S A;  2M2B A;  4DCO B;  1B3T A;  3C15 A;  3MAH A;  1MWY A;  3H42 A;  3VQS A;  3AD7 C;  4ZK7 M;  1HBO A;  2IRY A;  3ITH A;  4OYA A;  2DXE A;  5LM7 E;  1ZH5 A;  4K4V A;  3CUN A;  3H5X A;  1NHV A;  2OH2 A;  3HLU A;  3UD4 P;  4IO9 Q;  1X4D A;  1FDA A;  1K1S A;  2XI3 A;  3P3D A;  2IRU A;  4QR1 A;  4QYZ K;  3UQS A;  2ZE2 B;  3NNH A;  2HQC A;  2MKJ A;  3QFW A;  4A8Y A;  4LBH A;  1KP6 A;  3MCM A;  3MDF A;  1CS4 A;  2YKM B;  3HKZ D;  3MMA A;  4F3Q A;  3TX8 A;  4CLK A;  3MEG B;  3H4B A;  5IC4 B;  3HHL C;  1S9G A;  4GRS A;  1T9T A;  2V5H G;  3X1L B;  3W62 A;  4CTA A;  3MGJ A;  5KT4 A;  2DYA A;  1RWU A;  2IMW P;  3CB4 A;  5D3G A;  3AOC A;  3FBF A;  1F5B A;  3A12 A;  3PW0 A;  5KG3 A;  1Q0N A;  2NRE A;  4ELU A;  2XMV A;  2ZWP A;  2HQI A;  2M88 A;  2ZZM A;  4H4O A;  3J81 U;  3V6H A;  1NSP A;  5B7W A;  4QJV A;  1ULR A;  3A8J A;  1SQG A;  4IOC Q;  1FKO B;  5C24 A;  1VQ5 S;  2WVF A;  5CZX A;  4J9O A;  3DLL Q;  1QD1 A;  4YHH J;  1RA6 A;  4I2Q A;  4J9L A;  3OXL A;  4O44 B;  2J6T A;  4EYH B;  1T7P A;  4RO0 A;  3BYR A;  3ZZO A;  1YZ6 A;  1YRT A;  5B0F A;  3FQK A;  5B0D A;  3J80 Y;  4S0M A;  2Z4P A;  4DSF A;  3JAM U;  1WEX A;  3WX4 A;  4B3O A;  2GAH C;  4DQS A;  5GVQ A;  3HT3 A;  1EKS A;  1VRU B;  2MKS A;  4QYZ J;  3PTW A;  1PBU A;  1N36 J;  2FJW A;  4QWC A;  4EGL A;  4CO2 A;  3AQO A;  1VRT B;  2QA1 A;  1WAC A;  1NXI A;  1PC5 A;  3IXQ A;  4RW6 A;  2AKW B;  5KFU A;  2WON A;  1MRO A;  4JI8 F;  4JI1 F;  4LFA J;  1Y5I B;  1T05 A;  1LEO A;  2UUC F;  2PMH A;  1ZAW A;  2NR0 A;  2A10 A;  2XHC A;  4X4S A;  2NQP A;  2QLW A;  4I2P B;  4ED7 A;  3LUY A;  4LSL B;  3O8W A;  3VGT A;  2AX1 A;  2P9C A;  4RUC A;  3SV4 A;  1YJT A;  4P7T A;  2PI4 A;  3N01 A;  3HM9 A;  1WKJ A;  1NK8 A;  2CDR B;  3GII A;  2J7K A;  3BR9 A;  1HL6 A;  4R8U A;  1FKA F;  2B4O A;  4P2S A;  4NLX A;  6FD1 A;  3NGU A;  2RDJ A;  3GFX A;  5A6W A;  1IBL F;  4QPX A;  2HFS A;  2HMI B;  1PBA A;  2DHS A;  1QVF R;  2RRN A;  1V5V A;  4QW8 A;  1LQ9 A;  4E8U A;  4F25 A;  4AD6 A;  4B3T F;  2B56 A;  1DLO A;  1IWG A;  2JEF A;  3P4U B;  4PG4 A;  1RAA B;  1UCN A;  3IA0 A;  3IMQ J;  4FVC A;  1GTH A;  2XY7 A;  2FVP A;  3BDP A;  2NS1 B;  2AMC B;  3OXG A;  4F3M A;  4NLD A;  5DDP C;  1CJV A;  4ZHR B;  3HK2 A;  1JXL A;  2JX2 A;  3BGO P;  8ATC B;  3TZW A;  3Q23 A;  1RLD A;  3OFH A;  4FYW B;  1UWA A;  1I94 F;  2ASD A;  1FRX A;  1BY9 A;  2IC3 A;  1JJH A;  1RT7 B;  1KC8 T;  2ALY B;  1C0U B;  2MZQ A;  4OMF G;  5BXI A;  3D54 A;  3BM7 A;  3J7Z 5;  2IHR 1;  3TZX A;  2APO A;  3K7R A;  3KHH A;  4NLR A;  2B9Y A;  3IAS 9;  4P9S A;  4OX9 J;  3JSM A;  1K8A T;  2V8H A;  3EMT A;  3R97 A;  5DGA A;  2X3G A;  4QOT A;  1ZYQ A;  2BKP A;  4N76 A;  3TAP A;  3SSS A;  3ETO A;  4NXN F;  2P6S A;  4FPR A;  3NY0 A;  3QBC A;  1OQ6 A;  2VA2 A;  5F8I A;  3AOB A;  2BAN A;  3UR3 C;  4D3G A;  2Y1J A;  3A3O B;  1MMN A;  1YKW A;  1MU2 A;  2PI5 A;  2X3D A;  3R6G B;  4J37 A;  4RW8 A;  1Y9O A;  5I42 B;  2RS8 A;  4OZ2 A;  1U25 A;  1PJ6 A;  3DNC A;  1F60 B;  1XNR J;  3HFZ B;  2Z58 B;  4ZN3 A;  4OL8 A;  5ETP A;  3CJ4 A;  4M5D A;  4DCJ B;  2HW3 A;  4F36 A;  1HIY A;  4QWD A;  2HHT A;  1KFS A;  1LFW A;  4OYM A;  4NI2 A;  5J2Q A;  3DGV A;  4OZ1 A;  3CJ2 A;  2VFV A;  2FHJ A;  3GG1 A;  3M2R B;  3OQ2 A;  2R7R A;  3M8Q B;  4M5H A;  2K3I A;  4HH0 A;  3KJQ B;  2DY9 A;  3N28 A;  4J9P A;  4JI7 F;  4Q8F A;  2V8D A;  4LF5 F;  2DR9 A;  4MIA A;  5KFH A;  1KTQ A;  1NHK L;  4NCA A;  2NPF A;  3B4D A;  2R8K A;  4DUY J;  4ZVR B;  4G65 A;  1EAY C;  2WOM B;  1LWF A;  1PYS B;  3PDN A;  1U0H B;  4N5S A;  2P5V A;  1VGY A;  2DK2 A;  2G1H A;  2DGX A;  3NGT A;  1REG X;  3A8E A;  2MGZ B;  3CXC R;  1JNZ B;  4FXD A;  3GON A;  3LAN A;  4F4A A;  3F56 A;  2KXN B;  3PY8 A;  5THW A;  4HDH A;  4DG1 A;  1FRJ A;  2G9O A;  4ES1 A;  3WHI A;  1QAJ A;  1FVS A;  4NCG A;  3G8S A;  4U6P A;  4B3S J;  3MCN A;  3SIP B;  1RTD A;  3PYD A;  1VBX A;  3G2X A;  5LJ3 Y;  3SYZ A;  2C3P A;  2OPS A;  3C16 B;  3MXH P;  2UU9 F;  2HNZ A;  4MFB B;  4WFA Q;  2DRA A;  4GO5 X;  1CLF A;  2IBO A;  4B9N A;  1FA0 A;  2QFJ A;  2RNE A;  5HSP A;  4LMZ A;  1NK6 A;  2BDP A;  2BVZ A;  3F0N A;  3AOA A;  5LXY A;  3OFE A;  4K2X A;  5HN0 A;  2AHO B;  1NJW A;  5GAH U;  3FBE A;  3PIP Q;  3ENW A;  1QUP A;  3DU5 A;  5E3P A;  2CPH A;  3RB6 A;  2VG6 B;  2W9A A;  4ZPC A;  2YKA A;  4TY8 B;  2B43 A;  2KB2 A;  1S97 A;  4WU3 A;  1VQN S;  4DV7 J;  4FYX B;  1UJ5 A;  4UZC A;  2DGT A;  4LF6 F;  3KMQ A;  2IIH A;  5BJR A;  1HBU A;  1M5K C;  3KLF B;  3OUY A;  2KZM A;  4RLE A;  2VQE J;  1WKK A;  4UOC A;  2RAQ A;  1C4A A;  5JJB A;  1IBM J;  3FEZ A;  4IRD A;  1IKX A;  2RML A;  3KLH A;  1FDD A;  3CDW A;  1SUQ A;  3LTO A;  4CLP A;  4DQQ A;  3T5J A;  2XMU A;  4YFU A;  1Q79 A;  2COL A;  3WIU A;  1RHQ B;  2RHQ B;  4EBC A;  3K5N A;  1VHF A;  3KHR A;  3MEE B;  1AB8 A;  2PFD A;  2DNY A;  3OL9 A;  4YQW A;  1QAI A;  2AJ2 A;  1VQ6 S;  2UXD J;  2W7O A;  1S5Z A;  4JUZ A;  3CO0 P;  1OMS A;  5K8M A;  2B9X A;  1MW7 A;  3AFG A;  2FLP A;  5CAB A;  4B17 A;  2C28 A;  2Q1L A;  1NZ8 A;  2H4Y B;  1KN6 A;  1N0U A;  3AHP A;  1ZM2 A;  3QPI A;  3C8Y A;  2CPI A;  4C0O C;  4OZ0 A;  4DMZ A;  1NH8 A;  3VAK A;  2YPZ A;  1HD0 A;  1U48 A;  2W4D A;  2FDN A;  1DBD A;  1NZA A;  3QGI A;  1S1U B;  3ZZU A;  1PG5 B;  3Q8P B;  1XR5 A;  4DV6 F;  2DPI A;  2CQH A;  3MOJ B;  3Q2S C;  1FES A;  2XYG B;  3IS9 B;  5IQ6 A;  3RB0 A;  1AFI A;  3DMJ A;  2HHQ A;  2YY3 A;  1VBK A;  5KFS A;  5L1J A;  5K8O A;  2XZW A;  5HK4 A;  3L09 A;  4B9M A;  5K9F A;  3ISZ A;  4HTI A;  3W5X A;  1HA1 A;  3B78 A;  3FC9 A;  3I96 A;  3Q8Q B;  1X4E A;  2Y1I A;  2KFY A;  5F8N A;  1VRQ C;  3D0I E;  3W3S A;  1AYE A;  1RGV A;  2FTR A;  3KG4 A;  4B9L A;  5AJ3 F;  3DOM A;  2ZH1 A;  3I5A A;  3CDE A;  3V6D A;  1FXL A;  1F6T A;  3QJL A;  1N5Y B;  1FFG B;  4KQZ A;  4X66 F;  4YME A;  1LW2 A;  4MT1 A;  4C48 A;  1P1T A;  5HRO B;  1KBR A;  4ZIT A;  1SQE A;  3DOL B;  1Q1K A;  4EWT A;  3RJM B;  3K0J A;  5ETK A;  2DIV A;  5F9N A;  4BLG A;  3V4I B;  2BJ9 A;  4CLL A;  3OFF A;  2NCK L;  2VKR A;  2LXU A;  4NWB A;  4L3N A;  2YTC A;  4K4T A;  1FRI A;  2C3U A;  3MFI A;  2F9D A;  4JBC A;  4C8O A;  1NJI T;  1WC4 A;  2J9C A;  4USJ C;  2DNQ A;  3VCD A;  4JI4 J;  4NXM J;  4I7F A;  4WK3 A;  2OAU A;  4ILM A;  1IM6 A;  2B0G A;  1C2P A;  4AQY F;  4M94 A;  1NM2 A;  3LGM A;  1IKY A;  5K20 B;  3PRB A;  1J5O A;  2DD8 S;  4DR4 J;  4Q43 A;  1S1V B;  1I1G A;  1EP4 B;  2AWZ A;  1RT5 B;  1Q7L B;  3GWC A;  3KK3 A;  2ZBQ A;  2PN6 A;  3MM9 A;  3G6E S;  3ZTQ A;  1CPZ A;  1LWE A;  3MUV P;  2RUG A;  3P8B B;  1RAJ A;  1HW9 A;  2OPP B;  5CYJ A;  2OGU A;  3Q8U A;  5LSL A;  3T9N A;  2MQP A;  5D4O A;  3UNY A;  1M5O C;  5DRK A;  3R6L B;  4KGK A;  2EVZ A;  1YJU A;  3QIP A;  4A47 A;  2AQ4 A;  2CWK A;  2HIY A;  3R27 A;  5J2P A;  2K1R B;  4AL7 A;  2CJ9 A;  1APS A;  4JV5 J;  1VMB A;  2LU2 A;  3BN7 A;  2DBB A;  2BJD A;  2R8J A;  4UOH A;  1T0T V;  3MM8 A;  4LF9 F;  2M8D B;  4C3L A;  3D4J A;  4RJV A;  2YNF A;  4EYI B;  4ZVS B;  1AZS B;  4RNH A;  5IT4 A;  4CP5 A;  3MMB A;  3IBW A;  4PPZ A;  4QIW D;  2B6A A;  4DFK A;  2VBW A;  3DXB A;  2RSQ A;  3TAM B;  4AE5 A;  5J2N A;  3PNI A;  3TEG A;  3CD7 A;  2QYG A;  5B09 A;  1JNR B;  1TVR A;  4Q0B A;  1HQE B;  3MMC B;  3AY0 A;  5L1K A;  1LV5 A;  2LVW A;  3BB5 A;  1IKW B;  1U2C A;  2RE1 A;  1JLA A;  2FIU A;  5M2R A;  4JP8 A;  3LF0 A;  1VQ7 S;  5A2Q U;  4ECT A;  3M30 A;  3DFE A;  5GAE I;  3CD5 A;  2DH7 A;  2CG8 A;  4GO7 X;  5CAA A;  1TAQ A;  3POT A;  2GGP A;  3DXS X;  3AA9 A;  1CJK B;  2G2O A;  5FDL B;  1KS2 A;  3IC1 A;  1CG2 A;  1REV B;  2CQD A;  1HNZ F;  3CDB A;  3Q86 A;  1YRX A;  1NSK L;  2HBY B;  4DV5 J;  3W7B A;  2VZ9 A;  1SKS A;  1YQH A;  3D28 A;  1RA7 A;  5E0O A;  3HVT B;  3CE8 A;  4LT6 A;  4KHR A;  5A76 A;  3DDK A;  1S1X A;  4IDK B;  4J91 A;  1CJU B;  1Q82 T;  4HYK A;  5IC6 B;  3GPA A;  3IBC B;  4ZVO B;  4URQ U;  2C2O B;  4A4J A;  2ZH3 A;  4JI2 J;  3M6V A;  4L74 A;  3UN3 A;  1AA1 B;  3D9B A;  2F1F A;  3D0H E;  1BQX A;  2H51 B;  9ATC B;  4KV8 B;  2B4V A;  1EJ7 L;  2HWI A;  2QL9 B;  2CIM A;  2CPY A;  2LEA A;  3CJ5 A;  5G4D A;  3QWU A;  3L95 X;  2I1R A;  4FS1 A;  2ADB A;  1RT1 B;  4M5M A;  5E5N A;  1S9F A;  1RKI A;  3GIK A;  1R89 A;  4UQG A;  4QR2 A;  2A2D A;  5GMK a;  4AL5 A;  3OR1 B;  4ZVU B;  3D1Q A;  2V67 A;  1KHW A;  1UVK A;  2DIS A;  1BGX T;  3UO0 A;  3NWG A;  3OL7 A;  1L3K A;  4FZV A;  4DSK A;  3IRX A;  1D8Y A;  3N4W A;  2VIH A;  2BX6 A;  4CLS A;  4ZMM A;  3K5M A;  4RNN A;  3KK2 A;  2FY1 A;  2XSJ A;  2ATL A;  2VDI A;  1U6Z A;  3NKY A;  4OYX A;  3RRK A;  3PJW A;  1B7Y B;  2PFF B;  3TJ9 A;  3JTP A;  2POK A;  2RDI A;  4F4K A;  3H8Y A;  2ABY A;  3IR7 B;  5SUH A;  2R7W A;  1ZZF A;  2QSF A;  2X1G A;  1WG4 A;  1QSL A;  4R5P B;  1GX5 A;  2RU3 A;  4MIW A;  1KQS R;  1SIW B;  3PRD A;  3GYG A;  1UKU A;  2VOO A;  4ELT A;  4HI1 A;  1JLQ B;  3E01 B;  1TK0 A;  4Y2C A;  2QC3 A;  3BBC A;  3M1V B;  2IAJ B;  5L46 A;  2DNN A;  1HPZ B;  3HPO A;  3K57 A;  2ZVS A;  3MM7 B;  5K14 B;  2YKN B;  1U26 A;  4LSN A;  5LSR A;  2J0S D;  2X1A A;  4ZP9 A;  3D67 A;  3TWZ A;  3NCR A;  4YP3 A;  2N7Y A;  1OO0 B;  4U7C A;  3LGH A;  4RUA A;  2L9D A;  4L76 A;  2AYE A;  1ITP A;  2LEB A;  3KNA A;  2R4F A;  5B0C A;  2N4C A;  2VPX B;  4TQR A;  5B0B A;  4A46 A;  3QLH B;  3ENQ A;  2IYG A;  1JLG B;  2JLF A;  4A8K A;  3DM2 A;  2M52 A;  1FD2 A;  2YNG A;  5HP1 A;  4XDD A;  4B08 A;  2VC1 A;  2J0Q D;  5A8W B;  4WFX A;  2PC6 A;  3MCS A;  2OML A;  1LK5 A;  1RQ0 A;  1SC6 A;  2GHV C;  4MK8 A;  1JXV A;  1RP5 A;  2BRL A;  1WHX A;  2RH3 A;  1JB0 C;  5ETR A;  3BGF A;  2FGO A;  3PJ9 A;  2MLZ A;  3TI0 A;  4WTY A;  3CMA S;  1DTQ A;  2IVY A;  4QR0 A;  5A8R B;  2HRY A;  4G3I A;  5F8G A;  4LF1 A;  1UVN A;  4DV0 J;  4J7C A;  3W61 A;  2KG1 A;  4TN2 A;  4JV0 A;  5IV3 A;  2R8I A;  1RCX B;  2VHG A;  4ZS6 A;  1VC0 A;  3U1N A;  2MPU A;  2KM8 B;  4OHW A;  2W24 A;  3KLG A;  1TKZ B;  3CVK A;  1S6O A;  2CPD A;  3KJF B;  5E2Q A;  3JQK A;  2WVB A;  4IRK A;  1S7I A;  2AZ1 A;  1J27 A;  3H2V E;  1HBM A;  3QZ8 A;  5KAK A;  2E1A A;  2CQ3 A;  3K2Y A;  4DV2 J;  2CQ2 A;  4WFZ A;  4PG8 A;  2HHV A;  4HKQ A;  3DDN A;  1GQE A;  5D6G A;  2E1C A;  4H4M B;  3KYL A;  3BO4 A;  1YBA A;  5DET A;  4HEA 9;  1NDK A;  5E41 A;  2YX7 A;  1M1H A;  5I4M A;  3CCJ S;  4RWW A;  2VBZ A;  3OVS A;  1VQK S;  2QL7 B;  3JXO A;  2HHP A;  1NKC A;  2PEB A;  2RIJ A;  1ROF A;  4ER8 A;  4HH1 A;  2OEK A;  4W4M A;  3DLE A;  3L7P A;  5CD4 H;  2GO9 A;  1U02 A;  4FKY A;  4GKK J;  5C5J A;  1MWQ A;  3W2W A;  5GME A;  2QSW A;  4FYV B;  4LF4 F;  1VJQ A;  3OT9 A;  3Q89 A;  2FUG 9;  1GT8 A;  3C6T B;  3CCT A;  5CYQ A;  3NNC A;  3N0V A;  1XR7 A;  4AXJ A;  4OV6 A;  1TK8 A;  1RT6 A;  1TKT B;  5KG2 A;  4N47 A;  1C4C A;  3HD2 A;  3HI9 A;  1YTY A;  5A6P A;  4PWW A;  1PJ7 A;  2HVZ A;  3UD3 P;  2F40 A;  3W2V B;  2DT9 A;  4ATN A;  1R0B G;  1S0N A;  4ZJO A;  2CPJ A;  3BKF A;  1RWO B;  3CCV S;  5IXU A;  3SFU A;  4U67 Q;  4C3M A;  4EZ9 A;  3A1Y G;  2XNR A;  2E7V A;  2V0N A;  4MKV A;  2VD3 A;  3OTC A;  4ENO A;  1AUS L;  1AW0 A;  3R1L A;  5CH7 B;  2F8H A;  3I5C A;  1TR0 A;  3ITH B;  2XMA A;  4CO1 A;  4DV3 F;  3BRE A;  3FDS A;  4DV4 F;  4WXO A;  4WFN Q;  4NL5 A;  2F4V F;  3DCA A;  4O3Q A;  5IOL A;  3HMJ G;  2P9G A;  1GMW A;  3G71 S;  2MY8 A;  3T6B A;  1TMM A;  4RNO A;  4ZLP A;  2MQN A;  4L73 A;  4DR3 J;  2XMK A;  4C11 A;  4CNY A;  1L3S A;  4IUF A;  2I0X A;  2WCX A;  1FO1 A;  3LP2 A;  1I51 B;  2K3K A;  1HNX J;  2W25 A;  3DI6 A;  3W65 A;  4X62 J;  4OI3 A;  3GR1 A;  3GIM A;  4PWD A;  2GJ2 A;  1CQN A;  1N32 F;  2ZH7 A;  2HVE A;  1BQN A;  2U1A A;  1WTB A;  3MUR P;  5EWE A;  2J6S A;  2W4P A;  3HT0 A;  1VQ9 S;  3PHE A;  2YWK A;  4X62 F;  3HJF A;  4NYP A;  4KGZ B;  2XG8 A;  1FK9 B;  3RW7 A;  5L38 A;  1KOH A;  5IT0 A;  3MPY A;  1XMB A;  5C24 B;  2N3L A;  1T3O A;  4JV2 A;  1R0A B;  2W2P P;  4RNM A;  1P1L A;  3N6N A;  2W8L A;  1A9N B;  4LFC J;  1KOO A;  1WI8 A;  1S1T A;  2Z30 B;  2HAF A;  1VS3 A;  1SJ4 P;  2BOP A;  2IA0 A;  1UTA A;  2CJY B;  2HND A;  3UN2 A;  1NB2 A;  4QU7 A;  5J1E A;  1U49 A;  4EU0 A;  3LW5 C;  3KJV B;  3I6P A;  2DH8 A;  4DF8 A;  1H6K X;  3S6E A;  1FEH A;  5BR8 J;  3EVO A;  5IQQ A;  5HLF B;  1VK3 A;  2NYI A;  1TV6 A;  3EPG A;  1SKU B;  4B3O B;  4I6W A;  4UST A;  4P10 A;  2K06 A;  3IN5 A;  4PYD A;  1E6V A;  2FJV A;  4DL7 A;  2XY5 A;  1T02 A;  2OD4 A;  3JQM A;  4OQJ A;  4QPT A;  2MZT A;  5HAN A;  1R6V A;  4RX6 A;  4RU2 A;  1G6B A;  1FX2 A;  4KGV B;  1T3N A;  1X60 A;  3GJS B;  4RW6 B;  1L3V A;  4WJB A;  1U7L A;  1IJF B;  1RCO B;  2C2Z B;  1H2V Z;  2WON B;  2JEG A;  2YBV A;  3M2V A;  1MRO B;  2IBK A;  2YQ0 A;  1VQY A;  4DDF A;  2ZOG A;  1JWW A;  2BUN A;  4F2R A;  1UJ4 A;  3EZU A;  2I6W A;  5KOX A;  4DWI A;  3QMQ A;  5FLX U;  1B0V A;  4FXW A;  1SH2 A;  2IPO B;  1RT3 A;  2YVS A;  4C9D A;  2H48 B;  2VAS A;  3LO3 A;  3EVM A;  4WPA A;  4F2S A;  2B5J A;  2X7I A;  3CCS S;  3PW7 A;  2XWX A;  2D69 A;  1VFJ A;  3Q8R B;  3KLE B;  5HBM B;  1FDB A;  3UDV A;  1FI4 A;  1U1R A;  1QUV A;  1IWA A;  3VR1 A;  2VG5 A;  2WSE C;  3GFH A;  1XJW B;  4K2J A;  2FHO B;  4K59 A;  1GK8 A;  4PXE A;  3HVW A;  2DJW A;  2R7T A;  2OUG A;  2AD9 A;  5J1N A;  4OJ1 A;  5DO2 A;  2C3M A;  3I0R A;  3K5L A;  3FMB A;  1ZET A;  1KNZ A;  3R2C J;  2KXF A;  2XGQ A;  3EE3 A;  1F9H A;  4BC7 A;  1JK9 B;  1CJV B;  2PO4 A;  2XQC A;  4MH8 A;  4ZIV A;  2QA2 A;  3P6Y C;  3GFY A;  5E3C A;  1T03 A;  1C1C B;  3R9L A;  1WI6 A;  1B7F A;  4OX8 A;  2OKQ A;  2J5A A;  1IBK J;  2J9E A;  2DNL A;  1NPR A;  3OHB A;  2V2Z A;  1WDD A;  1SV5 B;  1H72 C;  3PW4 A;  3B6B A;  3ILL A;  4RL1 A;  1RAE B;  4JI5 F;  4CDI A;  2CNN B;  4C98 A;  1HHT P;  2HPU A;  1SIZ A;  3NGR A;  1X5O A;  1JMT A;  1NU4 A;  4ALZ A;  1QTN B;  1WG5 A;  3TAR A;  4DV1 F;  1WHV A;  1KKH A;  4J9Q A;  1XWL A;  1LXN A;  3QID A;  2BQU A;  3DLB A;  3D0G E;  4C8K A;  2WAQ D;  4DN9 A;  2BRK A;  3OTE A;  3UD5 A;  1MU2 B;  5HO4 A;  3MCO A;  1QDU B;  4RW8 B;  1VJW A;  1HBN A;  4ANC A;  1FX4 A;  4KJI A;  1TL7 A;  1BWE A;  1S4E A;  4KSE B;  1VQP S;  4M5D B;  2OTJ S;  1S9E A;  2MY7 A;  4K5S A;  5D4L A;  1YLX A;  2OPR B;  1H2U X;  4F7V A;  1VQM S;  3P49 B;  2JOQ A;  5ETN A;  2Z2Z A;  2DNH A;  3BH7 B;  4OJH A;  3D2W A;  5HQL A;  4USV A;  2YXL A;  2VDH A;  4J5O A;  2BA9 A;  3A8K A;  4FP9 A;  2JEI A;  1GTE A;  2GCF A;  4FPI A;  1YJR A;  1WHW A;  3OLB A;  1LWF B;  2LU1 A;  3MAA A;  1Y5N B;  3EDR B;  2XS2 A;  4M5K A;  4P71 A;  2V50 A;  3CIZ A;  4C4W A;  4LRA A;  3QWP A;  1KQF B;  2WVE A;  1VOM A;  4DG1 B;  1N33 J;  3ZXW A;  1B0T A;  2UUB J;  2DY1 A;  5HL7 Q;  2CAD A;  3A8I A;  1I3O B;  3ICL A;  1FE0 A;  8RUC A;  1VLO A;  1RTD B;  2ZJR Q;  4PG5 A;  1TAU A;  4Z2X A;  2QIF A;  4KH0 B;  4C7Q A;  3T6J A;  1U09 A;  3H0P A;  3HJV A;  1WOP A;  4YEA A;  1FT8 A;  2OMO A;  2KL8 A;  4I0W A;  4F4Z A;  4OHY A;  1UL3 A;  4B9V A;  2JDJ A;  5A0Y B;  3FJ2 A;  1GFW B;  4UQT A;  1K9M T;  4JI0 F;  2XYH B;  1SJ3 P;  2PE8 A;  1VC5 A;  2O66 A;  2R2T A;  2IJN A;  3SQG B;  3N6M A;  4OYB A;  2IRX A;  3PR5 B;  4LF8 J;  4FDF A;  3M9M B;  2VV5 A;  1U1Q A;  1XEZ A;  4CH1 A;  1SKW A;  4WP8 A;  2KVQ E;  4HHU A;  1Q78 A;  1FJE B;  2RU9 A;  3H90 A;  1KLM A;  4NRU A;  1N48 A;  2AYB A;  3JQJ A;  3EUN A;  1CC8 A;  3CDU A;  1X4F A;  5HMZ A;  2A2C A;  4LF2 A;  4USW A;  3TVZ A;  2HZA A;  2NZ4 A;  1YBU A;  4HI2 A;  2WW4 A;  4QCL A;  1JLC A;  1RWK B;  1IKX B;  3KLH B;  4DPU A;  2F7V A;  1HI8 A;  1SUQ B;  2PGC A;  3GLJ A;  1KEK A;  1VBY A;  2CQP A;  1N34 J;  1RBA A;  3KG0 A;  3L9Z A;  2WSF C;  3D3B J;  3LP1 A;  1JLB A;  1HR0 F;  3HUL A;  2C2D A;  4G1Q A;  4Y65 A;  4JI3 F;  5A8K A;  4RZR A;  3PYE A;  2XTJ P;  4ZN1 A;  2XWY A;  2W9C B;  4DL6 A;  5BYQ A;  2VUG A;  1JX4 A;  2HQG A;  3EGZ A;  1RTJ A;  1TUV A;  3MTJ A;  4YB7 A;  5AXK A;  4DX7 A;  3NBP A;  1R43 A;  4J9S A;  2P9E A;  3M8P A;  1N52 B;  2Y0S D;  4XK8 C;  2XMM A;  3E8O A;  3DKD A;  2W2N P;  2XLJ A;  1JLE A;  2KYZ A;  1CBK A;  4HVZ A;  4RWX A;  4EZ6 A;  2CYY A;  5LXR A;  4DFP A;  4ZLJ A;  3FQL A;  4A8X A;  2HLT A;  2MSS A;  1RZM A;  1HNW J;  3EZ5 A;  4ZCL A;  4KTQ A;  2CAJ A;  4FNI A;  2RRA A;  4LF7 F;  4NYO A;  1SVD A;  3DMJ B;  1B70 B;  1Q5Y A;  2FZK B;  3PW5 A;  4KHP J;  5LT5 A;  4XO0 A;  3T5L A;  7FDR A;  1HNV A;  5KFE A;  3GR0 A;  3O1L A;  2ROE A;  2P8I A;  3DOM B;  3AB2 B;  4X65 F;  4B9S A;  3V6D B;  2V2Q A;  4UOG A;  4DSJ A;  2MJU A;  3THV A;  1SC1 B;  2GNK A;  2KU7 A;  3M32 B;  5D15 A;  1FXR A;  1LW2 B;  2AEM A;  1BUX A;  5DG8 A;  3IRW P;  5KFQ A;  1RAO A;  3MEG A;  4HLB A;  2ZJQ Q;  4IFV A;  4TU8 A;  2YWF A;  2VQF J;  2AJ0 A;  1V3Z A;  5EWF A;  4CRJ A;  3PRV A;  1BMQ B;  4H54 A;  4M8L A;  3SCK E;  2BAB A;  1SH0 A;  1KQK A;  3GIR A;  2VF3 A;  4XIU A;  1TL5 A;  1X7V A;  2F65 A;  2QLF B;  2CNO B;  4ICL A;  2ZM6 F;  1ZA1 B;  3O2I A;  1E6Y B;  4DR6 J;  4J9K A;  4O4G B;  1HQU A;  1LOU A;  7AT1 B;  4XPC A;  4AFF A;  2BW7 A;  1YG0 A;  3MM5 A;  1J5E F;  3ISN C;  2ZKT A;  1C0T A;  4O44 A;  1UFL A;  4ED3 A;  1LK7 A;  4I7F B;  3M8Z A;  2BE2 A;  1VIO A;  4HR2 A;  2IA6 A;  3K5P A;  4AND A;  4OI4 A;  1BC6 A;  3PR4 A;  4WP3 A;  2LDI A;  3J7Y I;  3FCH A;  1S6Q A;  3RB4 A;  1Q7Y T;  4MTP A;  2V4J A;  3DC2 A;  5IWA J;  4WK1 A;  4W98 A;  2ZZT A;  1U24 A;  3KK3 B;  1EKR A;  2ZDP A;  4CT9 A;  3GCW P;  4NZ7 A;  3MMJ A;  1IKV B;  4F50 A;  2YPY A;  2MZR A;  3GSD A;  3R8Y A;  2OI2 A;  2MKK A;  3DYA B;  4NE9 C;  5MLC V;  4YOE A;  2CNK B;  2A6M A;  2WBR A;  5HMW A;  4GC7 A;  1RBL A;  4OHZ A;  1VRT A;  3RRG A;  2Y8W A;  1FRK A;  1SJR A;  2J9D A;  2Z2M A;  2B8P A;  4F04 B;  2OFH X;  4DR5 F;  4DSL A;  1U1K A;  3FSY A;  1KON A;  1RAG B;  2DHH A;  3SZ2 A;  3F44 A;  3IAM 9;  5D0G A;  3J81 Y;  3FRZ A;  2CNL B;  3FCW A;  2VU5 A;  2YNF B;  4I2P A;  1XQI A;  3TVY A;  4QWA A;  2G13 A;  2QV6 A;  5DG9 A;  3TUI C;  1EAR A;  1SPB P;  2VFS A;  2Q6B A;  1S12 A;  2UXB F;  3TO8 A;  3DDI A;  4USM A;  3OVB A;  1X4G A;  3OVA A;  2VOP A;  4IH6 A;  5DS7 A;  1TVR B;  3CCE S;  4KKO A;  3PO5 A;  3JAM Y;  2V34 A;  1IM4 A;  4KRW A;  3ZO7 A;  1NUE A;  4DR2 F;  2HMI A;  5KFD A;  2E5G A;  1FTR A;  5JVG Q;  2HKE A;  3PVX A;  1QM9 A;  5H1S V;  2UUA J;  3KJN B;  2WBM A;  1W7W A;  2EFG A;  2MZS A;  2BAC A;  2ZDO A;  3S7R A;  1N0V C;  3QJJ A;  1ZOT A;  2ZH5 A;  3CCW A;  4QU6 A;  5U47 A;  2RF2 A;  3TA1 A;  4ERD A;  2ZWO A;  2IM3 A;  1NAQ A;  1YJV A;  4UY8 5;  4IKA A;  2XS5 A;  4M5J A;  3CIM A;  2R2U A;  4PAB A;  3M05 A;  3NS6 A;  1R8A A;  3DRR A;  2OPQ A;  1FNM A;  2HVI A;  2HHH F;  2G4B A;  4BC9 A;  3FKB A;  1RAC B;  1NLK L;  4YY3 F;  4F4Y A;  1C0U A;  4ED1 A;  4Q7A A;  1S1X B;  4C8M A;  2DXD A;  4X4Q A;  2OEM A;  1GXU A;  1Q8I A;  2XCA A;  4GVL A;  3DRS B;  7FD1 A;  2LQJ A;  2DGS A;  3CC4 S;  3I9Z A;  4LR7 A;  3W64 A;  2HRU A;  2JLE A;  3MR7 A;  1S99 A;  4DZD A;  3BKU A;  2LQ5 A;  3L4B C;  2YNH B;  1RXO B;  2F63 A;  2HGL A;  2R8G A;  2HSE B;  3ZFV A;  2GHP A;  5HJY A;  3R5C A;  3ZZ0 A;  1MN9 A;  1P9Q C;  4RR5 A;  2CJX B;  1QSS A;  3NOC A;  2HBZ B;  2BJ8 A;  4NLT A;  2EI5 A;  1S6U A;  2KDO A;  5I42 A;  1KHV A;  5FJ4 A;  1RSC A;  4DCP B;  5C7P A;  2OFG X;  1FWP A;  1LFP A;  5DZ6 A;  2RHS B;  3AAW B;  2EKY A;  3N5F A;  4KYZ A;  4AT1 B;  2H9Z A;  2VFR A;  4NYZ A;  4NA2 A;  3NGK A;  4ECW A;  3NEK A;  2OEJ A;  5DZ7 A;  3TJ8 A;  3M8Q A;  5DG7 A;  2BR0 A;  4EFA C;  3H25 A;  1LKZ A;  3W60 A;  1EHW A;  4NA1 A;  2X1F A;  4NMX A;  1SL0 A;  4RUH A;  4WZM A;  2ZD1 A;  2XMJ A;  1XNQ F;  4WF9 Q;  5KFA A;  3CMQ A;  2B9E A;  2WOM A;  1G7C B;  3HHK A;  3Q0A A;  4NLW A;  2MGZ A;  2LQ9 A;  5LSO A;  3THT A;  2DCU B;  2DHX A;  2UVR A;  4TLR A;  2L41 A;  4MK7 A;  5HAO A;  1OYD A;  3LAK A;  1YK9 A;  2AEJ A;  1L3T A;  4ZVP B;  1FNX H;  4WE1 B;  2JRS A;  5IT9 U;  5DDQ C;  1NHU A;  2KJV A;  3G96 A;  3G6V A;  2ZBR A;  2ZIT A;  2OD6 A;  2KZZ A;  1FF2 A;  4TXS A;  1BD6 A;  1ZZN A;  1HNI B;  1C1B B;  1FJC A;  2LLZ A;  4L75 A;  4PXC A;  4CQ1 A;  4DPX A;  1NME B;  2P2C B;  1YWX A;  4G1P A;  3DOK A;  4KT0 C;  2OTL S;  2CQ4 A;  1O6X A;  2EBE A;  1WOS A;  1DQA A;  5CYM B;  3H2U B;  2XMT A;  4F3O A;  4JB8 B;  1L3U A;  4G6V B;  2OSQ A;  5HMY A;  1LW0 A;  2VG6 A;  2HS0 A;  2Q6C A;  4A8M P;  2V9W A;  2D9O A;  4TY8 A;  4WII A;  1S7H A;  2MXY A;  1FCA A;  2PSZ A;  2JL9 A;  2JHE A;  3T19 A;  3NAI A;  3OL8 A;  3KLF A;  1OWX A;  2YNI A;  1UA1 A;  5T14 A;  4CYU A;  2EC0 A;  5LOQ A;  3QGG A;  3OTO F;  1MML A;  1RU1 A;  5HMX A;  3V4M A;  1HWK A;  3US5 A;  4PCQ A;  3CJR A;  3SI8 A;  1DHM A;  4JI8 J;  4BWM A;  3MEE A;  4JI1 J;  2PT0 A;  1X9M A;  2UUC J;  2AGO A;  5JUM A;  3DLK A;  1X4C A;  1NDP A;  2AIR B;  2WHO A;  3ETM A;  4QIE A;  3KLG B;  3T1H F;  4LIR A;  3TJA A;  3CC7 S;  5HVH A;  1UW9 A;  4CO3 A;  4MMO A;  1HBM B;  1HYS B;  5D8H B;  1M5S A;  2BJE A;  2ZNY A;  4LRB A;  4B02 A;  3TZY A;  3CUL A;  3KTQ A;  3V81 B;  3HVR A;  1U2F A;  1T11 A;  1IBL J;  1VIX A;  1S1U A;  4WIQ A;  4L6V 3;  1OQ3 A;  4EK2 A;  2M8H A;  2VON A;  4MYU A;  1U45 A;  2IM2 A;  5L1I A;  4B3T J;  2GC8 A;  3PW2 A;  3LOU A;  2MST A;  2FPH X;  5J2M B;  3KG1 A;  1OS5 A;  3VGS A;  3K58 A;  4IRC A;  3WDO A;  3VWS A;  2JEJ A;  2RDD A;  3TUZ C;  2HYI B;  1QE1 A;  4M63 A;  3BSA A;  4TLQ A;  2HLU A;  4RUB A;  2LQ8 A;  5DM7 Q;  1FDN A;  1NJX A;  3MED B;  3PCO B;  2FZG B;  3CO9 A;  4LRE A;  1N5Y A;  3T5H A;  3G8T A;  1I94 J;  4CM0 A;  3QT5 A;  3TAN A;  3BSO A;  1D9F A;  3GV7 B;  1RT6 B;  3HCX A;  1EIY B;  4IQX A;  5AE3 A;  1HI1 A;  4PAA A;  3L7O A;  4P7V A;  3CSK A;  1JQG A;  2IM1 A;  4IFY A;  1HHQ A;  4MKB A;  3H2L A;  4R0J A;  1S72 S;  3IWN C;  1RTI B;  3V4I A;  2YKQ A;  3SXL A;  1U1M A;  1Y00 A;  3FEY B;  3V5R A;  1H2T Z;  4USH A;  1RAB B;  4IR1 A;  4I67 A;  2EK6 A;  4IO1 A;  1K0V A;  3CT9 A;  1ZM3 A;  3FK4 A;  2MHN A;  2UZA A;  1SBR A;  2HWT A;  4NXN J;  1S1W A;  1KTV A;  4UZB A;  4DHV A;  1TZ0 A;  3EM1 A;  1WDT A;  1B99 A;  1WWH A;  1RB0 A;  3CGI A;  2E5L F;  1FJG F;  2NXU A;  2I8E A;  4N8O A;  1KLN A;  4V19 J;  5DGB A;  2JJ4 D;  4CCH A;  2XB2 D;  2RQC A;  4D3H A;  4DL2 A;  1EP4 A;  1RT2 A;  3ZZR A;  3W63 A;  4Y3C A;  1JKH B;  2IVF B;  3MR2 A;  1NO8 A;  1U4B A;  1F1B B;  5KFN A;  4URS A;  3HP6 A;  1M5P C;  2CA9 A;  5L8R C;  2DR5 A;  4B3M F;  4YR3 A;  5ETT A;  5KFJ A;  3NNA A;  2F4F A;  3ZC4 A;  4DR1 F;  2J9D E;  3DI6 B;  4JI7 J;  4X64 F;  1EET A;  4LF5 J;  3EXC X;  2HHW A;  4KAI A;  1CJT B;  2DKO B;  4RW9 B;  2EWH A;  2KI2 A;  1UZH A;  1PAE X;  2VFT A;  1TUG B;  2AX0 A;  4WYL A;  2Z0G A;  3RAM A;  2E5I A;  3RBE A;  1AZS A;  2CVI A;  3IBF B;  1VI7 A;  4F0M A;  5GAD I;  1XN9 A;  4DI6 A;  1PIL A;  1PKU A;  2DCL A;  2O3D A;  5KFK A;  2V68 A;  2CPX A;  4K4X A;  2E1R A;  2V6A A;  1RDR A;  5DQG A;  3TAM A;  1SC4 B;  4DLE A;  1EQ0 A;  2DNM A;  1U1N A;  1S1T B;  4PUO A;  2J0X A;  3MMC A;  2GMH A;  5G0R A;  3DLH A;  4P2X A;  5KFM A;  2NSB A;  1RHJ B;  1XTZ A;  2BEF A;  2UU9 J;  1S0O A;  4MAK A;  6FDR A;  1NND A;  2KFZ A;  3UI3 A;  2ZUG A;  1U2R A;  2V8V A;  3MEC A;  1LWX A;  1XMQ F;  1N6Q B;  1OJ4 A;  3Q22 A;  1NKB A;  1NSQ A;  3DRY A;  2HS4 A;  2EFQ A;  3SV3 A;  1CJK A;  1KDN A;  5EGY A;  5FDL A;  1HAR A;  3LP0 A;  1AUD A;  2FJE B;  3H5S A;  1REV A;  1HWI A;  2EFO A;  1WNE A;  3QGH A;  2QLB B;  2HBR B;  1WSV A;  2GVZ A;  1TTH B;  3C3L A;  5KFC A;  4V1A k;  2QG9 B;  3LGN A;  1RAF B;  3M2V B;  2D3O 1;  2RKI A;  4Y2I A;  1SJ1 A;  2I5J B;  4LF6 J;  3BDE A;  4OI2 A;  3CJQ A;  1KSP A;  3CJ8 A;  2DNP A;  1Q16 B;  1CJU A;  4GKJ F;  3GTY X;  4WTO B;  3TVK A;  1T8E A;  4Z37 A;  2W9B A;  1AFJ A;  1UWB A;  1YI2 S;  3GIL A;  2OO4 A;  4LR8 A;  3P45 B;  1Q53 A;  2B5J B;  1N8R T;  3TZZ A;  4OZ5 A;  5T7L B;  3B82 A;  4U95 A;  2XLI A;  2Z2Y B;  5HVG A;  2F5G A;  4DS4 A;  2HRT A;  3KHG A;  3KOA A;  5A2Q Y;  5DM6 Q;  3C6U A;  1RT1 A;  2H5J B;  3K5O A;  3PJX A;  1IQT A;  2PD1 A;  2KG0 A;  4Z7C A;  4X4O A;  4P6Q A;  1HD1 A;  3UCZ P;  3MF5 A;  3JTO A;  3WZ0 A;  3N5B A;  3T1Y F;  1WC1 A;  1O0P A;  2GVD A;  4X4R A;  4DSE A;  5C42 A;  1IR2 A;  4P72 A;  2KH9 A;  3CC2 S;  2ZEJ A;  3R7B B;  4DBQ A;  2EBG A;  1DFD A;  1Q95 G;  1T9W A;  3D6M B;  4HHJ A;  5EX3 A;  1ZPV A;  4ID5 B;  1FVQ A;  4DV6 J;  4PG6 A;  2N3O A;  3BGR A;  4Y2A A;  1H73 A;  1Z1Z A;  2GW8 A;  5ETS A;  5DQI A;  2HZV A;  1WOO A;  3D1H A;  3U1M A;  2XI2 A;  2HQD A;  3IGN A;  3K8W A;  3MD1 A;  2ZH4 A;  2HHU A;  2DR8 A;  1UMJ A;  3MTK A;  1KQG B;  1TFW A;  2KRB A;  4U9R A;  2MQM A;  3D1O A;  5KT2 A;  3MR6 A;  4DQP A;  3W5Z A;  3UNG C;  4ES2 A;  4KGM A;  5AJ3 J;  4R5P A;  2NXN A;  3BV8 A;  2FJA B;  2DIU A;  4X66 J;  5CQG A;  4ZCK A;  1JLQ A;  5B0A A;  5ETO A;  2GIQ A;  5CCM A;  1RWV B;  1N5Q A;  3E01 A;  4Q2L A;  3LAM A;  3QNW B;  3RR7 A;  4AYB D;  1D3W A;  4RW4 B;  4DL3 A;  2L9W A;  2IAJ A;  3ZZZ A;  2R7U A;  1HPZ A;  4CLT A;  5E3A A;  4IG0 B;  3EWG A;  3NGD A;  2YKN A;  1Q81 T;  3LAL A;  1HBN B;  2M0G B;  4PQU B;  3LA0 A;  1G2E A;  5JVH Q;  1TKX B;  3ZZP A;  3CD6 S;  2A3J A;  3I0S B;  5ETL A;  3V6K A;  1UEU A;  5DDO C;  1VQL S;  2JFD A;  1FKP A;  3D66 A;  4CH0 S;  4ZCM A;  2C2N A;  4OHX A;  5ETM A;  2GIF A;  4ECZ A;  2BV3 A;  2E29 A;  1JLG A;  4KO0 B;  1WHY A;  3ZNU A;  4AQY J;  3M6X A;  2GQ2 A;  2NUH A;  3M2U A;  5D77 A;  3Q8Y A;  1VIS A;  4R0E A;  3BKT A;  4KE5 A;  1YDL A;  5A8W A;  4HT7 A;  3M7V A;  5KFY A;  3MAA B;  4A8W A;  1OYE A;  4C6A A;  5I3Q A;  2UV8 A;  2MLX A;  3BO3 A;  3BQ0 A;  2Y8Y A;  1FER A;  4I6A A;  3ZNJ 1;  3W9H A;  1VDH A;  1QJH A;  5EWG A;  1QSY A;  3NCQ A;  5A8R A;  2UVU A;  5K8N A;  2AP6 A;  5GAG I;  1T9X A;  4Q8E A;  1PC4 A;  1ZBT A;  4ED0 A;  2LEC A;  3EZO A;  4LF9 J;  5LMN F;  4DR7 F;  1YJ9 S;  2EPI A;  5EUH A;  5KFG A;  2K7K A;  2LCW A;  2AGP A;  4CLY A;  1TKZ A;  1FTC A;  4UW2 A;  4OI0 A;  3V2U C;  2U2F A;  2IM0 A;  3SDE B;  1NPK A;  4O3S A;  4TY9 A;  1K1Q A;  4NAS A;  1TL4 A;  1WUU A;  1OIA A;  5GAE U;  3IWL A;  3MWB A;  4KB7 A;  4JYA F;  3I82 A;  2UV8 G;  3H5U A;  2BM0 A;  2DO4 A;  2BE7 D;  2ZJP Q;  1X4A A;  4H4M A;  2JZ5 A;  4NCB A;  3AT1 B;  2NXE A;  4LUB A;  3M8W A;  4I69 A;  2DR6 A;  1QAY A;  4ZPW R;  2IY5 B;  1KLM B;  1RHM B;  4HAC A;  3HSJ A;  5F41 A;  2VL1 A;  1NK5 A;  3AOD A;  2DVI A;  4DUZ F;  3DLG B;  4B3R F;  1UP1 A;  4K0K F;  1NDC A;  2PMW A;  4O4R A;  4ZLL A;  3M8S A;  1JLC B;  2ZBI A;  1KFD A;  1VK8 A;  4O3N A;  3BQ1 A;  3I55 S;  1B4S A;  2KTQ A;  1T9U A;  1HNZ J;  3S1T A;  5E7O B;  1M1K T;  4OFZ A;  3J7Z T;  2QTW A;  3QJP A;  1Y11 A;  2QRR A;  4IYQ A;  1YJN S;  2QMU B;  1D9A A;  1JLB B;  1R0C B;  2GV1 A;  1Z2Z A;  1XR6 A;  2EEY A;  2LYV A;  3GV5 B;  2XZD B;  4YB1 P;  5A8K B;  1HWJ A;  1X0F A;  1Z4U A;  3GP9 A;  3HHL D;  2ZC4 A;  3FBC A;  4ZVF A;  4C97 A;  4LFB F;  2GML A;  3M8P B;  3NL0 A;  5ETQ A;  4Y2M A;  1OPZ A;  5CZV A;  1UJ6 A;  8AT1 B;  4FF2 A;  5EN1 A;  4GVB A;  2B7C B;  4WFB Q;  4IH7 A;  4JI6 F;  5AE2 A;  4QIV A;  2ZH9 A;  4QYR A;  4ZPV R;  5LMU F;  4CWB A;  3O5T B;  4ECR A;  3GFZ A;  4KPC A;  2MQ8 A;  1OY8 A;  3CD0 A;  1R3N A;  1XMO F;  3I87 A;  1SH3 A;  4ZVG A;  1YHQ S;  2Q79 A;  4U7U D;  3Q83 A;  2AV5 A;  3UVJ A;  2R8H A;  1S79 A;  1TU0 B;  3OXF A;  5CHC B;  2NXC A;  2ZVI A;  5CCL A;  2J0W A;  1HNV B;  1CVJ A;  1PGZ A;  3GIJ A;  2V2V A;  1L5U A;  3K8V A;  2ASJ A;  5L39 A;  1MNE A;  4FF3 A;  2EFN A;  1R7I A;  1NSA A;  1WD6 A;  3B8H A;  1N5T A;  4XTT A;  2R2R A;  2FJX A;  1EB0 A;  1WEZ A;  4IFV B;  2H5I B;  4F26 A;  1RT4 A;  4HL9 A;  1BQM B;  2JWN A;  3TUJ C;  2B51 A;  3HDS A;  1HKA A;  4J9N A;  2CPE A;  3DGP A;  3W66 A;  2HQ3 A;  2QL5 B;  1TL3 B;  1VQ8 S;  1A0O B;  1UET A;  2VC0 A;  1LWC B;  3IG1 B;  4F02 A;  2FLL A;  4ICL B;  2G0I A;  3FVY A;  1FK9 A;  2MQO A;  1TUW A;  9RUB A;  2Z2L A;  1HQU B;  1R0A A;  2KYX A;  1CQM A;  4IOA Q;  3L3C A;  2KM8 C;  3AJ1 A;  2CQ0 A;  3H5Y A;  3MM5 B;  1C0T B;  3NAH A;  2KO1 A;  2ROP A;  2KHC A;  4H4K A;  2BE2 B;  1RHU B;  3AD8 C;  3QQC D;  4KFB A;  3CWJ A;  5AT1 B;  3G8Q A;  2LQB A;  3KJV A;  1S6Q B;  4YHH F;  4TQS A;  3A4T A;  5HLF A;  2HNY A;  2V4J B;  2AYM A;  1RTZ A;  4DN0 A;  4ZPT R;  4ZCI A;  3D3C J;  6AT1 B;  3IO1 A;  2Q3P A;  2J8A A;  4PRF A;  2AJQ A;  3AA8 A;  3UR0 A;  1RAI B;  3QSI A;  2DEI A;  2CQC A;  2QE5 A;  4M95 A;  4ECS A;  1H0H B;  1ZM4 A;  3NMA A;  4FF1 A;  1IJE B;  1N36 F;  3TQE A;  1QY7 A;  2YQ3 A;  1N56 A;  4EO8 A;  2ACM A;  3LPY A;  4W92 B;  1Q8B A;  3H98 A;  3GYX B;  2QA4 G;  3S01 A;  4G1I A;  1S6P B;  3BBB A;  3UFC X;  1VCT A;  4OX7 A;  2FJD B;  3JB9 k;  2VJU A;  3FEX B;  3DRP B;  1S4F A;  3GYN A;  2JFK A;  2DEJ A;  1G1X A;  4LFA F;  3KUG A;  1FRH A;  2CG4 A;  2RD5 C;  1T95 A;  4P73 A;  2R7X A;  3UDL A;  3KLE A;  1Y10 A;  5HBM A;  3TP2 A;  5KG4 A;  4KKO B;  2IDE A;  3QO9 A;  3HHL B;  2JC1 A;  2LXF A;  4DJB A;  4F0H A;  5HAT A;  4O23 A;  4OJ3 A;  2H54 B;  3TUP A;  5IZH A;  4C2M A;  2IJF A;  3GCX P;  1VHI A;  5HJX A;  1W26 A;  3JYT B;  4HTJ A;  2P6T A;  2CZ9 A;  4C8L A;  2ZH6 A;  2GHW A;  2E7X A;  2CZV C;  5FD1 A;  2RF2 B;  4X4U A;  3FUY A;  5KFI A;  1EZZ B;  4FN5 A;  4N41 A;  4KH1 B;  3O6Q A;  2UUW A;  2K7J A;  1KVK A;  3F41 A;  3R7S B;  3CCU S;  1P27 B;  2EXU A;  4NLY A;  5FLX Y;  5IM0 B;  5IFM A;  3W5Y A;  3DRR B;  3HXM A;  1XC9 A;  1C1C A;  2OPQ B;  2GQC A;  3G82 B;  1R8C A;  4ELV A;  5IV4 A;  4K4S A;  4DLG A;  4UTG A;  2G2Z A;  1SV5 A;  1VYA A;  4F8R A;  2A0F B;  2AT1 B;  3BGU A;  1H7W A;  1SQF A;  3E51 A;  5KG0 A;  4ZVQ B;  4TNO A;  2XC9 A;  1H74 A;  3SBM A;  1RTH B;  1CUL A;  3TR5 A;  4F4W A;  1EQM A;  4ES3 A;  4LF4 J;  2LA4 A;  4P52 A;  4DS5 A;  2ROG A;  1YIJ S;  1R27 B;  3CW2 C;  5KTQ A;  2A6O A;  2CVE A;  2VBY A;  3BS9 A;  3RW6 A;  4OX9 F;  4AL6 A;  1HMV A;  2AZ3 A;  3AD9 C;  3AXM A;  3NWR A;  4K8R A;  1IN0 A;  4YDD B;  3EJM A;  2XM3 A;  3ZTR A;  5D0E A;  2LKZ A;  3LQV A;  3R5J B;  2DTJ A;  1F5C A;  3J7A N;  3CCZ A;  1ZPW X;  4H4K C;  4ECQ A;  2AU0 A;  1D9D A;  3NP5 A;  5T41 A;  1NDL A;  1K73 T;  1V3R A;  1UVI A;  5KFL A;  2L9N A;  2VH7 A;  2PII A;  2W1B A;  4CZC A;  3OSP A;  4P2F A;  5CD4 A;  1NK4 A;  1XBW A;  2DGQ A;  2OPR A;  2ERR A;  1X0P A;  4CO5 A;  3ZZT A;  1U1P A;  1DQ9 A;  1XNR F;  1F2H A;  3VAJ A;  5FII A;  4RBV A;  3CJT A;  2GA7 A;  4DV3 J;  2EFV A;  4DV4 J;  3CED A;  3LH2 S;  3JSR A;  2D74 B;  2F4V J;  1HHS A;  3C15 B;  4ZLN A;  1WEL A;  2ZD1 B;  1HBO B;  4GC6 A;  3T41 A;  2W7P A;  4X4V A;  3MD3 A;  2UXC J;  5K5M A;  3GG0 A;  1SXL A;  1CC7 A;  1BXN A;  5DJB A;  3RR8 A;  1UVM A;  3ZTS A;  4PPD A;  2YWE A;  1F2G A;  3H59 A;  3HHD A;  3NCP A;  3CJS A;  2LA6 A;  4OYZ A;  1PYT A;  4DL5 A;  2MYF A;  5MAO A;  2MZ1 A;  2UXC F;  4DUY F;  3D5M A;  3VTI A;  4O3R A;  3IM8 A;  3VQT A;  3I9V 9;  1PAU B;  3J80 U;  2WRM A;  3SCI E;  4E2F B;  5ITH A;  3OHA A;  1JJ4 A;  1U8S A;  4KPY A;  4ZPA A;  2W2O P;  1N32 J;  3KNG A;  4Q2M A;  1CS4 B;  3I5B A;  3MMA B;  3EXY A;  2ASL A;  2VIC A;  3CCQ S;  3P5B P;  3U02 A;  3PAC A;  1DRZ A;  1S9G B;  3QFH A;  1DQ8 A;  4NPO A;  3DOK B;  5F3T A;  4B3S F;  4CTA B;  3KK1 A;  3TX0 A;  4PZV A;  3W1Y C;  1RJJ A;  5D3G B;  4E0D A;  2QN6 B;  2ZBC A;  5ADZ A;  5A0Y A;  3ET6 A;  2BBE A;  4IG3 A;  2QT7 A;  5B08 A;  2JC0 A;  4YR0 A;  2R7Q A;  2HUR A;  5KFO A;  1M1G A;  1GH8 A;  3VHQ A;  4H4O B;  4RW7 A;  3ENA A;  1IR0 A;  4Q5V A;  1LW0 B;  4I4B A;  3SQG A;  2YX1 A;  3FNN A;  3R5G A;  2HZC A;  3C14 A;  2R7S A;  2D3Z A;  1NH7 A;  3PX0 A;  3CPW R;  2MJN A;  2FVR A;  2BXJ A;  2C42 A;  5B0G A;  4I2Q B;  2SXL A;  3RBZ A;  4CH7 A;  4IH5 A;  3PEH A;  3HD1 A;  4XPE A;  1U1O A;  3BSN A;  1Y0H A;  2E5J A;  2M9K A;  1ZTT A;  2YNI B;  4WCE Q;  4CYU B;  1NJZ A;  4DV7 F;  2FHJ D;  3NG8 A;  3G9C A;  2J7U A;  3CCL S;  2ZOF A;  3KMS A;  2NPI A;  5GAH I;  2K2P A;  1WEY A;  3BR8 A;  3R2D J;  2VQE F;  4P75 A;  2DXF A;  5KOW A;  2OEL A;  3AJD A;  1IBM F;  2DHA A;  2E7W A;  4CLZ A;  1GXT A;  1FFS B;  3UWT A;  3WC0 A;  5KG1 A;  3Q2T C;  4DUT A;  2EK1 A;  2ZBP A;  3I32 A;  3DLK B;  1JIH A;  1G4C A;  2UVW A;  4USK A;  1WSR A;  4WFY A;  2HFN A;  1K47 A;  1OY6 A;  2W9C A;  3P5T L;  4P74 A;  1T05 B;  2XHW A;  1ARO P;  2UXD F;  4ZKA A;  5AXN A;  1AXQ A;  1RIS A;  1Y7P A;  4RBT A;  5KT5 A;  1VBZ A;  3NS5 A;  1VQ4 S;  4X4N A;  5D4P A;  2GO8 A;  1D8Z A;  4OYP A;  2M70 A;  2AJ1 A;  3ELH A;  2JLG A;  1UVJ A;  2B3T B;  1M0S A;  2NLW A;  2YX4 A;  1FWK A;  4R8U B;  4I56 A;  1RHR B;  3PZP A;  3F73 A;  1A7G E;  2JH3 A;  3Q24 A;  3VZH A;  4CO0 A;  2QLJ B;  4C0H A;  2W01 A;  3TRG A;  2HFO A;  4DZ6 A;  1QE1 B;  3MR5 A;  3DN9 A;  1NK0 A;  3A3N B;  2HQF A;  1NCL A;  1DLO B;  4N56 A;  3VGU A;  4TYA A;  2N4D A;  1WC6 A;  2I9S A;  2Q66 A;  1VLY A;  4ZP6 A;  2XBP A;  3M32 A;  3PEJ A;  3MUM P;  3PO4 A;  4ZDN A;  3B4M A;  5I3U A;  2FVQ A;  3FBB A;  4PEO A;  3HHE A;  1N54 B;  4J9M A;  2O01 C;  2XGP A;  4JI5 J;  3HZG A;  4CLU A;  1TQL A;  4IFY B;  5HI7 A;  5EHH A;  2IC3 B;  2OSR A;  2NSC A;  3NOG A;  4ZP7 A;  1DTT A;  1P9Y A;  3TA2 A;  3J81 j;  1FRL A;  1UZD A;  4OX6 A;  1E6Y A;  3AXK A;  4NLO A;  4O4G A;  3CME S;  2FVS A;  3X3U A;  1S1W B;  4DV1 J;  3JSM B;  5I3P A;  3R5D A;  4TYB A;  4OYO A;  4IR9 A;  3OSN A;  3KLI A;  4CIO A;  2CQG A;  3LWM A;  4L3K A;  3HZE A;  3R7N B;  1SJF A;  2IDL A;  3EYZ A;  1I6J A;  2DNG A;  2J8S A;  2BAN B;  1RT2 B;  2CRL A;  4JI4 F;  4U96 A;  4NXM F;  3M9O B;  2KRR A;  3RZA A;  4KBI A;  3BGL A;  2Y1L B;  1FWL A;  2MHE A;  2PA3 A;  1IKV A;  2V63 A;  3DHX A;  4ZVT B;  1VQO S;  3FFI A;  3D6F B;  3DYA A;  2MMY A;  5E3R A;  5C25 A;  4DR4 F;  5H9F K;  3MOZ A;  1U0S A;  4CM2 A;  3AB4 B;  2XO6 A;  3NXZ A;  2ILY A;  4QWB A;  2YH0 A;  4IOB A;  2YH1 A;  1TL1 A;  5EX0 A;  3IWX A;  3CJ3 A;  1EET B;  4NI2 B;  2HFV A;  5J2Q B;  3HF5 A;  1LNQ A;  2NXJ A;  3T9Z A;  3OR2 A;  2C1E B;  4JV5 F;  4ECV A;  2V4Q A;  2MTL A;  2KN4 A;  3RTV A;  2CPZ A;  4OV1 A;  2G0C A;  5D78 A;  4LJM A;  4PXD A;  4USU A;  3T1A A;  3SCL E;  1IXK A;  4PUO B;  3PHT A;  5G0R B;  3CJK A;  1S57 A;  4BBY A;  3VAH A;  3SSQ A;  4YR2 A;  1R31 A;  1R8H A;  3SSR A;  3VAM A;  2J6U A;  4AXI A;  2XZT B;  4NCG B;  4Y28 C;  4DU7 A;  2RQM A;  5DLF A;  2LP4 A;  3CJ0 A;  3MEC B;  1GNK A;  3L7U A;  1K0T A;  4FNH A;  1RBO B;  1YBT A;  2D3U A;  4DX6 A;  4EBE A;  4NML A;  2OPS B;  4X2B A;  2GAG C;  2HNZ B;  3WX8 A;  3LP0 B;  4JI0 J;  2DNR A;  3BZQ A;  3HVA A;  2KT5 A;  3GV8 B;  3VZI A;  5H9F J;  2DPJ A;  2QFI A;  2H5E A;  5HQM A;  4NLS A;  2GVZ B;  2MKC A;  2B4U A;  2DIT A;  2RKI B;  4PKD B;  4ZPD A;  2KKH A;  1RAH B;  2AJ4 A;  2E9Z A;  2RJZ A;  5D0H A;  1JLF A;  3AH6 A;  3PKM A;  1KR4 A;  2MKH A;  2DHG A;  1NKE A;  4W90 B;  4DV5 F;  4M5I A;  3DRS A;  2W9B B;  2QGF B;  4OI6 A;  2IJR A;  1UWB B;  4J9V A;  5KT6 A;  3M8R A;  1HBU B;  3OUY B;  3GSI A;  4OIX A;  1UPP A;  2YNH A;  2Z57 B;  3W9J A;  1UA0 A;  4ED8 A;  4JI2 F;  2E5H A;  1GMU A;  2VG7 A;  4WKR A;  3GMG A;  1TP7 A;  4K5R A;  1PJ5 A;  2YWW A;  3C6U B;  1I5O B;  1HR0 J;  3DRX A;  4JI3 J;  4WZQ A;  3T5K A;  2ZZN A;  2Y0B B;  1U6B A;  1NBE B;  3BN4 A;  3VAG A;  3GZ7 A;  4ECX A;  3QYY A;  4X84 A;  4HT5 A;  2XS7 A;  3VAI A;  2ZHO A;  2MDA A;  4DXL A;  2K8G A;  1MN7 A;  3QAE A;  2GVD B;  1F3V A;  5C42 B;  4Y2K A;  5M2P A;  3QT7 A;  2D9P A;  4ZA1 A;  4I64 A;  5AE1 A;  4LRC A;  2X1B A;  3G6Y A;  2WTF A;  1YSJ A;  5E33 A;  3MM6 A;  1SB6 A;  2QMW A;  1S76 D;  3BGR B;  4LF7 J;  4QIF A;  3FZB A;  1ZTW A;  2VFU A;  2XO7 A;  2N7C A;  2MZJ A;  2XSF A;  2XUL A;  1WF1 A;  2RQ4 A;  3JS9 A;  4UT4 A;  1W2B R;  3AJ2 A;  1MSW D;  3EGV A;  1U47 A;  3QAU A;  4X65 J;  2MKI A;  4PR6 A;  1YVF A;  4NLU A;  4NX9 A;  1Z2L A;  3RAQ A;  1Q8L A;  5JXS A;  3RG6 A;  1WG1 A;  3CCR S;  2ZE2 A;  3EGW B;  3HHN B;  2ZNZ A;  1PIE A;  2MLY A;  4WE1 A;  2HAI A;  2Z8Q A;  3KKF A;  4LR9 A;  3H20 A;  2CZ4 A;  2V2K A;  2YKM A;  1ZS6 A;  2FJB B;  4ID8 A;  4OYW A;  4C8Z A;  2MQQ A;  4EEY A;  1HNI A;  2E66 A;  1C1B A;  3ILO A;  2GFF A;  1D0E A;  3KDO A;  2AF6 A;  1U8W A;  2ZM6 J;  4DPT A;  1MWZ A;  2QX0 A;  2I38 A;  3J7Y U;  1S0V A;  1Q86 T;  4K7Q A;  2ZHB A;  1FKP B;  3RAX A;  1T94 A;  5CYM A;  4O0N A;  1OPI A;  4ZJL A;  2BQR A;  4WU2 A;  1J5E J;  1S59 A;  1Y3J A;  3D7S B;  3ZZY A;  4OHV A;  4ETZ A;  1HWU A;  3QT6 A;  5KFX A;  5KG7 A;  2C2M B;  3DHW C;  1O8B A;  1FKO A;  3M2U B;  1J2V A;  3I4H X;  1X31 C;  4N7T A;  4X4T A;  4BWJ A;  3GJT B;  4C0B A;  4YS2 A;  1GXL A;  1N4L A;  1G3O A;  2RIL A;  4Q45 A;  1FD8 A;  1HFE L;  4FBU A;  1IKY B;  1J5O B;  4M5G A;  3SEO A;  4QW9 A;  1VC6 A;  4IQM A;  2EW9 A;  1N5S A;  3I31 A;  2DO0 A;  1WTF A;  2JNJ A;  5IT9 Y;  2QO3 A;  2C2E A;  1SI9 A;  4YB6 A;  1RWM B;  2GX8 A;  4NLQ A;  5B0E A;  4RPF A;  3MM9 B;  3OW2 R;  1QLN A;  1VRU A;  2AGQ A;  4MK9 A;  2M7S A;  2HGM A;  4DR5 J;  1NPP A;  4F4X A;  4EBD A;  1LWE B;  3MR3 A;  2VOD A;  4DSI A;  4EMD A;  1FE4 A;  5HQ8 A;  3TYT A;  3R1H A;  2F3J A;  2L48 A;  3MHY A;  2OJ3 A;  1K44 A;  1ZAV A;  4LRD A;  3QIP B;  5J2P B;  4DOZ A;  3WC2 A;  2FD2 A;  2W4C A;  3HO1 A;  2EKN A;  4MIB A;  4DV0 F;  1HWL A;  3C2P A;  1UEV A;  2Y3Y A;  3Q8V A;  4FF4 A;  2UXB J;  3W8G A;  2BKO A;  3BSC A;  3IP0 A;  3MM8 B;  1ZA2 B;  1HYS A;  3NGS A;  2BYC A;  5F0U A;  1RWW B;  3TA0 A;  2HK3 A;  2E1P A;  2N82 B;  1RAD B;  4LSL A;  2E44 A;  1F9F A;  3MMB B;  3V81 A;  4ETX A;  3BEG B;  1W2I A;  4M5N A;  4Q44 A;  3OL6 A;  2B6A B;  4DR2 J;  1FFW B;  4FVM A;  2ALZ A;  4K4W A;  3ENV A;  5J2N B;  2VKZ G;  1V5I B;  2J76 E;  1V6H A;  2DH9 A;  4DV2 F;  2F9J A;  4Q0B B;  4L72 B;  3MI7 X;  4HAC B;  1ACM B;  2JVO A;  3OFG A;  3D6T B;  5J2M A;  3E2E A;  1ZM9 A;  2DRB A;  1JLA B;  3C19 A;  2PMZ D;  4J9U E;  1H98 A;  1QAX A;  4FYY B;  2L08 A;  1QVG R;  3M30 B;  4BCA A;  2HS3 A;  4FXV A;  3K89 A;  3MED A;  2VPZ B;  3K17 A;  3EGN A;  3PFO A;  1HQ2 A;  3A3P B;  3GQC A;  2BQ3 A;  2VJV A;  3RYL A;  4C8Y A;  1WC5 A;  2GGP B;  3POT B;  2ZFH A;  4LQ9 A;  4FYD A;  2HHH J;  2ZHA A;  1TK5 A;  2D7S A;  4GKK F;  4YY3 J;  2VPW B;  1YGY A;  4ZHR A;  4YUD A;  1FHT A;  1KVJ A;  1P6T A;  2HIQ A;  4UUX A;  3BJY A;  3D6H B;  4I6Y A;  2ATC B;  3U27 A;  1IUJ A;  4Z7Y A;  2FYX A;  2O1P A;  4MKA A;  4TVA B;  1RT7 A;  1RTI A;  4OZ3 A;  1Y4Z B;  2EC2 A;  2FHM A;  1S49 A;  1UW4 A;  3NRB A;  2ILZ A;  2DNK A;  4NLV A;  1WF2 A;  2FGC A;  4EI2 A;  3R5A A;  4GVB B;  1O51 A;  5BYR A;  2NUU G;  3KXD A;  3BF4 A;  1RKJ A;  3A13 A;  4JOU A;  2Q43 A;  3R3T A;  2A1B A;  2GIR A;  2H4W B;  4QBU A;  1YJW S;  3GJQ B;  5F8J A;  3PFE A;  3PKY A;  3RBD A;  2FB0 A;  2IVM A;  5JMN A;  3BYP A;  3ILJ A;  2B9W A;  4Y34 A;  2F8M A;  3UVJ B;  2R7O A;  2VPY B;  4OYI A;  3SMZ A;  3M9N B;  2GQQ A;  3H7H B;  2BE9 B;  4A8O A;  4ECY A;  2ZC3 A;  2YWG A;  2HFZ A;  4OZL A;  3QZ7 A;  3QRR A;  3OPK A;  3EPI A;  3IFE A;  5KFT A;  1JKH A;  2JSX A;  2ZOM A;  2LEP A;  1XK8 A;  4BDP A;  3Q8S B;  2R9L A;  3PM9 A;  3PYG A;  2RVJ A;  1QTM A;  3HSD A;  4DX8 H;  4NLG A;  4DFM A;  3FZ2 A;  4QQB A;  1O5J A;  3PG9 A;  4RBU A;  1WKL A;  2WVD A;  2LDY A;  2YKO A;  2LFV A;  3IRX B;  1RT4 B;  3TNV A;  3PXG a;  1CJT A;  4DR3 F;  3M2R A;  1XNQ J;  3DGP B;  1X9S A;  2XEX A;  4RW9 A;  1TFY A;  4ZP8 A;  2B4P A;  3KK2 B;  2XSJ B;  1M5V C;  2CDQ A;  3LPE A;  1HNX F;  3TQ1 A;  1RE1 B;  4EO6 A;  4DEZ A;  2KT2 A;  2CQB A;  1JXE A;  1DY3 A;  3KUE A;  5F9L A;  1U0H A;  3ZTP A;  3G86 A;  2QYC A;  2DNZ A;  3OD2 A;  4J90 A;  1GAO A;  1V3S A;  4NZ6 A;  3PX6 A;  2VA3 A;  5LJ5 Y;  4U8V A;  4KFB B;  1TMJ A;  1YZ7 A;  3PX4 A;  3KFW X;  2HNY B;  4LFC F;  2RQK A;  2FC9 A;  3BQ2 A;  1SCJ B;  3V6J A;  2XNQ A;  1S77 D;  1N6Q A;  3G6X A;  4LRF A;  2RRB A;  1JJC B;  4LSN B;  2KT3 A;  3C16 A;  2M4M A;  4A8S A;  3C66 A;  3MEK A;  3BPS P;  4MFB A;  3VAF A;  5BR8 F;  2XYP B;  5AXM A;  2X51 A;  1KD1 T;  4K50 A;  1XER A;  4DPW A;  4ED4 A;  1RYR A;  2DR7 A;  3I56 S;  1NK7 A;  2IFX A;  2I5J A;  5K8P A;  2G0J A;  3G87 A;  1OY9 A;  3O3L A;  1GMW D;  1W25 A;  3UE2 A;  3IR6 B;  1X4B A;  4WP9 A;  3DM2 B;  4M5L A;  2YNG B;  5HP1 B;  3UPF A;  3UCG A;  1A6L A;  5AXL A;  2QMX A;  1M90 T;  4LBI A;  4J9R A;  3OTO J;  3PIO Q;  4NEY A;  1KRP A;  5T7L A;  2E1M C;  2JVR A;  5ETV A;  3E3X A;  4TU7 A;  1X8D A;  1FJ7 A;  3QO9 B;  3WBZ A;  4K4U A;  4C8N A;  1URN A;  3B54 A;  1DTQ B;  1Q8K A;  3HSZ A;  2BMB A;  1PYO B;  3IGV A;  1S48 A;  2E9T A;  4DFJ A;  3SQO P;  5F3Z A;  4PYA A;  2HHX A;  5L1L A;  3T1H J;  4FBT A;  1TEL A;  2F8E X;  2CJK A;  4MYT A;  1T9Y A;  1ELO A;  3CCM S;  4DU8 A;  2BW2 A;  4WBF A;  2O5D A;  5KFZ A;  2ADC A;  4CLF A;  1BWV A;  2KXH A;  1RWP B;  1OSC A;  5KFF A;  5DQH A;  3PV8 A;  3MPU B;  1WJ9 A;  2PEH A;  4ID5 A;  3GB0 A;  5LL6 d;  3PYF A;  1SC3 B;  4ZIW A;  5M2U A;  2QLX A;  4U8Y A;  4DQR A;  2O67 A;  3TW0 A;  2HGN A;  3KUH A;  2FC8 A;  1JJ2 R;  3IS9 A;  2DB1 A;  2PA8 D;  2OIH A;  3ONQ A;  1F5A A;  1IBK F;  4LIW A;  4LSZ B;  2M3D A;  1CUL B;  2FHK A;  1X5P A;  5KT3 A;  4KIA A;  2HWH A;  3DLE B;  5KFR A;  1GMV A;  3U7J A;  2BM1 A;  4RNF A;  2W7A A;  2BOA A;  1HMV B;  3W2W B;  4RW4 A;  1VQS A;  4LVO P;  2PDA A;  3P96 A;  2C3O A;  4EUV A;  1HLW A;  2ZKU A;  4IG0 A;  5CYQ B;  4ED2 A;  2EFP A;  5HRO A;  2V4R A;  4PQU A;  3OLA A;  3MZI A;  4USI A;  1S0M A;  1F0X A;  1IQZ A;  2L3M A;  2XLK A;  1TKX A;  3DOL A;  3I0S A;  2VBX A;  2RUS A;  2V94 A;  1X4H A;  4LBP A;  4NRT A;  1UAW A;  1RHK B;  2HHS A;  4TKT A;  2RT3 A;  4PWU A;  3G4S S;  3HSG A;  2FVC A;  2WSC C;  5F8H A;  4OI1 A;  2KFN A;  1H38 A;  4DX5 A;  2W2Q P;  1EX8 A;  4KO0 A;  2ZH2 A;  2E5L J;  5EDW A;  4CNZ A;  1DUR A;  1T9V A;  1FJG J;  1BHN A;  3M6U A;  2CFX A;  2CJB A;  1UVL A;  1D1U A;  1RI7 A;  1RU2 A;  1AT1 B;  2DGU A;  2V9K A;  4KY3 A;  3RBX A;  3SFG A;  1YJ7 A;  3MFH A;  3OJU A;  3EX7 B;  3M6W A;  4MJK A;  2CWX A;  3R5B A;  3UDE A;  3W9I A;  3M8Y A;  4NOH A;  4B3M J;  1S1V A;  3W8P A;  3J7A 1;  2EG2 A;  4ZVH A;  3UW1 A;  2WB1 D;  1RT5 A;  1R6Y A;  2GS8 A;  5GAD U;  2M5Y A;  1CEZ A;  4DR1 J;  4FKX A;  2R42 A;  4KHM A;  5KFV A;  2EG1 A;  4X64 J;  2OPP A;  2KVI A;  4YB5 A;  2QEX S;  4C11 B;  1PCA A;  3LP2 B;  1N33 F;  1F9E B;  2AW0 A;  1RK8 A;  4OZN A;  2K1R A;  2UUB F;  5BYS A;  1RWN B;  4QZV B;  1DAX A;  3BPD A;  4PWD B;  2DGW A;  3KK1 B;  3FSX A;  2V69 A;  4PG7 A;  2R2S A;  1BQN B;  3JTN A;  2E9R X;  1WC3 A;  3SDE A;  3VVT A;  3ET6 B;  4IG3 B;  3VAL A;  3FSI A;  3D68 A;  4RW7 B;  4I68 A;  2XCP A;  1N5V A;  4P2M A;  2DRD A;  3C14 B;  3M4X A;  3T3F A;  1R8B A;  4A8Q A;  1UFK A;  3K59 A;  2R7V A;  4UY8 T;  1HQE A;  1XMQ J;  1IKW A;  2HND B;  3DLG A;  5C2G A;  2XMW A;  4LF8 F;  3N6L A;  5J1E B;  1OSD A;  2G2Y A;  3FCV A;  4F0K A;  2NZC A;  1UFW A;  5RUB A;  1R8P A;  3C46 A;  3OV7 A;  3UDC A;  1YIT S;  1TV6 B;  5DDR C;  2CPF A;  3GU0 A;  4F67 A;  3HFV A;  2HEK A;  1N88 A;  1E6V B;  4R25 A;  4N8N A;  3I4P A;  1UPM B;  1VR6 A;  4MKY A;  2ASY A;  2H65 B;  2DNO A;  5L9N A;  4NEZ A;  4PXB A;  5HVF A;  3QAT A;  3VGV A;  1KVI A;  4GKJ J;  3MAQ A;  4E98 A;  1SJQ A;  2QJ3 A;  1Q5V A;  4RU9 A;  2FLN A;  1PSD A;  3EVW A;  3TAQ A;  1B0P A;  1WC0 A;  1GEH A;  2C2K B;  3GJR B;  1N34 F;  4PQA A;  3HVT A;  5D4N A;  2GJI A;  4FS2 A;  4IDK A;  2DGV A;  4DPY A;  3CF5 Q;  5C2C A;  2RB7 A;  1RT3 B;  2W2M P;  2WK4 A;  1MMD A;  4GMK A;  2IYI A;  5GMD A;  2WZ1 A;  2YWH A;  3H4D A;  2D41 A;  3OJS A;  4ZVE A;  1S10 A;  4KV8 A;  1XIQ A;  4A8F A;  1H7X A;  5KFP A;  1FNO A;  2HBQ B;  2WVC A;  3HFK A;  1X9W A;  4UF4 A;  3ISN D;  1NK9 A;  4JV1 A;  1HNW F;  3T1Y J;  2YKP A;  4N77 A;  2VG5 B;  1NJY A;  4UUW A; 
#chains in the Genus database with same CATH homology
 4DV4 J;  2UU9 J;  4NEY A;  4NEZ A;  4DV2 J;  4AQY J;  1XMO J;  2HHH J;  4B3R J;  3D3C J;  2F4V J;  4K0K J;  1HNX J;  1J5E J;  2VQF J;  4DV7 J;  2UUA J;  4YY3 J;  4X62 J;  2E5L J;  3IMQ J;  4LF4 J;  1FJG J;  5AJ3 J;  4LF8 J;  2UXB J;  4GKJ J;  4JV5 J;  2UXC J;  2KVQ E;  4X66 J;  4HHU A;  4JI7 J;  2VQE J;  4LFA J;  3J81 U;  4JI5 J;  5LMN J;  4KY3 A;  4DR7 J;  1IBL J;  4LF5 J;  1HR0 J;  5LM7 E;  4X65 J;  1IBM J;  4JI3 J;  4DV5 J;  3R2C J;  4RJV A;  4B3S J;  1HNW J;  1N33 J;  1XNR J;  4DR2 J;  4YHH J;  4DR6 J;  2UUB J;  4B3T J;  4JI0 J;  3T1H J;  4V1A k;  4NXN J;  1XNQ J;  5IT9 U;  5FLX U;  4JI4 J;  4NXM J;  3J80 U;  2MQ8 A;  4GKK J;  4B3M J;  4LF6 J;  4DV0 J;  4KHP J;  1XMQ J;  4KYZ A;  4JYA J;  1N32 J;  4LFC J;  2MEW A;  3J7A N;  4DV1 J;  1IBK J;  4JI2 J;  4DV6 J;  4LFB J;  2UXD J;  4DR1 J;  4DR4 J;  4JI8 J;  4JI1 J;  1HNZ J;  4X64 J;  1N34 J;  3R2D J;  3JAM U;  2MTL A;  4DR5 J;  4LF9 J;  4OX9 J;  2KL8 A;  3OTO J;  4JI6 J;  2UUC J;  3D3B J;  2ZM6 J;  5IWA J;  5BR8 J;  1I94 J;  5LMU J;  4PWW A;  3T1Y J;  4DR3 J;  4DUY J;  3W1Y C;  4LF7 J;  1N36 J;  4DV3 J;  5A2Q U;  4DUZ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...