2KLBA

Nmr solution structure of a diflavin flavoprotein a3 from nostoc sp. pcc 7120, northeast structural genomics consortium target nsr431c
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
154
structure length
154
Chain Sequence
SIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAAVDLQELRELVGRCTGLVIGMSPAASAASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDPLLSKFRNLGLTTAFPAIRIKQTPTENTYKLCEEAGTDLGQWVTRDRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution structure of a diflavin flavoprotein A3 from Nostoc sp. PCC 7120, Northeast Structural Genomics Consortium Target NsR431C
rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
molecule keywords Putative diflavin flavoprotein A 3
total genus 43
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2klbA00
2B3DA 3G5MA 1YCHA 4C0WA 3OJXA 2WC1A 1SQSA 4GR9A 3GFQA 3FW1A 2ARKA 3ESYA 3K1YA 5FUQA 1AMOA 2FLVA 2BZSA 2QX6A 1AKRA 4HS4A 4OXXA 3HA2A 3F90A 4C0XA 5LJLA 1QR2A 2GSWA 2HPVA 1J9ZA 2Q62A 1YDGA 2R96A 4YAFA 1DXOA 3F2VA 4R81A 3B6IA 3NHRA 4XDGA 1D03A 3FX2A 1XT6A 2Z9CA 3GFSA 2M6RA 3O2NA 4Y9UA 1QHEA 3W77A 1YRHA 2QMZA 1AKQA 3JSXA 3R6WA 4PTYA 4BMPB 4CETA 2MTBA 1FLNA 3QFCA 1CZHA 1DXQA 1WSWA 1J9EA 2AMJA 2QX9A 4QOEA 4XDHA 3RPEA 3NHJA 2BN4A 5F51A 1OBOA 3NHUA 2MOKA 5JROA 4FGKA 3L9WA 1JA0A 4DIKA 4YQEA 4NLLA 3TZBA 1RTTA 1T0IA 2FOXA 2FAXA 3UXHA 4BMOB 4ZVLA 2FX2A 3NHSA 4DY4A 1FX1A 1OBVA 2BF4A 2QX8A 2X2OA 3ESZA 3W79A 4F8YA 1V4BA 4C14A 3L9XA 4ESEA 1C7EA 1BU5A 1E5DA 1T5BA 3O73A 3QE2A 4YALA 5NULA 4D02A 3P0RA 4PTZA 1SG0A 3NHYA 2QX4A 1D4AA 1QBGA 2X2PA 3EDOA 1WSBA 3NHKA 4N82A 4YAUA 3N3AC 3OJWA 4LA4A 4PU0A 1J8QA 1RLJA 1XYYA 3W7AA 6NULA 5EMNA 2V5VA 3QFRA 1AG9A 1XI2A 2QMYA 3N3BC 1B1CA 1XYVA 2FZ5A 2OHHA 4U7GA 4J8PA 1C7FA 2Z98A 4ZVMA 2OYSA 2V9CA 3SVLA 3NLLA 1FVXA 2D5IA 1DX9A 1AHNA 3LCMA 4ICIA 5ULLA 4LTMA 1FUEA 1ZWLA 2A5LA 2HNBA 1AKTA 2FVXA 4QOHA 1YCFA 4U7HA 5LMCA 3OWXA 4N65A 1F4PA 3HR4A 3KAQA 2Z9BA 5EAIA 3W78A 1J9GA 1AZLA 1CZRA 5FA6A 1YOBA 1VMEA 2FZVA 3NHLA 2FCRA 2MT9A 2MWMA 3FJOA 1QRDA 3FNIA 3HLYA 3F6SA 4LTDA 5F4BA 1OFVA 5F12A 3OX1A 5EA2A 1H69A 2BMVA 3F6RA 5LLDA 2ZKIA 1TIKA 2HNAA 4QOFA 2OHJA 4YAWA 3EYWA 1RLIA 2V5UA 4NULA 5NLLA 2FDXA 2KQUA 3UXEA 1CZOA 1AKVA 1KBOA 3B6JA 3FVWA 5LBUA 5B3KA 1CZUA 2Q9UA 5LJIA 3KLBA 4CF6A 3ES9A 4ZVKA 4HEQA 1FLAA 2XOEA 3KAPA 1YCGA 3GFRA 4N9QA 1YKGA 4M0CA 3TE7A 3OWHA 1CZLA 3NHFA 2F1OA 4QOIA 3B6KA 4GI5A 3NHPA 4H6PA 1KBQA 3OX2A 3OX3A 5BUCA 1RCFA 2OHIA 4YAOA 4FX2A 3OVMA 4Y9RA 4DILA 1ZWKA 3ZHOA 5LVAA 4LAFA 3D7NA 2BPOA 3N39C 1I1OA 2KLBA 1D04A 1AKUA 3NFRA 1H66A 2QR2A 1TLLA 3K20A 5LBTA 1ZX1A 3U7IA 1CZNA 1AKWA 3LT5A 4ZVNA 2RG1A 2Z9DA 4S24A 4FGJA 5TGZA 4C76A 1NNI1 3ESXA 4U7FA 2QWXA 4H2DA 5FX2A 2W5UA 1FTGA 3TEMA 1X77A 1GG5A 2M6SA 1FLVA 4LTNA 3NHWA 1JA1A 2N1MA 1BVYF 2R97A 3GAMA 4GQIA 3S2YA 5A4KA 3B6MA 4QOJA 3KEGA 2XODA 3U7RA 4QOGA 1CZKA 1FLDA 5B3LA 4QODA 4Y7CA 4FGLA
chains in the Genus database with same CATH superfamily
3VPAA 1XEWY 2RC6A 4KDFA 4LRXA 1A96A 2DC1A 1OKKD 4GPD1 4DNQA 5A6SA 3ZGNA 1U11A 4ZI7F 4KEAA 3G5AA 1NLFA 3JARA 4FNOA 3AFHA 4N1AA 4OB7A 3H9GA 2CSXA 5C2JB 3EQ7A 2PJDA 3I05A 5DO9A 4UNIA 1E32A 2XRFA 3DMFA 1UT6A 3ZZNA 2RK4A 1KPGA 3ROMA 2P9TA 1D2CA 3ICPA 4RC9A 4R9NA 2W2MA 5BVGA 4KMRA 3AP1A 1YMUA 5J5VA 3I2KA 3CEHA 1FXWF 1V41E 2FFJA 4RKWA 3X1YA 3ZCQA 1PNVA 1U6KA 4OQEA 4U7JA 3CUVA 2R7NA 2PLFA 2R8PA 4FK8A 1K7YA 5F51A 5TMPA 2ZRCA 4FGKA 3DTVA 1ZH2A 1LPBB 1DIAA 4RACA 4EYOA 4MUJA 3NM5A 1ZLXA 5TPWB 3HADA 2WV7A 3UWOA 1M2OB 1W87A 2PS9A 4KPUA 2IBSA 2OBFA 2XLBA 4LW8A 1LI7A 2C1XA 2M1XA 4QQKA 1V43A 3LGXA 4L7QA 5FQNA 3ME5A 5CDFA 2VLIA 3VO2A 2YJTD 5IP5A 4LHXA 2DFVA 4LYGA 5EKUA 4DTCA 1DUIA 2OBBA 3QEMA 4LDAA 3IVAA 2FR0A 3MJHA 4YRTA 3K9FC 4KE9A 1WCXA 4QASA 4XQCA 2XQVA 3LECA 5EFZA 3G2HA 1Y7IA 1HRDA 1GA1A 4LNAA 1ZMBA 3HUUA 3IEXA 1JW9B 4FCWA 3VC3A 2YHUA 4M1MA 5FOSA 3TQQA 4NENB 4CR7A 4V2IA 4K0KB 3GGDA 3NKLA 1ZL0A 4R3UC 5HK8A 3FCOA 4BZQA 5ADUS 1NDQA 4PS0A 4QXQA 3EASA 4J9UE 4OJKA 5DOVA 3AEKB 3ZNQA 5HQ3B 2G70A 2IXTA 4P58A 3NT2A 4F2HA 3H2IA 4YMSA 3CZ5A 4ZCPA 4GMKA 2RKWA 2OHFA 1GPBA 2MWMA 2UZ1B 4UCQA 3EC7A 2FPSA 1XHFA 4B7XA 1YZFA 1C3OA 3CUKA 3L0BA 1L4EA 4EFMA 1M74A 5B57C 2C5GA 4E32A 4HNSA 2A9RA 2GAOA 2K2QB 4D9KA 2PUTA 3L2OB 3ZE0B 4LOLA 4PXSA 1Y9ZA 3KHKA 3ZIAD 2VRWA 4XH9B 3S1SA 3QSYA 5FOTA 1VJ5A 3JRXA 2WU4A 3QV1A 3BK7A 4IDHA 2UKDA 4Q6WA 4EF6A 1P6UA 5JNSA 4HQ0A 1KBQA 1TW2A 5DCUA 1L4KA 2FGJA 2CXSA 4NC9A 5DIZA 4KWCA 4PAOA 1I1OA 4LHSA 3ZZUA 4PFJA 1Q7BA 1MB3A 5FO0A 2B2CA 4PSKA 3SJUA 3U7IA 1TFRA 3TXYA 1K86A 2HRRA 4GC9A 4MW4A 3WNVA 1DDOA 3CS3A 3L4KA 2HMUA 1IJBA 4B5KA 4HV4A 3EEBA 4NBTA 1JNYA 1L4UA 4MS3A 3NHWA 1BO6A 1N9ZA 4IIVA 3RRJA 4XFJA 1GKLA 4XYMA 5LZ5A 2AOUA 3HJBA 5CM9C 2RE8A 4F21A 4QOJA 4EJ0A 3RUCA 3VPXA 3RB8A 3IVGA 2AS0A 3NWJA 4JQOA 1L1QA 2VIIA 4F12A 2LR0A 1LVGA 1U8TA 1OLUB 4YDHB 2ZIZA 3DTTA 4BE9A 5JZOA 1R0CA 1NQTA 3OJ0A 3PSAA 4JX8A 1NC1A 1KC1A 4LZAA 4OU5A 1KIFA 4YWHA 1JIJA 4BJ3A 4LDNA 4W1PA 5KPDA 1UK7A 3L1KA 3WMFA 4C0JA 2BIFA 3IEVA 3KUUA 3A6PC 4BVBA 2J9FA 3H6GA 3FZQA 5FUBA 3O4RA 2GTIA 4IXMA 5ICSA 2HWWA 3OC6A 4E46A 3EMVA 5F4ZA 1P2VA 2C04A 1UXGA 4QFDA 4DWOA 1SCUB 1Y37A 4HFJA 4GUAA 1DAHA 1A82A 1UKEA 2QRVA 1ULSA 3N2EA 1G9SA 4X8LA 2M1ZA 3OTHA 3VSEA 3VPDA 4AUNA 3G85A 1VXOA 2PH5A 4F04A 1UP7A 4XAQA 4Q21A 4ALKA 4F2PA 1K2WA 3Q2IA 1MD9A 3TOVA 4RSGA 1QIJA 1L4MA 1I10A 1G2PA 2W83A 2DSTA 4UCWA 4FOTA 1FXSA 3UCXA 3E53A 2AOVA 1T2UA 3P0RA 2AOXA 4MUGA 1WDKA 2NNLD 1EUCB 2P35A 1Q2UA 2VYVA 3QMWA 3CRRA 5DP1A 1LSUA 3L4BA 1M1YE 4PHCA 1ZU5A 4BN0A 2FN9A 5G4KA 4ES6A 2NU6B 3C3KA 4MQMA 3D3JA 4ZJYA 1IUKA 1EDBA 1T4MA 3QU7A 3AF0A 2QMYA 3M7IA 1N5DA 2JJ1A 3LP6A 1CR0A 1K5HA 1CQWA 1OZGA 2Q1WA 1Z37A 2X4IA 4P4UA 1JQAA 1FVHA 1NYQA 5ALHA 1M7BA 5F1OA 3VH3A 1KMNA 4GOND 3MLAA 1DMSA 3GRZA 3GDHA 3O93A 5IJZA 3CKLA 1D09A 1Y5MA 4KQHA 4C1NA 3BF7A 2WWRA 1PQYA 2YFHA 4B4DA 5C3MA 3DEKA 2LE0A 3CR8A 1AM4D 3GQBB 4ALIA 1SXIA 2IU0A 1BSVA 2MSCB 4KYIB 3T5AA 5CVCA 5ALQA 2Y67A 2ORWA 2OSBA 5CDSA 4D3FA 4QUKA 2EX0A 4II2A 2FR8C 4YREA 1KMMA 5ICFA 1B1AA 3TQIA 5ITZB 3A9CA 4IDCA 3LNTA 3A14A 3WGKA 3O8CA 2IPOA 3C41J 3T4EA 4D25A 1CY0A 1R1DA 5AKKA 1D4OA 4KPYA 1O2DA 3ESRA 3EOAI 2A33A 2HQRA 3L6OO 2DKFA 2NPOA 1R66A 3QVUA 4WN3A 5C8VA 3FYCA 4C20A 1JP7A 5JS1A 1N8KA 2GD6A 1J6UA 3KP1A 4JWTA 5JNVA 1WXGA 2I2FA 2NTJA 3E9NA 3LI2A 2ZJ4A 1VGRA 2WIBA 3PPYA 1ZHHA 4OUDB 5D7BA 2FFBA 4ML3A 4QICA 1EZZA 4EHBA 4EMBA 4BB9A 1YR8A 1FYXA 1U7UA 3PDWA 4O8ZA 2JZOA 3LT5A 4EHDA 2BEKA 3MWEA 1TNDA 1CVLA 4JJZA 5IC4A 4D9HA 2H5LA 4O4LF 3PQ2A 4E88A 4JUAA 3HA3A 4HYYA 3IMGA 2R8ZA 1WV1A 3PDJA 4FS8A 5E4YA 1M6YA 1SC9A 4J75A 1OUMA 5EWLB 3JAKA 3IL2A 3KKQA 2PUWA 4MWTA 4HUJA 4QODA 4R84A 4AWAA 1JKJA 3U5TA 4IXDA 3EQ6A 1MC5A 4YRCA 5LC1A 4ZYTA 4Y98A 3I6BA 1BE8A 2HU8A 1CKEA 1UJ2A 1W47A 3LS2A 3S55A 4F5DA 4LZOA 4PZAA 1ZUIA 3GCGA 2WSYB 5D1NA 1L5KA 2UZ3A 1GPAA 2I65A 5ICCA 3FOEC 3I9FA 2RFLA 3BIWA 2J59A 1CS0A 3OOJA 3I58A 1EGHA 4P7KA 4OFZA 4M8IA 3N07A 1RBYA 1YRHA 2EP7A 4UNSA 5BOSB 2M32A 1P81A 5IF9A 3BICA 1RAEA 1ZMXA 5EVCA 2OCDA 5JALA 2IE8A 4MUYA 1X3SA 1HT3A 4TVBA 1JR6A 5FF9A 3GR6A 4CM3A 3ORQA 5LYYA 2G8LA 3AJ8A 3E3NA 5K05A 3CEMA 4LMBA 3UANA 4MDHA 1P5FA 1R6TA 2CNWD 3R3UA 3ZC3A 5FV7A 5JASA 1G55A 2IYZA 1ZNZA 3NYRA 4F4JA 3RCBA 4CGYA 3DCIA 1RJFA 3Q3EA 2ECPA 3DZBA 4G84A 4HYTA 1KSGA 1II8B 3KBBA 4Q3LA 4PLGA 1O6BA 4LSGA 1A71A 2PLNA 4M0KA 3RNLA 2F8TA 1PR4A 2B8EA 4I14A 3U3JA 1P4AA 1XYYA 4D5GA 2XBMA 4ZI7A 1GL6A 1LV8A 2M98A 5I9MA 5L3SB 1E1QD 5TIIA 1UFOA 1L0BA 4PONA 5FTJA 2EP8A 4QRHA 1G5TA 1M6NA 1EP3B 3WLHA 5C8DA 2A5GA 2J07A 1B14A 3B78A 1X15A 2I33A 5FNVA 2OXTA 1K3TA 5KYVA 4K9PA 4OEHA 2QM7A 3RBZA 3V2IA 3PWTA 3ZJVA 4B43A 4QM7A 3BJMA 1JG4A 1EXDA 3GLGB 4IH1A 1KAOA 1QIFA 4JP3A 4P7BA 2XA2A 5C5DA 1YS7A 2HI0A 3IPXA 3QXSA 5IZCC 2OTCA 1UINA 4CKWB 5DX0A 4A73A 1YFKA 2VYQA 4PTLA 4PANA 1F3LA 3A2NA 3AR6A 2NXNA 3Q7TA 1BIFA 3F6SA 5CA1B 5F12A 3SIRA 5K8TA 1HFJA 3HFJA 2AC7A 4CQNA 5CEJA 1FRNA 3IHKA 1HFEL 1Y7HA 5DH9A 5K45A 4BNIA 1RYZA 2VNSA 2P9FA 3WRWA 3IPYA 3L04A 4WERA 3PHIA 3AEQA 3OO0A 1FFXB 2X1VA 4ZZ2A 3VYTB 3WKBA 2ZJFA 4MICA 1V7ZA 1KYIA 1O96A 2YV5A 5JIBA 4PCVA 2I2BA 2QPOA 3A9TA 2GERA 3V1MA 4K2HA 2GS9A 1U3GA 1ZLYA 2G7MC 2CHGA 2G5PA 4R98A 1KAHA 3WGIA 3V1TC 4R2HA 3KSAC 1C0EA 2X13A 4KO4S 2H48A 1EB9A 3TSAA 1XEXB 4CMIA 4ISBA 4L8YA 2ZI4A 3TN7A 4IDBA 3IAEA 3GT0A 1IZ0A 2C29D 2F1HA 2J33A 5JDIA 2FYTA 2JIZA 3KYBA 4QOGA 1CZKA 2P9BA 2AFRA 3HB1A 3JASA 3VYSB 1HO3A 3DZKA 5AH0A 3SICE 2H1FA 1XLTA 3WLFA 4YRNA 1DARA 4JYAB 2PR2A 2DY0A 4BGEA 1EZ4A 1ZI8A 1I6KA 4P8RA 2XAAA 2B78A 3TJMA 3AM4A 2ZB2A 3OZVA 3PHBE 1YAJA 4X97A 3QXJA 3RSHA 1XU9A 1YZYA 2CHVA 4X91A 3OIYA 5CIQA 2FI1A 3ZDRA 4EI7A 1Z07A 2XUKA 3B7WA 3JQQA 3LYLA 1U8FO 3EG9B 1TF7A 4P4TA 2WB2A 4KUEA 2QMEA 3K2QA 3MTQA 3TRHA 3W05A 5AP9A 2IW1A 1CWUA 3IP9A 2I3ZA 1AXEA 2CC2A 2XWPA 2WEKA 1ZVKA 2HX1A 4L16A 4UATA 2BISA 3INTA 4MKRA 4LJAA 4CBVA 4HXFB 3K6SA 2FG7C 1STOA 4UBLA 2WBLC 2TMYA 4AS1A 4JGBA 4MRMA 2OBLA 3SNHA 4MKIA 3SIXA 2YUTA 4C04A 1HE4A 3CBQA 5KSOA 3KV3O 4II3A 2XBUA 1AGNA 3KEQA 3GZNB 5KHOC 1OVMA 1KRHA 5CVDA 2WNSA 2QY6A 2X2OA 4NFYA 3EZYA 1DZ3A 1PFVA 2KMLA 1U7PA 2OC4A 2PD6A 2G40A 2W6IA 4MVJE 3LVQE 4QRDA 4A8PA 1PQ4A 1XTBA 3IOYA 1SG0A 4FHZA 1QZTA 4CFYA 4X3OA 2FB9A 2RGBA 2RH8A 3CU5A 1SULA 2QGFA 1JRLA 2X0EA 5REQA 4RXTA 1PBNA 1YRYE 2C5LA 1F38A 1IHXA 4MR8A 2GVDC 2JLAA 3RJ9A 1MJ5A 5E95A 3HC7A 2C3UA 4RIHA 1Q50A 3PEUA 3PCRB 4IFEA 4K9RA 1VE3A 1JLMA 1TD1A 4QOHA 4OJQA 5FWYA 4YA6A 1WZEA 2QZZA 3E48A 4M99A 3S5UA 3HCAA 2EHDA 2AEJA 4YQYA 2H2GA 4UVHA 1B2RA 4C0LA 3ZPXA 1HE8B 2EC5A 4D4HA 2QG6A 4LSWA 2VRCA 2XB8A 1U3TA 2Z2YA 1Z82A 1E9FA 1ECGA 3PZBA 3QKRB 4LPKA 3BD8A 4PCUA 4UTXA 2FMUA 2I9PA 3B9BA 3DYBA 3R9WA 4M9XA 1GV0A 4RY9A 5K99A 2W48A 5CHEA 3TVTA 1Z5GA 4GKKB 3FNGA 3GU3A 3CZCA 4NONA 2RHCA 2OZPA 1RXUA 3OPXA 4DCNA 4I6EA 1WMDA 4EA7A 4EX6A 5E2IA 1IIRA 2W11A 2O0MA 4DR7B 4I4IA 3GOQA 1R6XA 2QSYA 1L9XA 2G07A 4L4RA 3A6HA 3RROA 4FZ3A 1X14A 4IJWA 2P2NA 1T4CB 3FJ1A 4QFCA 4Q15A 5AVQA 5JFGA 4XQ9A 4BQIA 1YHZA 3KVRA 4U7DA 4ACAA 5BOVA 5DHTA 4XWKA 1GZHB 4ZOBA 3WLNA 2Q27A 3EN0A 1N92A 3IPAA 3HXOA 5CXXA 3ESXA 3E2PA 1VKOA 2QWXA 3RFFA 3VAAA 1ZBDA 4P7FA 4G1CA 3REQA 3F78A 3IIJA 1E2KA 3KJNA 3OE7D 3KB8A 3SSNA 4IIHA 1XJCA 3BL5A 3NTQA 5BSMA 1P33A 4XVCA 3KQYA 5DX1A 4MWOA 1UMCA 1S6YA 1T8SA 3LXMA 1MZPA 4U5QA 1E1RD 3D4IA 4LJ6A 2O8EB 1T4BA 4GE3A 2PS0A 4X6XA 3W34A 2YZKA 3F7OA 3GGJA 3ZU6A 2SCUA 4NBSA 2JGDB 3DLAA 3OU2A 4UFNA 4M7WA 4BNLA 1BA3A 1P5ZB 3M6VA 5H81A 4ARUA 5F3RA 4BX9A 2VFAA 2D3WA 3GW8A 5LNK1 1FFCA 2QIOA 3OZFA 4WNCA 3F9IA 4FB4A 3U7EB 2JCYA 4QPCA 4JEMA 4XFDA 1M2JA 1FW6A 2MR6A 4UQOA 2X9QA 2QM8A 2RGYA 4ZAGA 3KHTA 2NYVA 1KZYC 4BNDB 5HUQA 3Q7SA 5E7MA 1KJJA 2IVZA 2FU5C 3M5WA 3RT7A 3ESDA 3G0OA 3TNLA 4W5HA 3LQ1A 1QIDA 1ZL2A 3L8FA 3S6JA 4OX9Y 2GM4A 5BYAA 3H1BA 4NJMB 3VQTA 4BMOB 1KR2A 3C87A 1O94A 1IBMB 4YLYA 3TRDA 1GQYA 1JTEA 5CT8A 2GD2A 2VP5A 3RUIA 1E5VA 1NVBA 2PAFA 4BQNA 3SZ3A 3TLEA 2R6R1 5HQTA 5FL3A 2OFOA 1YNSA 3HJRA 1SQGA 2A4MA 3F4LA 2FP3A 3I92A 3K0FA 3M5DA 4GXQA 1DC3A 5JG7A 5K3FA 3T4XA 3WSTA 4XQGA 1JSLA 2XE6A 3FHCB 4DLUA 4IF6A 4J9VA 5LUBA 2QBYA 2F3UA 2HIHA 2C7RA 3HCRA 4EPWA 5HDQA 2ZRHA 3CLTC 1K7XB 2FRVA 1SO8A 4K9NA 1USWA 1JLSA 5E7QA 1SRQA 5I3ZA 4GR4A 1WW3A 1PLJA 1TZ2A 3PGJA 3V7WA 4RJ2A 4EHIA 2GPTA 1BC5A 1XQVA 4H27A 4JB0A 1ZK2A 4OAPA 2IT1A 2C00A 1K08A 3A37A 3QI7A 3PIIA 1FNNA 1OX4A 3MCZA 5FR2A 4EO7A 3THWA 5CCBA 2DM6A 5AVZA 4Z4QA 3U80A 3CF2A 1VRCA 2XCOA 5IULC 3OCZA 2GZRA 3R0XA 2G3YA 2GXQA 5CDUA 2GN2A 2HA5A 1CUHA 1V37A 4MGZR 1EBUA 2GHTA 3B6JA 1NLUA 2V7UA 4CEJA 1TZJA 1UIMA 5EP3A 1T6NA 1RZVA 1FDVA 4I4TA 1MJGA 2PO5A 1DOZA 3OU6A 3BSWA 1FP7A 4FNGA 2REQA 3D1LA 1RLUA 2O0LA 1M8KA 3A7EA 2PR7A 3DVAB 4H7DA 1BD4A 4YJFA 5BT9A 4GI1A 5LQDA 3EG5A 2W90A 1KRXA 1PD0A 2HREA 4GI5A 3VMMA 5JI3E 2C7BA 3PXUA 4OJNA 3GNQA 1EX6A 3TZEA 2C2KA 1L7AA 4TVSA 1BWPA 1ZOPA 3FTDA 2X22A 1TPYA 2ODNA 2V7QD 1R6VA 4LRUA 4G65A 4LOHA 4ZGGA 4C22A 4ZJUA 1B43A 4X3PA 4GXNA 1YULA 3QBTA 3TEMA 3K70C 1ZVVA 1X0VA 3ZWXA 3H2YA 4BJHB 2BCEA 3IH5A 5B7GA 2JGLA 3KHSA 5HM6A 4R40A 5EJIA 5THKA 3Q9SA 1E2BA 1XXHE 2J3QA 3BRSA 1Q57A 3DFFA 3W5HA 1EP9A 2EZTA 5LBIA 4DLNA 4D9JA 4DMHA 1ILWA 3HRIA 4RU1A 1U4SA 3CNLA 4XASA 5BV8A 1WKBA 5CMLA 3TK1A 1UM8A 4PX9A 3T1TA 2I34A 5B2ZA 4D0GA 5SZIA 1ZKDA 2IIPA 1P9WA 2RKOA 3VR3D 3GVXA 5B1HA 4N0DA 1K3FA 3DZ8A 2HWXA 4OHVA 5K0SA 4PSAA 2QTVB 5D86A 3EXHA 3H1TA 1AMNA 2GTPA 3PGXA 4BKPA 3MD0A 3VPBA 1QLWA 1PT9A 5DN6A 3HZHA 4WESA 3CHYA 4NL4H 3ZU3A 2MOKA 3KR0A 1NG9A 1IVNA 3F98A 3WGLA 4FCCA 4ZFNA 2UYOA 3O4JA 3OHSX 5ER9A 3BS4A 4UOQA 3I2GA 4CIWA 5JCJA 5D3KA 3OJFA 1AS0A 4QJBA 1HPLA 1U3CA 3CTPA 3HZZA 3QEMB 1MH1A 3RVRA 4BEVA 3KWJA 4D8YA 2A84A 3RYIA 9ABPA 3OUTA 2AKEA 3M2TA 1G19A 1RMQA 3HB5X 4M86A 3VR6H 3H5AA 2QV0A 3K6KA 3D31A 1WSDA 4V1CA 1FJ2A 1TYAE 2ORVA 1SKUA 2IXGA 1FP2A 3JVIA 1TJ4A 4QTXA 1UANA 2QZPA 4RM2A 4ILEA 1SQ0A 1M2OA 1TCAA 1BQ4A 1ISIA 1A9SA 4QXOA 1B1CA 1U8EA 2QEQA 3NPMA 1ZY2A 4D43A 5J4KA 1YE5A 3JATB 4I9GA 4EQ6A 1YSCA 3L07A 4D7AA 1XPOA 1ORWA 3FF1A 2GZDA 3DE7X 4IJ6A 4XGRA 2VH2A 3BD7A 4CIXA 1RC1A 4D8WA 5BQPA 2EX1A 4PE5B 3ESQA 2Q1SA 4JBLA 4WH0A 4IYJA 5HVNA 1XZ8A 1DPGA 3I5YA 1TD9A 1XRMA 2BMAA 3ZI4A 4LDQA 5JXWA 3UJ6A 5BO5A 3ZZTA 1PUIA 4JU9A 4QLBA 3IV6A 2OQIA 1W76A 1LPPA 1AKMA 3NUZA 3D6TB 1JT2A 4NBVA 3TMAA 5JHGB 4KQ1A 4KXYA 2QJWA 1KJYA 4TKUB 1N36B 3BFXA 1O0SA 3KKMA 4R2JA 3GVHA 3VHXB 4N9QA 1ZI9A 3BMQB 4CMCA 2FKAA 1KEEB 2I7DA 5EQJB 2BZ1A 5LXTF 4HDQB 3G9XA 1VOTA 5HTKA 3MGBA 4H6PA 4EA8A 4M98A 2BEWB 1PNQA 4TWAA 4IOJA 3SC2A 2PWYA 1FFBA 2WKSA 2TMGA 1NRJB 2V97A 3M82A 3IPRA 4WOBA 4I6JA 2D4HA 1HEIA 1GKIA 1JSRA 3R5FA 4TL6A 3VNUA 4KE6A 4P3YA 3GH3A 4IRXA 3RF7A 3T0FA 2FTKE 4QUHA 3T3EA 1KNQA 2QG4A 2P75A 1M6VB 3MJCA 1IN7A 2PQ0A 1KFJB 1FPMA 5DHSA 1ULZA 1XV5A 4PLCA 2VF4X 1CJBA 2WJAA 3E58A 1ISMA 1GNLA 1AMOA 3U4QA 5AYVA 2BUCA 4XWAA 1UZUA 4DF3A 1E4OA 1FX0B 4S1VA 4F3RA 1FZQA 3D0RA 4LJSA 1HE2A 3VBEA 2GXSA 4OXKA 2VBIA 4LVNA 4BDTA 1G3QA 1V35A 2GTHA 3HCBA 3KUDA 4A6PA 1Q22A 2ACWA 3GDOA 2R1TB 1U1DA 2VPTA 2AG5A 2HZ7A 4QNMA 1K4KA 3VU9B 1K8YB 1NP6A 2YJ6A 4LYEA 4C2UA 3NP7A 2W2PA 4ON9A 4BMPB 1HEYA 2E4YA 1XD8A 3DT6A 3PD7A 3FB4A 2AFVA 2GASA 3RREA 1OAOC 4UBNA 1Z7GA 2H1CA 3R9XA 3DE0X 1TJNA 3UKOA 3UXMA 3W6PA 3TF5A 1M1YB 4JKIA 4DR1B 1IRIA 1JJ7A 1CR6A 4P98A 5CYOA 1EZ1A 4E08A 1I1NA 2Y27A 4CYMA 5KOIA 4Q9DA 4MWGA 1IB6A 2DHEA 2P2CA 1PS8A 1HE1C 4ZVLA 1FXUA 1YOVB 1LKZA 1WKCA 2XCIA 3I45A 4HH0A 1GJRA 2ZXFA 3EC1A 1DKNA 5H68A 3KTDA 3G17A 3I34X 3KUKA 3DMDA 1U5BB 1RE0A 5NULA 5E3HA 1Q2XA 1U2SA 4IIEA 2HBQA 1BX0A 3EXHC 4W5NA 1FEZA 1TZBA 1CQIB 1YQEA 3UTDA 5IANA 2UU9B 3NNDA 5CYFA 2BGKA 4PQEA 1QBKC 4TSKA 2Q41A 1B8VA 2X5JO 2VPWA 2RHGB 1YNOA 2WUWE 1XD9A 3C7TA 2P6NA 2EL7A 2DQYA 2OP0A 3PUVA 3CX3A 4S2EA 5DPMA 4S1PA 3B89A 1WXIA 3CPSA 3A27A 3KJEA 4V24A 1XO1A 2NQ8A 3IE2A 3CF0A 4ZV7A 3R09A 3VAZA 3DR3A 2VAXA 4JROA 5K1ZA 1CQJA 3ISVA 1DHRA 3EXIA 2ZM6B 4B2IA 1PLKA 4KXNA 1KEPA 4F4FA 3THYA 5FA6A 1BHO1 4FOOA 4QXAA 1BGWA 2G9ZA 5TGDA 2WJVA 1E99A 1WMFA 2I7VA 4KXWA 3ROFA 1CJKC 3ZDCA 1HQDA 2W6ID 2WT4A 2NSLA 4TV9A 5M34A 2V5UA 1SXJE 1G8KA 3OQIA 2O8EA 1RADA 1RQGA 3U3MA 4ZQGA 3QLTA 4OATA 1T9KA 2OCXA 2RONA 3BCHA 2QMOA 1U9IA 4GMFA 3NTXA 1IY0A 1ITZA 5AKLA 1EX9A 2XD4A 1WZUA 4KK4A 3CR7A 1K7SN 1XE3A 4JX9A 5T41A 3DC7A 1W75A 3CNBA 5DNEA 4ZYUA 2OPBA 2B1IA 3HH8A 2E0IA 5ES3A 3VU3A 2QTTA 1MIHA 1ZWKA 1MOQA 2GJAA 4WJKB 3BT7A 3OD5A 4HOYA 1MT0A 1J0EA 3KXLA 1QM5A 1S8FA 1FJGB 5IVDA 2D5BA 2P9JA 2Y68A 4E3WA 3A3PA 3OFND 5E6UA 3UTCA 3ZWMA 3PTAA 3HPQA 1BEEA 1BVUA 2AR7A 13PKA 4RH3A 4LXQA 1ADYA 1PTKA 4D26A 3VKGA 2OKGA 4FZVA 1YRWA 3RFCA 5ILQA 3DVQX 3ON5A 3RH0A 1SG6A 4K6KA 3VTAA 2OZLA 4NH4A 4B4KA 3RYCA 1FRZA 1X74A 1W5FA 2PWZA 4HAZA 2Z8YA 4BLWA 2XSZA 1DBWA 5K8IA 1ZIYA 3Q41A 1JEQA 1U7WA 1WCIB 3IIMA 3OLWA 3SY8A 3HBJA 3ESYA 3Q5GA 2F1RA 2X6QA 2Z6UA 1EDZA 4UNNA 4GLFA 4INAA 2C4TA 2R5NA 2B30A 1VHLA 1YC2A 3DEYX 1NKVA 1PTJA 5B7QA 2KI5A 1QHYA 3IKTA 1LJLA 3RI3A 3HMQA 2EKLA 4RTQA 5A4DA 4KN5A 4XSHA 4Q7JB 5KNDD 4TV9B 1ANKA 1NA5A 2IYOA 4FNMA 1YB7A 2CVOA 5FWYB 3ZQUA 3D4PA 3RSSA 4PIMA 1MGOA 2EEPA 3UB3A 4GX2A 1GNRA 4NOKA 3NATA 3WJ1A 2WOJA 5E9QA 4BVLA 5IT0A 1NGSA 4G4GA 1PL8A 1RZUA 1Z0IA 2GZHA 2P9HA 4H3HB 4ZRNA 3K4HA 4ZMBA 2XUPA 1AJEA 1CIVA 1GAEO 1JL3A 3LLSA 4EX7A 3WADA 4IV8A 5T6BA 2DUNA 3C3XA 2CB9A 4OQYA 3OCVA 5K3OA 5EESA 1B8PA 4GOKA 4H4DA 4EUSA 2CLOB 3OAAA 1L5RA 1DQRA 2YXBA 2VAWA 2AL7A 3COSA 3I83A 4FYMA 1FSFA 1WJGA 1D4AA 4IICA 4Y2UA 5BNIA 5HJEA 1ND5A 1Y8ZA 1G63A 1U90A 5DMHA 3TLGB 4KIUA 1P7CA 2EBWA 2YRWA 4KREA 4DLPA 4KIFA 1VXRA 2GNAA 3AZOA 1YDMA 3NEPX 3WO0A 4JIGA 3ZGOA 4ETWA 1TK3A 2FMKA 5HGJA 4WOJA 3SNKA 2H2HA 2CLCX 4HFRA 1YJBA 3Q1KA 3QYPA 4Z4HA 4U2FA 3EYAA 3I5MA 1XTZA 3DOEA 4JBXA 2HLDD 3U48A 2Q3DA 2JH3A 3GOHA 2RCNA 1GVNB 1T3HA 1UJBA 4JXZA 3OJOA 3GLHE 4HRXA 4Y8VA 2NZYA 1OIVA 1S01A 3HU5A 2XHEA 3BIJA 2PGNA 2VXOA 5E1MA 1O5TA 4FDVA 4UD2A 1Q20A 1RWMA 3DH0A 5BQ3A 1BVHA 1SCIA 3MWDB 2XKBA 2YC2C 1D8TA 3ADPA 3GXBA 1E9CA 4ZV9A 3WBJA 3TW0A 4BP3A 2CNDA 4MPTA 4D8VA 2H2FA 3VISA 2SBTA 4E11A 4OXQA 3LZ6A 3EUFA 5DJ5A 4M0CA 2WK1A 3FWHA 3I6IA 2XNDA 4OOFA 3WSWA 4HB4A 1RM5A 1GZ6A 3A6LA 2DVMA 3E81A 3HYSA 3ZU2A 5T6MA 3GLRA 5DOZA 1QORA 4RULA 2AK3A 5EJ2A 3WIOA 4P82A 5TMBA 4AX8A 1PV4A 3MUOA 3ECAA 5G0TA 4BO8A 3ZHQA 4FFMA 4LY6A 1R6UA 2V6MA 2IE0A 5IM5A 2PYZA 1J90A 2Z9DA 5FDFA 4N6GA 3HUDA 1LBQA 3B3QA 4BVKA 4D44A 2QLMA 4ZCQA 4AXBA 4HB2A 1RXCA 1H5UA 2HF7A 2VSXA 3QENA 4PC7A 4ZC1A 4O6VA 3DCJA 1JECA 1PW7A 2JFBA 1UEXC 4YT4A 1T3TA 3EIFA 4XD7D 1KS9A 2PKCA 4Z9BA 1PGJA 2ISCA 1E9BA 3ZHRA 4P4LA 5AJTA 3DF9A 3S5JA 1Q44A 2O7SA 1HDGO 2O9JA 5E7JA 5EZQA 1JWLA 3IV9A 4LRWA 2WV9A 1A8QA 1UWVA 4ZAZA 1KJIA 1NFQA 4E15A 4AXXA 3UJ9A 1NNSA 4AMZA 3UV7A 4ALMA 3OKAA 2B6HA 3S4YA 1JHMA 3SKXA 3GFPA 3K0HA 3IKLA 2FE1A 3H9EO 2H7CA 4U9HS 3B9RA 3FUXA 3H5WA 4OHXA 5FEUA 1EYZA 3HRKA 1NR1A 1IJEA 2H06A 3A1UA 1MO3A 3EVNA 3IR5A 4OYLA 2M6LA 4Z4EA 1DKMA 1VPDA 3BXHA 1MW9X 3GDWA 4B76A 2P67A 1BNCA 2D2VA 1LPMA 1SUFA 4YO7A 2K2WA 4TTJA 5KQMA 1PT6A 3PDIA 4L51A 5LIRA 1XLWA 3TW6A 1TC1A 2P9QA 3EMBA 3N6XA 4ZAFA 1QTIA 1Y1QA 1IL0A 3HM9A 2PFGA 1M67A 3L7CA 4ESHA 3AR8A 3HE3A 4L9RA 3F67A 5A4IS 5IDYA 2E4AA 4J29A 1TCCA 1NVXQ 1WCYA 4MEJA 2PIAA 4XE5A 4QHSA 3X44A 1MENA 2BZGA 4BQEA 4YMHA 1DS6A 3PQ3A 4H60A 1PAUA 2P8SA 5JWOA 1HX7A 1GXSB 2DZDA 3HS3A 2C82A 4EW1A 2PUBA 2A0FA 2R86A 4N7MA 3HDGA 4QREA 5HX7A 4FWBA 4B9AA 1JE0A 3IOMA 2P6PA 3QNMA 4U7GA 3GI1A 1MNAA 2PWBA 3HI4A 5CW1A 5IVHA 5AK0A 5FPTA 5C34B 1YB1A 2OILA 4KPUB 4DLSA 1PBTA 1QX3A 1GRVA 3P19A 4U7HA 3TZCA 3JQGB 3LSTA 4XUDA 1FA9A 5EZSA 4YYEA 3ZGVA 5BSGA 1Z7EA 5E1DA 1DQPA 1Y7PA 4W5OA 3Q87B 2ZTMA 4KLCA 3B2NA 5IAJA 2D06A 1SUCA 3RRFA 5DYGA 4ACBA 3MA0A 3MLEA 4Q01A 3IBFA 5CNKA 2ONCA 4MVJH 4D4LA 821PA 3F6RA 4BNVA 2C0CA 1ZN8A 1L4BA 2HNAA 2NSHA 1U2GA 3ITDA 3AG6A 4YACA 5AJHA 3MS2A 1QDUA 3CIOA 4HXYA 1RPAA 1RAAA 1A7UA 1HE3A 4R8SA 5LJIA 5A0VA 4BCCA 5CDTA 3NKFA 3U3KA 3V1LA 2F9LA 2LV8A 2DPGA 1DVRA 4HAUA 4Q1VA 4IUBS 5E6RB 3EGIA 3NYWA 5FOUA 4D9EA 1YCGA 2AYXA 2MSNA 2AXPA 1DIHA 5CX4A 4EARA 1UQRA 3DNFA 5HKKA 4HDNA 3RJZA 3JYLA 3RAEC 1E3JA 4TSFA 2Y1EA 1IN6A 3EIOA 1P9LA 2EKZA 1DQNA 2D1FA 5CLJA 1V48A 3FVQA 1G2QA 4NDZA 1N77A 2ZB8A 2X0RA 3ELUA 1V5GA 2I4NA 3MWEB 3H2GA 4CLRA 4YJGB 2K4MA 2FSUA 2EEZA 1H5NA 3A1NA 4S24A 4RPIA 1DDIA 2X5OA 1G64A 1ULHA 4GPIB 4DA9A 5FX2A 1KS2A 5KOHA 3RS7A 1N5OX 2Z04A 4CLOA 1MN6A 2HF9A 3F4KA 1PKXA 2WJJA 3FPEA 3HY3A 3OCWA 5JAOA 1T6ZA 3T9FA 2WU0A 1RP7A 3SQLA 4F7WA 5D2CA 5IZCA 1ZMTA 3N2NA 4R8LA 4RD0A 1XA0A 5F2NA 4FOPA 1J8VA 1L8XA 3LA8A 3T7SA 3CX6A 1M2HA 1ORRA 4HD8A 3HGQA 2YY6A 4RHFA 2I0FA 2O3QA 3G2MA 2G83A 4Q5IA 3NORA 1XXHA 4G63A 1ENPA 3TSCA 5IPFA 3WLOA 2BY4A 3RGGA 1ABEA 1KNXA 4LJ9A 2XUHA 4MMXB 1G8MA 1D5WA 2FRXA 4WFKA 3L6CA 4WLNA 2H4YA 1ENOA 4KNVA 1ZIXA 3EBPA 4IDGA 3D9QX 3MB8A 4WXRA 4U9UA 2CXNA 2H0QA 3THXB 3PIRA 3QUAA 4B75A 1PSZA 1GTJ1 1ZQ1A 4KXXA 3U4IA 3GJ5A 3USZA 4M9QA 3TECE 3RGWS 1OBOA 5E4FA 1EWKA 1SUEA 2QZ4A 1GA6A 2BCJQ 1ND6A 4X1YA 2PRIA 5ARBA 4QZVA 3CG4A 5JCZA 4TMTA 2WUDA 2NZJA 3L7JA 3AT1A 2FN4A 4OQFA 4DMGA 1D1TA 2R44A 3FAZA 3UV6A 2QRUA 2W22A 4IEFB 4NYJQ 3E05A 3OCJA 1KVUA 1WY5A 1ZJZA 2ASEA 3I2HA 1YZKA 1R5NA 1TJYA 1WUJS 5DCYA 5BWLA 3U4MA 1G5IA 4EO4A 4E22A 1T5BA 3VUEA 2N46A 4I46A 1Y8AA 5I7EA 3AL3A 3GCDA 5B1SA 2JCGA 3OX4A 2ZWIA 3MTBA 4HWTA 2GCNA 3I42A 4XLLA 5ECGC 5DHPA 4ERNA 1F4VA 4OI4A 2XMSA 2XDWA 4KUGA 3QPDA 3ZDXB 2FMTA 2KB0A 4EGFA 2Y76A 3AFIA 5AKGA 4P6VF 3G0CA 1DC8A 1HETA 5B12A 4W5WA 4YMWA 2C54A 2ZANA 1HLDA 3FFAA 3HR4A 4N65A 5J63A 4AMYA 3RQSA 2ZI3A 4BX2A 1L1RA 4IJMA 1JFFA 4MEAA 1N3IA 2DLNA 5K0CA 4B73A 1CEXA 2DBVO 3HBNA 3SXUA 3THRA 2FWRA 5LLSA 2QPTA 3O74A 4UVGA 4TMVA 2V74B 3E9CA 4FSDA 3S3TA 5K8UA 4LF9B 3TD2A 3QBJA 1TYZA 1N2SA 1Q1EA 2ZI9A 3A70A 2HUPA 1A1SA 4URYR 5D51S 1BWQA 2RC5A 3EFOA 5GY7A 3I5AA 3VMFA 5NLLA 2BGIA 2XKJE 3DUFA 3MTJA 1B2LA 4YB8A 5B53A 3TDMA 2BJHA 1KFKB 4HX9A 3U2QA 1FLAA 4HDMB 4P93A 3PEFA 1OASA 2BI4A 3OQPA 4MQ5A 4WKPA 1M7GA 4KZPA 1JAYA 1U94A 4DRXA 2ZIUB 3H1GA 4IQ8A 3UJDA 3ZE6A 2IPNA 4U4AA 5BYKA 1FMCA 4MUFA 3SBDA 3WK8A 5J4VA 4FHFA 2RAPA 1KEEA 3WWYA 1P44A 2PGOA 3G79A 3IERA 2KHZA 2LDXA 5IYZF 3SEAA 4C07A 3ADCA 1DCTA 1AH2A 2GPJA 3SFZA 4PNEA 5KTRA 1ZAYA 5CLGA 1W49A 3QF7A 4BGIA 5JSZA 4V0MA 1L5VA 2YTZA 2CXRA 2HGSA 2XA1A 3I3OA 1SIOA 4ZHQF 3AFNA 3E3MA 3G2KA 4AJ9A 2O3SA 1I7QB 1EUDB 5K8CA 1DBIA 4WVFA 3AOEC 3PPVA 4OI0A 3T5PA 4ZOEA 4Q1EA 5J40A 4CL8A 2AYYA 3LBFA 2RK3A 4JB8A 1AS2A 1GTG1 2B3DA 4XA8A 3B2QA 1HC7A 4JSTA 6Q21A 3WIVA 1QVAA 1TU3A 2JJQA 2WIAA 5EEHA 2I2CA 1N2IA 3VV2A 5AM0A 4BTEA 4WN9A 4Z99A 3UMCA 3UT5A 1XTVA 1MHTA 3NH6A 3OFVA 1ICEA 3ZBUA 4JJAA 1AQ6A 1P7VA 3KVNA 2O2EA 4RZUA 2BF7A 5DTEA 5HFNA 3HK2A 2W37A 3BRCA 5ALJA 5JSKA 1CW2B 1QYDA 1V96A 3SU8A 3WQSB 1CR2A 1U0SY 4IGEA 5CBPB 1CUEA 1Y81A 2VDQB 4YJHB 5AK5A 2ZXUA 3ANYB 3EGWA 3WAGA 2WUFA 1IQ0A 2HDNB 2HWKA 1XJWA 4J3JA 1N9GA 3ZD8A 3DMRA 3KAKA 3QWHA 4H4CA 3WBBA 4ZYLA 3U19A 4P22A 3AOGA 3MFYA 4FS3A 4GPEA 1ONBA 1VL2A 4FBLA 1YB4A 2MDTA 2ZJAA 1L4FA 1VKHA 5GV7A 2I5PO 3H86A 2WYVA 4J16C 5IJXA 1YGPA 3Q4GA 3D2CA 4MA0A 2I7CA 4YRAA 1XQ6A 2C20A 5E9AA 2ZG6A 3KZMA 5KAMA 3DL7A 2A7XA 2OV1A 5K01A 4F1JA 4XX0B 4C0QC 4WLOA 2NO7A 1JHRA 4MRNA 3K53A 3CVJA 4QD3A 3JQ9A 5EIOA 5AVXA 3KQLA 2OYCA 4G25A 5HGXA 1RLMA 2I6XA 1JMYA 1ZCBA 3LUGA 4I5EA 5TMDA 3LMKA 1YH3A 5FUWA 4IIJA 2IL1A 3JZIA 3L7OA 1H2XA 3EFHA 3PSHA 2NP6A 1OXSC 1V8PA 3O9ZA 2ZWMA 4M8NE 4TV8B 5JQGB 1OZHA 3LUBA 2BH9A 3T95A 3H13A 1K5GA 2FPLA 1OLSB 3R6GA 3QVSA 3ND7A 2NT4A 3Q8MA 2I3DA 4QUEA 4U2GA 3BRQA 4F2GA 1T2VA 3TOSA 4OH7A 3ILSA 1VMEA 4EFLA 4LGYA 1U81A 2QUIA 1O8CA 2F1JA 1S3GA 2Q2WA 4XGIA 2FRDA 3FZEA 4DJAA 2JIBA 1KMHB 2C3YA 3U1TA 1E7WA 1U8XX 3QUCA 1FFSA 1GDHA 2FDXA 3JARB 1XMXA 2IP2A 2X76A 1H3NA 5FV4A 3R0ZA 3QLVA 5KOJA 2K87A 1EWTA 3QJ5A 1GCAA 1NURA 4Q12A 2RGDA 3L8EA 4PSUA 4B6GA 1Z2PX 4W8OA 2I1WA 1XCMA 3IVMA 1ISHA 2QYSA 4GKAA 4UTNA 4CF3A 2OSVA 4IUYA 4B3JA 1PJ4A 3HB9A 1E2IA 4LQ4A 4R1MA 3LLCA 2XEDA 1URPA 1XWWA 4ARZB 1P4HA 1NR5A 2QY9A 2DERA 3WY9A 2F55A 2QSUA 1PNOA 3DKVA 1DTWB 3S68A 2Z57A 2PKEA 1ZW1A 2GLTA 4E21A 1G21E 1ULAA 3D2LA 2YYYA 4MVJM 3AESA 3GFTA 2RGWA 1EGMB 1DE0A 2OK8A 2P40A 4JXKA 4L08A 3EFEA 3WGZA 4F0JA 1RVV1 1QIGA 3Q85A 4V0RA 3HI6A 4KJXA 4XPZA 2Y1LA 3HN2A 1AN0A 2R4UA 4AG5A 2IXAA 5HIKA 2I4LA 5AW8A 4B74A 1TTQB 3W5SA 4L75A 1W4RA 1SXJB 3J7TA 3U16A 2QE7D 4WEOA 2NZXA 3RRXA 2B5OA 4YJ2A 4QRIA 1FMTA 2WTEA 1L5YA 2Z8XA 2CD7A 4NICA 2VQDA 2ONJA 3R8CA 3FX2A 3U56A 2X14A 4FIDA 4DBVO 2XVYA 2UYCA 4HUQA 4M9RA 2XADA 4RVSA 1HV8A 3KTAA 1UPAA 2EFHB 3ZLJA 1NFFA 2OYRA 3VKFA 3JXEA 3P0HA 1KI2A 3CVWA 3T9BA 4MQ4A 1SXQA 2JARA 3QUTA 1T9ZA 4AX4A 4NU8X 1RW4A 1WOYA 5GZ6A 4Z53A 1D0VA 1E61A 2A9OA 1UBRS 4WZAA 1PFKA 1XDUA 2NV6A 4M83A 3F9RA 4Y0VA 5DTQA 3P0FA 1VE1A 5C1OA 1YR7A 4PV7A 3GLGA 2I7TA 1VJCA 2Q29A 1ZYUA 4QJ3A 3L9XA 4UE6A 4V0QA 4EG7A 1BU5A 1MA3A 5FNVB 2ZM5A 5HEKA 1NRIA 1DO0A 1A5SB 2GLUA 5FL7D 3EODA 1E7YA 3TW8A 4WVLA 4XM1A 5C81A 1V3TA 3N3AC 3L5OA 2PZBA 2CJPA 4O8CA 5K0NA 4C5CA 2ZJ1A 4F86A 1VE6A 4J4BA 4B6RA 1PG0A 2VS1A 1D0IA 1I1QB 3FH0A 1DFIA 1GPLA 4US2R 5K9ZA 2W6QA 1IAQA 2JLBA 2SCUB 3OZBA 5IUJC 2J5RA 1RQ7A 4FFBB 3CUEF 2RHHA 2Q3EA 4Q1AA 1BFUA 4X8MA 1PS9A 3S0JA 1J09A 2R7LA 2HU2A 4ITUA 3GBVA 4CTMA 1UMCB 6YASA 2IODA 2MMGA 2AW3A 1BG6A 2Q0QA 3PD0A 4R2WA 5IXSA 1IBKB 2V7EA 2YS6A 2FUG1 2X3YA 1H94A 4F3YA 3E22A 1X1DA 3NAQA 4XUGB 4WEQA 5FPKA 2AX3A 4V0NA 3UA4A 2ZAIA 3ZCVA 3UWPA 2OVFA 2GAFA 3SKYA 4QAJA 4J0HA 4PY2A 1ULBA 5M7EA 1B7GO 4YV2A 3QNWA 1Z4PX 4MB6A 4QXMA 1JILA 4PGGA 2HMYB 1NOIA 1YQDA 4Y6PA 4CCYB 4YMTA 3P94A 4F9GA 3P0IA 2JFGA 1EFVB 2NU7B 3P2JA 1KSJA 1HMYA 4KQGA 1LSOA 3U5ZB 2H5JA 2YHAA 5E6UB 3SZLA 3UGQA 4YYZA 4BFXA 4UAUA 2WF7A 3KPUA 2EQAA 1SHZA 3WMEA 4LVOA 4F3KA 1UMKA 5ELXA 3DG9A 4FX2A 3V3TA 3QF4B 2OFFA 1P4RA 4O4JB 4U0KA 2OUKA 3NWPA 2GK4A 2W2NA 2ZIFA 4DQLA 4Z1OA 2AZXA 3OICA 4NOJA 3EPLA 1KYYA 1X9IA 1IEQA 3JQBC 1OYOA 5BN3A 1IY9A 4G0VA 4IR7A 4WKBA 2BFCB 1YZNA 4H2DA 5DGXA 1S89A 4AYXA 1ESEA 5I7VA 5IJ0B 3S27A 1CDOA 1VMDA 2O0JA 1TEVA 2AT1A 4BKMA 2JAWA 2TMKA 2FOIA 2DLCX 4G8BA 3RBXA 4D96A 4P36A 3W90A 3NOXA 5A4KA 1HOXA 3G7SA 3QK7A 2JAOA 4GSYA 5CGQB 2FN3A 1NKTA 3N87A 3RUDA 3U7RA 3X1JA 5J4YA 1RHQA 1WF3A 2GSDA 2P2GA 3C4JA 3FGOA 3EQ9A 3LKZA 4FGLA 4KV9A 4ZDIA 4FBGA 1NJSA 4YVFA 4BE7B 4HSGA 5P8WA 5C5CA 3GHHA 3OKFA 3OU7A 5JFOA 5FLXA 4CM5A 1ZJ6A 2RG7A 3SHQA 3FRHA 5CXQA 1W0JD 3WLPA 2VH1A 4ND6A 4IUDS 4K3UA 5JDCC 1WQ4A 5U9CA 2HMWA 1JX6A 1ZO8A 4C7JA 3ONVA 3S44A 2Z9CA 1DC4A 4I9FA 2XWBF 4ZVUA 2GK3A 3RRNA 4NX2A 3L7DA 4K1LA 3WLKX 1RWKA 3NVMB 4CETA 4WE3A 2FJ0A 1KEZA 3T7JA 1Y6GA 5A6VA 2DJIA 5AXBA 2ZZKA 3TSYA 1GLGA 2JGEA 2P0AA 2QTAA 3DDOA 2XYPA 4IF4A 3I52A 2ZULA 2PFKA 1XDZA 4JQYA 3JWEA 3SXUB 3JTMA 1VE7A 2JH9A 1IG3A 1KI6A 3D6FA 4JP5A 1XB2A 3PYLA 3WNQA 4X65B 4ZHQA 2YKGA 4M4SA 5JSQA 2VNHA 5K8LA 1ETHA 5AUPB 1H2WA 3RG8A 1U2DC 4JYPA 5HKKD 2W4MA 1XF9A 5AJXA 2QNIA 3QW4B 1NBEA 1PV1A 1EX7A 1U1EA 3H84A 1K6IA 5CIWA 1GPKA 1RQXA 3AW8A 1C8KA 1G8PA 1C9YA 4Q00A 1KMCA 3RS8A 4EF4A 3R5XA 4KH1A 4PTZA 1XQWA 2XUFA 4YHBA 2PSHA 4HNQA 1IEWA 4MUBA 4QVKA 3CB4A 4XEHA 4DDMA 3EPHA 1IMJA 1XTJA 2HRQA 2EDCA 3M6XA 3K9GA 4EW2A 1BE0A 2ZPAA 4V0OA 5JO0A 4RXMA 4L50A 3ZWCA 3EGDA 5L45A 1OIXA 1WULS 4EF5A 4IIJF 2XJ4A 3O7MA 4O4HB 1N7IA 1JEDA 4P92A 1T1EA 1PCXA 2OG1A 4YRRA 2VHYA 5K6RA 1PDOA 1LC3A 3PV0A 4MRRA 3GN2A 1SBIA 1D6JA 4KTVE 4RZ3A 5KVSA 2EXXA 4KQ6A 5AESA 4RDXA 2QRVB 2Y93A 3CW8X 2ACEA 4HNHA 1G3RA 4E7OA 4OXNA 4LMRA 1RWQA 2NTYC 1VLZA 4L6AA 2PZFA 3I37X 2W2KB 4MYDA 1XXHB 2Z4TA 1RLTA 5C0OE 1M6VA 2WTXA 3LT2A 3Q98A 5EYPB 1GLNA 4J07A 4D6YA 4QBFA 2QIPA 5EKSA 3VSDA 2YZMA 4IQFA 1B8UA 3NYIA 2QLFA 1PJ2A 2O8NA 2QB5A 3EXEB 2IP4A 1NP7A 1FNDA 1R8YA 3KOMA 3QUQA 4FGSA 4X1IB 3DZJA 4CW7A 5CNJA 5I8PA 3IGFA 1NI4B 2JZNA 2AHOA 5ESXA 1GGEA 1JHPA 2DY1A 3TAHA 3L82B 2AG0A 3AEQB 3RWOA 1QC5A 4H0FA 2W8ZA 2JIQA 5GP1A 5CYGA 3AR7A 3R3ZA 3T3GA 1RIFA 2WTUA 2AE2A 4UJ3A 3I1JA 3RS4A 3AY7A 3FMGA 4O2BB 5JRJA 1ATIA 2IZ7A 4BOYA 1XGKA 1X77A 2BBSA 4KH0A 5KVAA 1RPJA 4L9WA 2OM2A 1S7CA 1YQTA 3U49A 2XXBA 2BH2A 1GGJA 1XEWX 4UZSA 4YJGA 1KPHA 5FTMA 4D3ZA 5TT0A 4QBHA 3AKDA 4QYIA 4DDUA 4HBZA 3HYCA 4OM7A 2Q2VA 1UF9A 1J4AA 3C6MA 4A5OA 1GV1A 1Y4ZA 4IWYA 5ITWA 2REOA 5FPYA 5DNYB 2VC2B 2Y6VA 1N2ZA 1QJCA 3MT7A 2ZYTX 4FYHA 5KYYB 3LHDA 1ZN9A 5L4NA 3TWOA 4DQVA 1QF6A 4KIWA 1SC1A 2H1LA 5HS6A 3UFXB 4RSMA 4BYGA 5J2TB 3NDIA 2NOAA 3PC6A 4JS0A 2M9MA 1X2EA 4R81A 4RLFA 3W04A 2EAUA 1DIBA 3E9ZA 1ZNXA 1V5IA 4PR3A 4Y9UA 3QV2A 1Y5IA 2AKAB 5ERXA 5G0WA 2D6FA 4X00A 4ZU6X 4KACA 4OHMA 3N0TA 2OCAA 1OFGA 4K86A 3AUKA 1O6FA 1T5HX 2WVAA 3ONFA 5DGIA 5JPIA 3SD7A 2FHPA 3SSOA 3TTWA 1QZZA 3QX3A 1QCZA 3JQAD 5BWMA 2VP2A 3G6WA 1ZH0A 2I80A 4QU9A 4TRMA 4F93B 2CNWA 1HT2E 3OPYI 2ZIXB 4YUWA 3O3NB 1PO7A 1OSNA 1U1GA 3C5EA 3W5DA 2C9ZA 1O87A 1R8XA 2HJSA 4TQAA 2HXGA 1KJ8A 2O3UA 4CG3A 2AVDA 2V7BA 4TX1A 5EHZA 4X66B 4ZCMA 3LU1A 1JTVA 1W1UA 2P9CA 1JR3D 3O82A 3AQ4A 1DXHA 4DG5A 4N7BA 2GX6A 1L5NA 4CT4B 3RHTA 1N9GB 2FFHA 2J3EA 4TMZA 1RLJA 1DO8A 1ESDA 4N8SA 4CDRA 5ALSA 4Q3EA 5LFAA 2DBYA 4ZEOA 3VTKA 2YYZA 4EY6A 4OQMA 2FP4B 4F5EA 5JHHB 2YUIA 4IIFA 2YV4A 2P90A 1XVUA 1IONA 1OXTA 1GO2A 3RVSA 4XGKA 3BD9A 1U63A 2I4RA 1U0OC 3T7EA 3BZUA 5D3ZA 4I3HA 3KETA 3LWNA 4BBPA 5DWDA 4Q9NA 1MU0A 1SHUX 1Z6QA 2VH5R 3GDFA 3TR0A 4B46A 4OAOA 4HAYA 2WD9A 3ZQ6A 4JYZA 2FCRA 1I6MA 3ORSA 3TKYA 3DT8A 2FMFA 4DLAA 2C5BA 4DWVA 4G0XA 4BFLA 4DDVA 5EE3A 2QT1A 2V0CA 2XMBA 3IT2A 1Z74A 2OA0A 3PB3A 5C5IA 1NDUA 4MCJA 4MYTA 2FXVA 3DEJA 4N39A 3STWA 3V8RA 5D3QA 4NDNE 4GPTA 3D5QA 2YRXA 1Z63A 3DB1A 1FTSA 4N3NA 4DGSA 3K8QA 2WPDA 5F7ZA 2BM0A 2J6BA 3BD6A 3RJMA 3K9CA 3UMBA 4IILA 3CZRA 2PJUA 5HE8A 1XAJA 1G6OA 2VUTA 3WDLA 1M8GA 2E1RA 2CDRA 2XKAA 3LC2O 2NADA 1VL1A 4UARA 2FSSA 4NCIA 2EV9A 5B36A 4Q9KA 2QR2A 2QTRA 2WYHA 3IE0A 3H5OA 3QTTA 4BVFA 4BVAA 4DEYA 9MHTA 1CZNA 3PC2A 4C4PA 1W36D 4XB2A 3D0QA 4XWTA 5CEEA 3FI0A 3COPA 3WDSA 1RP1A 1DV2A 2FWNA 4IDPA 5G1OA 4EW3A 4C0HA 5BV1A 5GM1A 2DT8A 1WXHA 1HLPA 2WMYA 4Z8XA 1ZGHA 1OYVA 4R9UC 1Y4DE 2W2VA 3LCVB 1PDWA 3O2QB 4JYBA 4N18A 3B6MA 3ZW9A 4G86A 3UQYS 4BO6A 4B3DA 2JLZA 2KSQA 4AKSA 3MHPA 3OQVA 4ZOLB 3TFWA 3EH1A 3JV7A 3RKUA 4L72A 4XUEA 4C0WA 4ARCA 2FW9A 3GEMA 2QOEA 4FWIB 3T5GA 4EG5A 3PNSA 4J4TA 2BM1A 3VPFA 1EXVA 1GRNA 2NQTA 4X93A 4BNZA 5J2UA 4KR9A 3VUFA 5L4LA 1J1IA 3P52A 2GOYA 1T8WA 1DG3A 1SVNA 1KYQA 3AI2A 2JK1A 3BFJA 4Y6LA 1YRQA 2Y3IA 2QMHA 3TL6A 1Q14A 1DCFA 3BXOA 4JI1B 4XLTA 1M9NA 3OOWA 3V5NA 2YJZA 1OJLA 3A05A 5IBPA 1QK3A 2UXBB 1OW3B 3A3YA 4MVJP 4U3JB 2XJ9A 2HDHA 4B35A 1QRTA 4PPQA 2C3MA 2FPIA 4G09A 4ER5A 1IOZA 1H93A 4W5JA 3KOYA 5K3FB 4TSRA 4AECA 2FOXA 3K16A 2DUUA 1TVKB 1VLLA 1YUBA 1Z7WA 2RGNA 1M8JA 3KWMA 5F3WB 2E49A 1LNQA 2FPMA 2FK8A 2CYCA 2FLKA 1MPTA 1W48A 3IHWA 1DAMA 4Q37A 4PO1A 2HSWA 5M3BA 3SYNA 2RSLA 4RAOA 1TUGA 3M3HA 4OKSA 2YCBA 3BGOS 5F5XA 3ECCA 1QIHA 2HHJA 3GAZA 2ZETA 2C5SA 3HKCA 1KQPA 4CNQA 2Q45A 5LZ4A 2EFCB 4UU8A 4GDMA 3C4QA 4HWGA 2P0EA 4KPGA 2HBZA 4WBSA 2VP3A 1S8AA 2EGHA 5LB4A 1U8ZA 4UM5A 1EI9A 1NPDA 4KDRA 5HBRA 4PLVA 4I4NA 4M3NA 1MOZA 2D1YA 3F74A 4IZOA 4LTMA 3AM1A 4TQUS 5EKTA 1Q19A 3OHMA 1MFPA 3KU4A 4RCZA 3VR5D 4LQCA 4DS3A 1YR6A 2OPHA 1T8YA 5BSVA 1DTEA 1H6AA 1VDMA 4JP1A 5ALVA 2Y99A 1L8LA 3SC4A 3RW9A 2IPAB 4MKHA 3HLYA 4D3SA 3KOXA 1QKJA 2R2AA 1I3LA 3E5RA 2BLNA 3C8UA 5GAJA 4BQQA 2GCGA 3PP8A 1A04A 5AHWA 2G1JA 2VHVA 3I2FA 3VPGA 1JSXA 4DVGA 4M0MA 3DZHA 1W8DA 3QHAA 4CIYA 5LQUA 1OFUA 4DMCA 3BXEA 3E7FA 2F2TA 4CF6A 3I6MA 2FSGA 4JELA 1THZA 2FWIA 4NCXA 3QVJA 3R3WA 2DFLA 2SNIE 2WSIA 3KFXA 4DNPA 3GK3A 3SWWA 3I0ZA 4E2ZA 3RM3A 2HDOA 1T1RA 3I01A 5T8KC 1NNEA 2D74A 1X94A 1T8TA 4L5AA 1XZFA 4WKCA 5CT5A 1ETUA 2XOKD 4GL4A 3WBFA 4JUIA 2Q0HA 2JD0A 3BBLA 2YWRA 4WA8A 4OHWA 3WG9A 5TS2A 3D0OA 1BHQ1 4V0LA 4CVNA 4QBIA 2F1IA 3Q0TA 1ZJJA 4JOCA 1SZCA 3M6UA 4Q24A 5ESWA 5JBQA 1W4AA 4J7XA 3GWGA 5JNRA 3AR4A 4UC0A 2CHEA 2EG5A 5T7BA 1H0RA 1DELA 2O3RA 2ZR7A 2CWWA 3H4MA 4OLFA 4YUAA 3KEGA 3RJTA 2QI9C 4GRIA 4BEJA 3NTRA 2UXDB 4W1QA 2VK4A 4LXGA 3WBKA 4NS1A 5KC9A 3ZWKA 1VLQA 4FYJA 1PR5A 2GD0A 1YBVA 4URWR 4F6LA 3UN1A 5CFZA 2H65A 4JGIA 2TS1A 2YV2A 2Y66A 4GR5A 4I50B 2G06A 3NW9A 3GLGE 2IIVA 2XMQA 2Q8NA 4UQPA 3GRUA 4KOEC 4COOA 2IGTA 3C24A 3QLVC 5C46F 2JLCA 3FF4A 4CEHB 4I5DA 4IEIA 3BE5A 3ZGYA 1SNYA 1U04A 1RLOA 1TM4E 2DBRA 1Z8DA 2GZ3A 3ASZA 3KQTA 2OB1A 1KJNA 2FSFA 1PT5A 1H2RS 3LY5A 4FJ1A 4ALLA 3DMPA 2NSDA 3CWCA 4WPGA 3SG0A 3WDMA 2IK8A 4F4DA 2GJSA 3CH4B 3EWNA 1N7JA 4NCNA 4WQMA 2PBFA 2AJTA 2RGGA 4ZZ3A 3DOJA 3RR2A 2C9YA 4LJ5A 4BO1A 4K28A 1M73E 5HZHA 3W9UA 3VYWA 2ADFA 5DM0A 1QCCA 1T26A 4W8GA 5HNKA 2OO7A 1NUHA 3E0XA 4ZQIA 1C8BA 4Z2YA 1V1RB 2QTVA 3QLEA 1S8OA 4MRMB 1ZA2A 4X85A 5CJPA 5BSUA 3ZXYA 5LL6P 3S7ZA 4C7OA 1Y1KE 2H54A 4UDOA 1JUDA 3T52A 3IT1A 1EEXB 2WP8J 2VTBB 2RAUA 4PNPA 1E9EA 4DARA 1YKFA 1HGXA 3PRHA 5FLEX 3NIDB 1Z6XA 2ZXEA 4B0OA 1PT8A 4JITA 1FVXA 2QTCA 5LPNA 1MC8A 3UPTA 4JYMA 2VTVA 5ES4B 1AXGA 2A5LA 4PZYA 4HAIA 4RTSA 2VHCA 3ZCXA 4GYKA 1GU0A 3HKDA 4K40A 1X1SA 3KKEA 2D7CA 3RVNA 2I29A 3LNCA 1JQ3A 2PBRA 2WTNA 4WOKA 1ILEA 3GT7A 3UB4A 2FSHA 3CE6A 1GY8A 1C3JA 4BV3A 4JT2A 2PZGA 4OP3A 2OD2A 2R8BA 4RVUA 1ZD2P 3V4VB 3DFZA 2BAGA 1VCIA 4MQEB 4A8HA 3FGZA 3AGPA 4R8VA 2A1TR 2RHOA 5CAEA 4MV0A 5GGYA 1I2CA 2W2XA 3OH8A 1D4ZA 2H17A 4C7KA 3UJ7A 1FS5A 3L0PA 2Y71A 1B73A 1G6HA 1T2EA 4B4UA 3COVA 3PFKA 3B12A 1MX5A 1OZAA 1Z0DA 5IT9A 3PNKA 2GZ2A 4HI0E 4F4UA 3IOBA 4B8ZA 3ELDA 4Q4AA 1QGED 1RCFA 1GR0A 2BGTA 1NVAA 4G24A 3E5NA 3R5JA 1P9RA 2UZIR 2WR8A 2XMPA 3LJKA 4KQEA 1HTTA 3BYZA 4M55A 5EXSA 5FNVF 1H8HD 2XWQA 3EZFA 1VHWA 5HPYB 2XW6A 3DBRB 4HGOA 3TIIA 1NQXA 4NATA 2NXJA 5IXYA 4YR9A 3IJ5A 1OH5A 1TU0A 4LRYA 1XNHA 1PS0A 1OOEA 5FI1B 1P4JA 1LB1B 2CWDA 2R2GA 2C94A 4RJIA 3SCZA 3AL0C 2ONYA 1YONA 5B37A 2DFTA 4DKJA 2A1UB 2CCJA 1XKQA 2XQJA 3G5MA 1Z36A 4I55A 4JVOA 4QDJA 4A0SA 5CA1A 4BP1A 1CUCA 1MAVA 2PZMA 3UAYA 4B80A 3BCSA 5EPOA 4HNGA 2C4NA 2BYTA 3NYQA 2O14A 4JUBA 4G5QA 2R96A 3AB7A 4JHXA 4MB2A 5EPUA 3VGPA 1UEJA 4M88A 3VZBA 4AT1A 4NJOA 3REOA 3RLFA 1IXZA 2VQFB 4I66A 5EPEA 1KDRA 1YZTA 5DP2A 3MBIA 2WSLA 4RV9A 3STXA 3VX3A 3PNBA 4CIDA 5IFLA 1CEQA 3DOIA 1FLNA 1Y7LA 2B3TA 2QUZA 3LO8A 4CR6A 3ZHUA 3MJVA 2JD1A 1JBKA 4I0WB 4BUZA 1YGYA 1SUSA 2VF5X 4RD1A 5KVQA 1XIVA 3UBMA 3WKAA 4GO1A 1UKYA 3G9UA 5I4BA 3VR1A 4M22A 2WNIA 3SXPA 2IZOA 2A58A 4IRMA 4OSOA 3IELA 1U4OA 4NYMQ 5DTJA 3WL3A 1TZMA 4HBGA 3VZQA 3P9QA 1Z2EA 2ZQZA 1LBEA 4M38A 2HCTA 1Y3BE 4HQ6A 3HCCA 3M0EA 5AVKA 3KZOA 1KYZA 2E5WA 2YOGA 1ODJA 3L8YA 4JY7A 4HGNA 3VXKA 4LGCA 2EJVA 4MQ6A 4TTRA 4A23A 4QT4A 5JFTA 5LXTA 4LJYA 1D3AA 1XTIA 2OKCA 5BNTA 4OGKA 5DHUA 3UJPA 4YONB 3K5WA 3PYMA 2JPDA 3I01M 1QX4A 2RHWA 1XF1A 4GI3A 3K05A 4ZVMA 4EG8A 2OHXA 2HJVA 5EJ4A 1QU3A 1J7JA 1UBFA 3H4IA 3DXXA 1E66A 1K6MA 2H4JA 3ZJ5A 2JJ1D 1WCV1 2LVBA 4I5GA 4FC7A 6GPBA 2I6GA 3UKDA 4B6OA 3JYNA 4PFKA 3BERA 4Z4IA 1AQIA 1OGYA 3LXUX 5CB6A 3W8DA 1D0SA 2CNBA 1JKXA 3K30A 5U4XA 4PYKA 1QV7A 4HEHA 3LQ2A 2IZZA 1AGPA 2BFBB 2XCSB 3NGMA 3EUWA 4TMKA 5G2OA 4P34A 1JSZA 2O20A 2XTNA 1E3LA 3DDSA 2GN6A 1I0ZA 4WZ6A 1RMYA 1YFJA 3ITNA 2IXDA 1ZZGA 3NRJA 3I6ZA 3LBIA 3AVPA 2V3VA 2V9PA 2PRKA 1BHJA 5E0KB 5IH7A 1H9BA 1T0UA 2XBLA 2JBAB 1WQ1R 2V59A 1ZIDA 2A14A 4G1UC 4PFQA 4KI7A 2J9XB 1YL6A 3GPDG 1RJ9B 1U28A 1M2EA 3IQXA 2FSVA 1HT0A 4Q9HA 4CEIA 4RORA 3AF3A 4XB6B 2GFIA 3CPHA 3L7KA 3MIIA 3IBSA 1YR9A 3BK1A 2P4QA 3VZRA 5BRAA 2YVUA 2W98A 1CTQA 2AFIE 3ELBA 4K6GA 5BWCA 1AKUA 4U7WA 3AG5A 2WUVA 2G4LA 4LY3A 3GEDA 1KXZA 1U1CA 1IY1A 1SVMA 4XPIA 4ZYVA 2H2DA 2RH5A 3KZ1E 1U0LA 5ICGA 4PX5A 3TIFA 3C6QA 3NBUA 3Q7QA 4RPJA 3QKRA 1V47A 2HK8A 2VKTA 2GYYA 2P9GA 2AFIB 1H8EA 1PKEA 3MMXA 4P08A 5ARCA 3ZOKA 4M1TA 5KX5A 2XCTB 5CR9A 1GCIA 1E5TA 1R5OA 4RPGA 1JA1A 3K5HA 3WV4A 5A5VA 2HADA 3DHNA 4F9FA 1RT9A 2BGWA 4XVQA 4P54A 5DNVA 1OI7A 3KU1A 5G1PA 3UJCA 4ETMA 4C2TA 2ZT7A 1O95D 1UJMA 3ICVA 2H00A 2ZRJA 4MZXA 3S8EA 3O8QB 3EXFB 5CNMA 5TY0A 2MSLA 3HVHA 5FB3A 1KQGA 2BGUA 4TMXA 5K8VA 2IOFK 1Q1NA 4NEHB 4XYEA 2A94A 2QQEA 3QBVA 3EPRA 2UZ4A 1M2WA 1VQ1A 2A92A 2IY9A 1BN6A 5EWJA 3SDBA 1C5KA 4H3SA 2PSSA 4PC1A 1UFRA 5L7YA 3TUIC 4DSOA 5BSHA 4YWJA 1M76A 4YK7A 1GKKA 2JIZD 2A88A 3OPYB 1T6YA 4QLAA 1CUGA 3HKEB 1XPUA 4JI6B 2YASA 2WSMA 1Y63A 5KVVA 5FR1A 5FUYA 3T5CA 1AZWA 4ZICA 3KB1A 3HGTA 4CIAA 5FH9A 2QGNA 3OZDA 2BR4A 3STHA 1RS0A 2OGZA 5ECYA 1TYEB 3RYTC 1JHYA 1I9CA 4L3WA 2BJWA 2L17A 2VYND 1CUYA 3PI7A 4MVJI 5EE0A 1EEHA 1OC4A 2ZUUA 3GC6A 4C4ZA 2YWXA 4EVIA 3RASA 2NO0A 1V4BA 2GBFA 2GBGA 1M2NA 2YWHA 3GMTA 4MCHA 1DX6A 5DGTA 4LF4B 1Z88A 3EDCA 1CQPA 3SHVA 1NVTA 3SP1A 1U0GA 2J48A 2VAMA 6ADHA 1T1SA 5TX7A 2X0DA 2ZE6A 4HWSA 2HL6A 5CBKA 4L4ZA 4MWZA 1Z3IX 1EVYA 2KS6A 3RDPA 2PXAA 1E3IA 3K8ZA 3UC9A 3VSCA 1XYVA 2HU7A 5HRAA 3C45A 2UVQA 3GHYA 4BWVA 4DDKA 5A4JA 5AI5A 1SEPA 5K3BA 5KWJA 5K3AA 3DAPA 3VU9A 3OETA 1X7XA 3P9XA 4EHFA 4MV6A 3FPFA 1JDPA 1UBKS 2WHYA 5I7UA 3HUTA 1ZM9A 4NJMA 1Q6ZA 5EWMA 5CFMA 3WGVA 3UHOA 3KAQA 3ZK8A 2B69A 2CJWA 2JCSA 4P7JA 2UUOA 3HPRA 3N2IA 1YZ3A 4KFSA 4KQ9A 3A32A 4YBRA 5IAAA 2ATXA 3RRYA 4B8YA 1L8QA 2GNOA 4MROA 4H9GA 4NZPA 1MNQA 1RYBA 5JMWA 4JJ4A 3ZY5A 5DSXA 1N2CA 1QWSA 5EMKA 4Q4CA 3D6HA 2BTEA 1Q7EA 1VIYA 3R5SA 2YXLA 4NFHA 4XIIA 3KUXA 1R0RE 4RM3A 2O8DA 2O2IA 2QYHA 4IJKA 3EXFA 2FZKA 1TVCA 2QJTA 4PSCA 1D1PA 1C9KA 2WJHA 4RJJA 1Z4IA 3O94A 4DKXA 2J46A 3OQJA 3STUA 1S2GA 1RAHA 1Y3DE 1VL6A 2ZJ6A 4FCVA 1X6VA 4LQLA 2H92A 3ZHVA 3TM4A 1J0AA 3B1YA 4MIKA 1ESZA 1TLFA 3RFUA 1NUSA 4MGYR 3W5BA 4ZRMA 2ZBRA 4KDCA 1P1RA 5IM4F 8ABPA 4HS9A 4J0JA 2XT0A 4PLTA 4QYTA 3P4UA 1J7KA 2ZRLA 1U1IA 1UC5B 3ABSB 2C2OA 2BMJA 4F72A 1NNI1 4MI9A 3N6RA 2GAAA 5LSAA 1PZNA 1XP5A 2PSDA 2ZR0A 1QYIA 2ZTUA 3B5IA 1IQRA 3C6YA 2QR3A 3E9EA 4IDDA 2FKNA 2WG1A 3IQIX 5AJUA 3TDNA 1ZH6A 1X7ZB 2UVDA 2JATA 3F7NA 1BVYF 4LKRA 4W8HA 2NU8A 3K73O 3EGCA 1E9AA 1UBHS 2FG6C 4L85A 5CX1A 4ZDWA 3IKVA 2HJGA 1Q0PA 5KWEA 1H0KA 2RCYA 3M6MD 3O8DA 1NT2A 4DADA 5A5DA 2G5TA 2EOAA 3X43A 2PIDA 1JFLA 2H9AA 4YCSA 3A1FA 5K0GA 4RQAA 2BFWA 4LXXA 3TBKA 3PXGA 4OFWA 4EO9A 1KVSA 4KE7A 1BA2A 3EGOA 4E5MA 4YXWA 2BFBA 2CGEA 4WOCA 1C8VB 2D8MA 3ZU4A 3ESBA 1JYEA 3I3SR 3WIEA 1PGPA 4A2WA 1KDPA 1EE9A 1X8XA 5JD4A 5I9LA 4NYIR 3QU2A 4NU0A 4WZAE 1GNVA 4FR0A 1OFTA 3RE1A 1NVVR 5DB4A 4YH1A 2G88A 4JLJA 3FPAA 4R9VA 1N9KA 1Z4JA 2AMYA 2G08A 5EMLA 3AUXA 2VZ8A 1QMPA 1VPLA 2HKIA 4LY9A 4TLLB 3NONA 3TCXB 3THOA 4RDCA 2A7QA 3DZIA 3A31A 2JL1A 3W2HA 1CT9A 2IUYA 4Q3OA 5ER6A 2GM3A 5KJ1A 1PR3A 3GG2A 4E03A 4DIFA 3KL4A 2LD4A 3QOFA 3WC4A 4F8YA 3T3OA 3IP3A 4JK3A 1YI0A 4BO5A 3T3DA 2LIVA 2JGNA 2XTZA 4KP7A 4TXJA 4UEQA 3QVTA 1OQAA 2VAVA 2E2WA 3EC2A 5E2BA 1UP6A 1A0OA 2JFZA 1W5BA 3LK6A 3DTVB 2OXCA 1FYVA 3A3NA 4JT9A 5CTJA 4IRUB 4KLAA 1AUXA 3LA6A 2AG1A 2YINC 4UKDA 1W0KA 2PN1A 1FQOA 1EP2B 1IUNA 2P69A 5F5NA 2G72A 4LFCB 3R3HA 4UD6A 3L0DA 3WMWA 1XALA 2QMUA 3HXQA 4KQKA 4W82A 2WOOA 3GAFA 1W0CA 4LXHA 2FOLA 2CNLA 4TUYF 1VZ3A 4EKNB 1NULA 4O5AA 1EIZA 4RTRA 2G1UA 4F11A 3UFXA 3ONNA 5C7OO 2IYRA 2DRIA 3GJQA 1I0LA 1UBMS 5HM8A 3FWNA 3GLUA 5CVUA 1W4ZA 2QTWB 3IDFA 3IV7A 4TTIA 1TQHA 1NMSA 2FMXA 1W0KD 3SBEA 4DMRA 2DT5A 2Y1CA 5IRCD 1W36C 2D7DA 2BMVA 4HRVA 3CLHA 3GEIA 2IYUA 2A4KA 2N0SA 4RO0A 1PG5A 2Q7OE 4MJ3A 1YASA 1LGYA 5EIAA 4XQEA 2Q4BA 3NXSA 3PFCA 2XCQA 3EG9A 3UKJA 5CD1A 1HFKA 1FXWA 2Q49A 4NS4A 2RHDA 5DASA 4B3GA 1ZOSA 1IXKA 4MR9A 3SYKA 5LP1A 2ZJYA 2SKDA 4TVKA 4UBKA 1SCAA 1MGPA 3R6DA 4IXNA 1ZRNA 3KWLA 5F33A 4RF3A 2H8GA 1UMDA 5ERYA 1XZGA 4K0RA 4IOKA 1TJ5A 4FLFA 4RS4A 3CPJB 3VSAA 4QC2A 2OM6A 4FEAA 2GETA 1ZZEA 1H66A 2YXDA 4G36A 1W29A 3DFUA 5BRJA 2O48X 5FHRA 1C9DB 3WMGA 2Q6LA 4Q34A 2CLMB 1EK2A 1DDGA 3KJQA 1C3XA 3N6VA 3K9LA 4ENSA 4XCQA 5BPHA 3FPLA 1ZJYA 1JJVA 2I4IA 4KRYA 2CXUA 4CM6A 5LQSA 2ZE5A 5F76A 3VDNB 4H1VA 3KYDB 3LUFA 2O4CA 1R4NA 2AWOA 3HEBA 4RAQA 4ETNA 1Y3IA 1YA8A 5KWVA 1KEVA 2VHQA 3RYHB 3J7AC 3LCJA 4K6HA 2Y2UA 1CRZA 2WU3A 4GOMD 4AYTA 1HQYE 2HYDA 3IO5A 3ND8A 1SCDA 1T3LA 4OXXA 3MWFA 6PFKA 3HB0A 3R8FA 2IYVA 3SQWA 4GOOD 3PTLA 1VC2A 3MTIA 3WQHA 4BMDA 3MINA 4NMLA 4MB0A 1C7QA 4UXIA 5D6NA 5I9SA 4AP9A 2E4WA 2ZW9A 2HTEA 2VP6A 1B3RA 3P97A 4TPKA 4KPEC 1E2QA 1AIPA 2C8VA 4HMOA 3R23A 1MFZA 3TL3A 3D3QA 3NCHA 1TJPB 3CWZA 3GEBA 5LB2A 2HT1A 1XZQA 1YZGA 3QJYA 3M5PA 5J5CA 3FJYA 3QPVA 4QXPA 4GSLA 1YS2X 1LS6A 2GA9A 2ZTVA 3ZEAA 5CDFE 2IEIA 5AW5A 4FDTA 4RXUA 5JSUA 2G17A 1IM2A 3EPKA 4BLQA 1J5PA 4IHKA 2HA3A 2QNBA 2EJUA 2YFYA 3JD3A 4I9HA 3TW4A 4YV7A 3C15C 1GAQA 4MHTA 4PHFA 2B94A 4GFDA 2QW1A 2Y92A 3MVEA 4M46A 4A1FA 1VIMA 2GR9A 1G41A 4B7UA 4BDSA 5COAA 2AA3A 4BV2A 5JI2E 4C08A 5L3SA 3GNSA 4UBIA 1JFSA 4EGSA 1XZDA 2LWIA 4JR0A 2YMLA 2QG9A 5DBEX 1GHTA 1EVIA 4NDAA 3O8LA 5G0SA 5AVUA 2BE9A 1GT91 2IYWA 4Z8YA 4L28A 4CMIB 1YB2A 3P9CA 4ERXA 5FUXA 3SZGA 5FQOA 4PNHA 1ZK0A 2OCKA 3OM8A 4YDSA 2F3QA 5TF0A 1C9EA 4I1OA 3TLYA 3PR3A 1Y4UA 3K0SA 1FDSA 1RM4A 1SIWA 2Q0XA 2BL4A 3QEKA 1C9MA 3PE3A 1QZUA 4CF5A 4YJ3B 2C88A 2ODTX 2WZDA 5KYWB 6ABPA 4MITA 1QRDA 1ZG3A 1LLUA 4QX6A 3HO1A 2J0EA 3BREA 4POAA 5LLDA 1P2TA 2ZVQX 5KSPA 3RK0A 5JUWA 2HHLA 3LLVA 3ICCA 4TKZA 2CF5A 1W6UA 3KSUA 3UT5B 3FVWA 3EY9A 1LBIA 3CZQA 4I50F 4OHZA 3KQUA 4TL9A 4HL6A 3SM3A 3EEOA 3AHJA 4TT3A 2PO7A 3WMRA 2IBMA 1YKGA 5J2TA 2AB0A 1YZVA 1S7GA 1UADA 5FLKA 5DBHX 4UNQA 3M81A 5G02A 1MXFA 5HBGA 3DBLA 5ENVA 1CRWG 3QVOA 1FSGA 3QLUC 5LMNB 1V9CA 2BR5A 4J0CA 5B6PA 2PQ2A 3NAZA 4LHZA 2IDJA 5DIFA 2Q46A 5DWVA 3B52X 3VO1A 3OIDA 3Q7PA 3K9QO 1T5IA 4X6YA 2NV2B 5EWLA 5FFNA 4C4RA 3G59A 1EDOA 1Z4NA 3G3EA 4NBLA 4BAZA 2QDKA 3CMMA 2DWQA 2G80A 5A3JA 1FTGA 4WK2B 3BFPA 3FYUB 2OXIA 4QELA 1QUFA 2UZ1A 1Y48E 2C3PA 2WTMA 1UKCA 2VDWA 2HUNA 3WGYA 1WXDA 1QKKA 1T24A 4E2WA 1O4WA 5CJJA 3HMKA 3O8BA 3ILYA 2V7GA 3GJXC 3R3VA 4HZIA 1TTTA 1IHDA 1UDBA 4NMWA 4NQZA 4MAFA 2IDZA 5EC8A 1R7RA 3COWA 4HLDA 1IMOA 4B9EA 1V95A 1C4OA 1YF3A 3RD5A 1TCBA 4PC3A 4BE4A 5LCXA 2PKXA 2WWHA 5JC8A 3PUJA 1KI4A 4ZT5A 3T15A 1WB9A 3R24A 4JJIA 1PW5A 1C41A 5CT9A 1CRLA 3BMNB 1YQXA 2D59A 1L4LA 5GJBA 5I9IA 5JJBA 3BILA 3H5VA 3EF0A 1DKPA 1KEWA 1IBRA 4I1UA 4J6FA 3PLNA 3TW8B 4BWFB 4LV6A 4LXTA 3CEJA 1C4KA 1BFKA 5EL0A 1GPUA 3ZU5A 5DBGA 2LDBA 3KXPA 3PITA 4ARIA 3GRAA 3FRJA 2CVFA 3A4LA 3BXGA 1P17A 1E18A 4DV4B 4I8XA 4ZU1X 3ZDBA 3JAWA 3DKKA 3ROZA 4GOLD 4YAEA 2Y2VA 1FOEB 1ORIA 1BAPA 4R8RA 1I7LA 4ZPJA 4A15A 1OLXB 3RIXA 1IATA 1GRQA 2PX0A 4G5GA 4W9MC 4QXRA 3CUUA 1HZZA 2WJ3A 1U0FA 3MTAA 1EMDA 1CJUC 1LTHR 7REQA 1H22A 3FHOA 2C03A 4Y0AA 3OZGA 5KZMB 5L7TA 1QHSA 4Q9AA 1HLFA 4AMGA 1VBFA 2P5