2KLBA

Nmr solution structure of a diflavin flavoprotein a3 from nostoc sp. pcc 7120, northeast structural genomics consortium target nsr431c
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
154
structure length
154
Chain Sequence
SIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAAVDLQELRELVGRCTGLVIGMSPAASAASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDPLLSKFRNLGLTTAFPAIRIKQTPTENTYKLCEEAGTDLGQWVTRDRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative diflavin flavoprotein A 3
publication title NMR Solution structure of a diflavin flavoprotein A3 from Nostoc sp. PCC 7120, Northeast Structural Genomics Consortium Target NsR431C
rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
total genus 43
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2klbA00
1YDGA 1OFVA 2KQUA 3TZBA 5ULLA 4QOEA 5LJLA 3W79A 3B6KA 4LAFA 4YALA 4ZVKA 3S2YA 1AKUA 2BPOA 4Y9UA 4R81A 4LTDA 2HNBA 3ESZA 3L9XA 4C0XA 2B3DA 3NHRA 2Z9CA 5LMCA 3NHUA 4ESEA 2R96A 2QX6A 4Y7CA 4LA4A 4N82A 4PTZA 2Z98A 3W78A 1DXQA 3SVLA 4H6PA 5EMNA 3KEGA 3F6RA 5FA6A 4DY4A 4S24A 4YAWA 4C0WA 2FLVA 3NHFA 6NULA 4GR9A 5FUQA 4YAOA 4M0CA 3KLBA 1XYVA 3R6WA 3RPEA 3FVWA 1KBQA 4D02A 4H2DA 1F4PA 1AHNA 2V5VA 3G5MA 1B1CA 3ES9A 3NHSA 2X2PA 5B3LA 3GFQA 1JA0A 5B3KA 2Z9DA 1WSBA 3D7NA 1CZRA 1AMOA 1TIKA 3K20A 2Q9UA 4NLLA 2RG1A 4N65A 1J9GA 3GAMA 1QBGA 4QOIA 3EYWA 2R97A 1RTTA 2WC1A 1AKWA 4DILA 2Z9BA 1OBVA 3HLYA 5LVAA 2ARKA 1AKRA 4OXXA 5F51A 1FLNA 3F6SA 3U7IA 3FNIA 1RLIA 2QX9A 3OJWA 4FGJA 4ZVNA 3ESXA 5JROA 1T5BA 1J9EA 1CZKA 2BMVA 4QOHA 3NHWA 1XT6A 3OJXA 1CZOA 1SG0A 2FZVA 1OBOA 4NULA 5F12A 1XI2A 1ZX1A 2MT9A 3KAQA 4YAFA 5FX2A 4ZVMA 1J8QA 3NHKA 3NLLA 1FLAA 2BN4A 2GSWA 5EAIA 4J8PA 3GFRA 3OWXA 4GI5A 1JA1A 3FX2A 3N3AC 2XOEA 4LTNA 2QMZA 3NHJA 3K1YA 5BUCA 1NNI1 3W77A 3QFCA 1YOBA 1AKVA 3QFRA 1YCGA 5LLDA 4U7HA 5NULA 5F4BA 3W7AA 4C76A 4QOGA 3N3BC 1BU5A 4FX2A 3L9WA 4F8YA 3OWHA 1SQSA 1ZWLA 3TEMA 2V5UA 1V4BA 2A5LA 4HS4A 2D5IA 1FLVA 2QR2A 2HNAA 3FW1A 3JSXA 1X77A 1FTGA 4CETA 1H69A 3F2VA 1FLDA 3F90A 2OHHA 2V9CA 2M6RA 1XYYA 1J9ZA 3OX1A 3FJOA 4PTYA 3GFSA 1CZLA 1D4AA 2X2OA 5TGZA 1RLJA 1CZNA 2MWMA 1QHEA 1YRHA 1CZHA 2N1MA 4YAUA 4LTMA 3U7RA 2OYSA 3O2NA 4QOFA 3ESYA 2FAXA 4GQIA 1AG9A 1C7EA 3OVMA 1GG5A 4ICIA 1BVYF 5NLLA 2FCRA 3B6JA 3HA2A 2OHJA 2ZKIA 2W5UA 4BMPB 2FZ5A 1VMEA 1I1OA 1ZWKA 2MOKA 5LBUA 1WSWA 2MTBA 3ZHOA 2HPVA 4C14A 4FGKA 4Y9RA 5LBTA 1TLLA 1AZLA 2QWXA 3NFRA 2FVXA 3O73A 1QR2A 3EDOA 4N9QA 2QX8A 3QE2A 3N39C 4QOJA 2BF4A 4HEQA 5EA2A 5LJIA 1FX1A 3LT5A 2F1OA 4ZVLA 3UXEA 1RCFA 4CF6A 3NHLA 2M6SA 3KAPA 1AKQA 2KLBA 3B6MA 4QODA 3OX2A 4YQEA 2AMJA 4XDHA 1AKTA 3LCMA 2QMYA 1FUEA 4XDGA 1CZUA 2OHIA 1FVXA 2XODA 4DIKA 2FOXA 3NHYA 1KBOA 2QX4A 3TE7A 1T0IA 3OX3A 4FGLA 3P0RA 3HR4A 4U7FA 4U7GA 3B6IA 1YCHA 1DXOA 5A4KA 4PU0A 1YCFA 2FX2A 1D03A 1DX9A 1H66A 1C7FA 1YKGA 4BMOB 2Q62A 1QRDA 3NHPA 2BZSA 1E5DA 3UXHA 1D04A 2FDXA
chains in the Genus database with same CATH superfamily
3H5AA 1DQNA 4JEIA 4KJXA 3IRVA 2AE1A 5IZCC 2LPMA 1T2DA 2P5UA 3KQUA 1K5DA 2FSVA 1S8FA 3KB8A 1YBMA 2QRMA 3L7LA 4HGYA 1HDRA 3RC9A 1V16B 3NWEA 4DZRA 2DHDA 3BREA 5LB4A 1URPA 1W5BA 4EPXA 3RS9A 3MTEA 1YV9A 4NCBA 5DF1A 2QTMA 3QEJA 4J0EA 4TKZA 1V6SA 3WHPA 3E9NA 3JQ8B 3SS7X 2VNJA 5CNJA 2Z6AA 5ITVA 1MVNA 2ZBDA 3CYFA 2IZOA 2GCPA 3GEIA 4L7VA 2PMKA 1X94A 4NTZA 4RMHA 1XXHB 1P62B 3UCEA 1L3BA 3VOSA 2FMUA 3WQQA 3CLRD 5EJIA 4B33A 1LSSA 1B8VA 4RKQA 2OCKA 2EFDB 4RE5A 5DCUA 3FWZA 3N74A 2GAJA 3RT1A 1NVGA 3CMCO 3TE6A 4J0GA 1QQBA 1KQPA 1E1LA 2ZT6A 1KIFA 1CEQA 2F9FA 1DAKA 3GRUA 2Q8PA 3HBAA 1FDTA 2WF5A 3QYPA 4OP3A 4BX0A 5IDXA 2NNLD 3OE5A 4AECA 1W581 2Q3FA 4O29A 1I0ZA 1CW2B 4EPVA 4DR3B 3GRFA 1EJ0A 3Q7RA 1J8DA 1Z29A 2H7XA 2R65A 3F4BA 4INPA 2NPOA 3BB1A 4HZGA 1IOVA 1G18A 4M0DA 3W78A 4RK0A 4B8WA 2WYVA 5K0GA 4IMJB 2JZCA 2IXGA 3EMKA 5ELLA 3VZCA 2XT0A 2CHUA 2C2KA 2Q5IA 1SPBS 5AVWA 1S4QA 3WJAA 2QAGA 2GERA 3F6RA 4KXUA 1SUSA 4NBWA 4ZMBA 2B8JA 3CVWA 2Y8EA 1LDGA 2QG6A 1GD1O 3KEMA 2VHEA 3DTYA 5CYFA 4DY4A 1FMCA 4Q4HA 2C2XA 4QGAA 3RG8A 3UJ3X 3OF2A 3QK7A 3A6PC 2IYVA 2OOSA 1O0BA 3VISA 1ZJYA 4KKXB 1QIDA 2CL5A 1JE1A 1TM5E 1U1DA 2C2ZA 1XRJA 3KOUA 3EFHA 3V8EA 4C4ZA 4TMKA 5CB8A 3USCS 1PT8A 3V1LA 4H3KB 2I2XB 1GQQA 5HW0A 1VL6A 5ADVA 2ZS9A 5LFAA 1L7VC 2BHLA 3IELA 4OJNA 3FJYA 4OIFA 4XWKA 1H85A 3OI7A 4N0EA 4HT3B 2R1UA 2Y1XA 2AG6A 2Y05A 1C30B 1YMUA 1LBTA 2Q9AA 4BO3A 1UMCB 2G83A 2ZSIA 3BIWA 1XRPA 3AFIA 5INTA 5JZOA 1MG0A 1VECA 2GK3A 4AW9A 1VE9A 3IPYA 2MSLA 4G1UC 3O0DA 3W3AA 3JWIA 1G20A 1N2CB 1YJ8A 4JNCA 4OSPA 4ZEXA 1E1MA 2WY2D 4EEZA 2XE7A 2WYHA 2WU8A 1JB1A 1U2EA 5JQGF 4UU0A 1F8GA 1UBJS 4TTJA 3QX9A 1S2DA 4S1PA 3GVIA 5IT0A 4E1VA 1CJVC 1L8LA 4TWZA 3L41A 2QSYA 3EA4A 3KFXA 4JZYA 1MO3A 1NBWB 1EFVB 3I2KA 1AGRA 4RPKA 3UV7A 2HMAA 1NMYA 4OREX 1Q7RA 3Q11A 3QVSA 5AVRA 3HDQA 3K6KA 3IP8A 3ZCSA 1ONSA 3NETA 1A5TA 1CYEA 4ZKDA 1PHRA 2J5KA 3GJ5A 2VUHB 1AHPA 3A1FA 1R6VA 4F5EA 5CB0A 1JIVA 3GEDA 2ORYA 3CUTA 3RS3A 5LXTA 3KKNA 1ODKA 5DLDA 2ETXA 1LPOA 3N8KA 4TMZA 2P65A 2KWIA 2OCYC 3PUVA 4QYSA 4DIEA 5H68A 4BO7A 4WBNB 5GINE 3NDPA 3I1JA 3N87A 1PK9A 3P2IA 2P1RA 3B5JA 3H9CA 7GPBA 1LSUA 1P9WA 1RD4A 3EN0A 1PE0A 2YYAA 4WEQA 4RMIA 4ZI7F 1MQAA 5TE9A 2WWIA 2NX2A 4DLZA 1Y8CA 1AUQA 3QUCA 1WF6A 3IERA 3RKUA 5EYPB 2X2EA 5B1EA 1E9DA 1TA9A 3TVYA 2OCXA 4L5JA 1T8UA 2EWWA 2ZYTX 4QFMA 4LF6B 4PZAA 4WACA 2Z9BA 2ESRA 1Y8ZA 1RBQA 5G0WA 3W3AD 3PDJA 1Z2CA 2FN7A 3EUEA 2BRUC 3ZWYA 4V0NA 1NXWA 3DJYA 4INOA 5KVSA 1XV5A 1UMBA 1WL8A 1EFPA 4AN0A 1RLTA 2D0PB 1P33A 4BBJA 1J8YF 4CG3A 3TTYA 3GLFB 3RJZA 4XWGA 5FFNA 1W88B 4UEOA 2CKDA 1XJQA 5L3VA 1OX4B 4Y2SA 2ZITA 1A8PA 1N8SA 3KWJA 5AVSA 3S8YA 2FEMA 3WV4A 2PH5A 5MGNA 2DYKA 1C1XA 1CKEA 2HK7A 4LGMA 2H1VA 4RF5A 3LX8A 5A4FS 3B1JA 3EGEA 4DRXB 3ZJVA 1B76A 2J46A 3B1ZA 3ND8A 4EJMA 5IZ4A 5GTDA 1SXIA 2QTZA 4LY9A 4D3FA 3OH8A 3WL6A 4ARUA 5IJ9A 5JWOA 2HDOA 4KG7A 3UENA 1DUIA 5ADUS 3NHWA 4ROTA 5LP6C 1XT6A 2FSPA 4AWBA 4EG1A 2AMYA 5EIBC 5IN4A 4IDCA 1DIOB 4O6VA 4MIEA 3ZGOA 2JH9A 3AXTA 1SOMA 3DB2A 5AR1A 3FMVA 4J9UE 4RPHA 3ZVRA 4N48A 4PXAA 1NATA 5KCZA 3L6BA 1SO8A 4WECA 2IFTA 4DBVO 1V5GA 3AEZA 3WRYC 1AMNA 1OZGA 4XX0B 1WCIB 2P27A 3QZUA 1YTUA 4QELA 1A82A 1K75A 1KY4A 1B23P 3OTGA 4MGZR 3KJNA 3PXAA 3QVJA 2I4LA 3KAQA 4AG5A 1YZVA 5CVDA 1E20A 1AKMA 4FGZA 4EW2A 1SWWA 5I5EA 4BXOA 4B34A 5FPSA 3BWEA 1TCUA 4PQFA 3HI4A 3AF2A 2PUTA 1SXQA 4ZYTA 4X6LA 1WU8A 1DQZA 3DV0A 1NNUA 4FFRA 4L6CA 3W8NA 1Y6RA 1C9EA 4PYKA 4CV0A 1O8BA 2QJWA 2GT1A 3KYCB 5H83A 3WYCA 1XDWA 4J94A 4REQB 1H2XA 2EGHA 2BFFB 1YQGA 2VG8A 3LC0A 3INTA 1GA6A 3Q7TA 4X1IB 1U8ZA 4BLWA 5BSEA 5C46F 4RD2A 5HHTA 2XADA 3TLBA 4Z0HO 3MHTA 2G71A 2WWRA 3PZRA 1VJTA 1Q0PA 2L0XA 3ZK8A 3X1MA 3RTGA 1UH5A 5MN6A 1CR6A 1L1EA 2V6FA 4LCBA 5FTNA 1KY3A 3IODA 2EKQA 3BH6A 3O94A 3OTQA 4KIGA 4CTNA 1JSZA 2JRCA 2OLJA 2Q3CA 3AUAA 4MR7A 5GV7A 1VCOA 5A3QA 4CQMB 4AXXA 1I3NA 4M6WA 2C2MA 2P0YA 5JQWA 1PV4A 2WIKA 3HZZA 1Z4JA 5AW4A 2I55A 2O7NA 2CXTA 3VHXB 4PHFA 1FTSA 2FWMX 4OO3A 3N2EA 1XTZA 1XZBA 1EINA 3G3EA 2HW8A 1BGXT 1RP7A 5COBA 5BYJA 3N3BC 2WSIA 2XKJE 3RJ9A 4NHEA 3M3HA 5AKEA 2DUMA 3WZ2A 3UGJA 3AEQB 3T3GA 1N1GA 1FXWA 4LFAB 1ZH8A 2C5LA 3NKLA 2GEUA 1R18A 4PTLA 3W06A 5GJWC 1MQSA 1LPBB 1VHWA 1MORA 2HNAA 3KHTA 4DXAA 2OENG 2BI8A 3E3OA 4DR4B 1KYYA 2Z8YA 3GZTB 4YJ2B 5F21A 3P8ZA 1UDAA 4XOUA 1PD1A 1FJHA 4DQUA 5KIAA 4KXLA 1V3QE 5ANRB 4BNFA 2PMCA 1P7YA 4EKDA 4F4HA 4E12A 1ENPA 1RQRA 2YINC 3F2VA 4IO0A 3PXGA 1NRXA 3DDNA 2NTJA 5LQAA 5EINA 4HH0A 3ORSA 1REQB 4D8XA 2OHHA 4IIYA 2X0NA 2LDXA 2C2GA 1PJ3A 2PTHA 4ZGWA 2IY8A 4ER5A 3EFOB 1PEYA 1OLSA 2WU4A 3LDGA 2QENA 4AY5A 2C9OA 1MMFB 1AXEA 4QQ8A 4DC0A 3GP8A 3CW8X 2OSVA 3AONB 4XYBA 4CF5A 2XIJA 3EBPA 3HJHA 4CTMA 2UUCB 2AI1A 1NI4B 3QUTA 3TBKA 5DISB 4ZTBA 3JTEA 1U8AA 4OKNA 1E6EA 3V7FA 5M2QA 5GAJA 1AIPA 2IDJA 4JLSA 1RYZA 1JFFB 1BWQA 1MU0A 3OQIB 5I8ZA 1ZM9A 4LCEA 3JYQA 4C1NA 1YASA 3CEAA 3TIIA 4PG6A 2G7MC 2I80A 3JZIA 5JXJA 2EFGA 1MENA 1WZ2A 3WGNA 2HRRA 4FFWA 3C3JA 3HS3A 4FNOA 3REQB 2CLLB 3C8ZA 3U56A 2RMKA 4C9BA 2MWMA 2QN2A 1U8TA 2AG5A 4NECA 3FPBA 3G2HA 5ICGA 1N4DA 5BT9A 4BCDA 1TFRA 3UC9A 2NWQA 2YX1A 5G1PA 5DW0A 1QMPA 3BOSA 1T25A 3WL3A 1SD1A 3NVKI 3C3DA 1C8LA 3H83A 4QRHA 3SHTA 5BWOA 4QZVA 3OQMA 2NU6A 3O2NA 4L95C 1YL6A 4JCCA 2BFBB 3IE0A 5DI3B 3CLUD 4C0KA 1ZLYA 4M38A 1GVHA 3IOMA 4HLQB 1INLA 1YL7A 3MAJA 1Q0SA 1ZVJA 1GNLA 5EWJA 3S5JA 4CE6A 1XMJA 2I2DA 2JDIA 4C89A 5KS2A 4JFRA 1FVOA 1P4JA 4RIIA 5TNXA 4QYIB 5HIKA 3PUZA 4GL2A 1AG9A 5AVOA 3PKZA 3VI4B 4H7DA 5D3MA 1S9DA 2W4IA 1PT9A 1RMTA 1RMQA 3OVMA 4JIMA 4LZNA 4MO2A 2XE6A 3D1LA 2BFNA 3DL7A 3HXPA 1AGYA 2BDTA 2COKA 4WOBA 1C9DB 4PCUA 4L51A 3WL7A 1KIAA 4HLUA 4AU1A 1FFHA 3JQFC 4U9IS 2BUAA 2ZPUA 3E7WA 4N0QA 5LBUA 4PIPA 3TPZA 3D54D 2G5PA 3N75A 5LN1A 2PZFA 3OLCX 1O6BA 3VH4A 2IGBA 3ZEAA 4UHDA 2JIZA 4D9JA 5DLPA 1NI5A 2XLBA 2PV7A 5JNLA 2GASA 2KMLA 1XEXA 2QUZA 4KXNA 3VM6A 1Y1RA 1YTLA 2QWXA 1M54A 1EG2A 2O3QA 2RHJA 4MZXA 1U1GA 5B2FA 2WSYB 5AVTA 5TMPA 5CEJA 4GNRA 3KJEA 5I47A 4AKIA 3O73A 5E1DA 1DO0A 3H3FA 4IP0A 2Z6UA 1E2BA 3PXEA 4ZQCB 3MBKA 2GZDA 1MOZA 2QR3A 3GR6A 3N39C 5JYBA 5K03A 3HH8A 1UZMA 4RORA 3EGDA 1R0XA 2Y1EA 3ETGA 4B48A 2HY7A 3B3AA 3CGWA 2PZ8A 4PZPA 3ZLTA 4K9MA 4P9NA 4P7BA 4TV8B 3FWYA 1CLEA 4C6SA 3IUBA 4B3MB 2CF6A 1WETA 2WIDA 3GMSA 3RSQA 5JATA 1OX5A 1NUAA 4CF6A 1MHTA 4E4YA 1N25A 4LOAA 3RC8A 4F56A 3CMMA 2F59A 2FPKA 2CGEA 5B7PA 4AB1A 2C2OA 4MARA 1XHFA 5JMWA 1J4AA 1Z5VA 4NBUA 1HZZA 4TXMA 4P3XA 4H17A 1N2ZA 1Z6TA 3AC0A 4B45A 4AP9A 1B73A 4IGKA 4XTRA 1RKQA 2K2QB 3HBNA 2O3RA 4J4HA 4RY8A 3ZY4A 1GNVA 5B6PA 4M7RA 2JIZD 3OIYA 3F71A 2ZSKA 1CEEA 2JHAA 1Y1LA 4YJGA 3OKCA 2X7JA 1FSGA 1O6CA 5GVSA 4N6OA 1TECE 4GLJA 2G82A 1JHPA 1GTJ1 3FWKA 2X5KO 4HXYA 1NR1A 2B61A 2NADA 2EJTA 2R8RA 3NHYA 1RTKA 4RZUA 1SHJA 5CGZA 4OB6A 2GM9A 1U7ZA 3GT3A 4LPKA 3I92A 5L6LB 3IOYA 4JLOA 2OAGA 4AMZA 3S2ZA 3HYTA 3J7AC 4N12A 5CEFA 4IWXA 3GJXC 2QJTA 3ITEA 2DR0A 1ZA2A 2E37A 3OX3A 5A9TA 1KFBB 3OOEA 2GBFA 5E3JA 1SKMA 4EECA 4EP1A 2CJWA 5AO9A 4WBXC 1P18A 4JYPA 5DGIA 1G3IA 1DXOA 4Y6PA 5FP0A 3CBQA 8OHMA 4P53A 4B4KA 4DZZA 1RAEA 4NHOA 2FEWB 2Z2IA 3TQSA 1PYGA 2B1RA 3UAZA 3J81k 3GLGB 3BXXA 3GGDA 4QOSA 2D4HA 2XDQA 2H08A 3IDAA 3O3NB 5EXEA 3WNVA 2DBYA 2VK8A 4W7SA 2OE2A 4BMOB 5KBYA 2P2YA 1PU2A 1P73A 1RSZA 1RYDA 4JP3A 4WCFB 2W90A 1RLOA 3BH0A 4ZAGA 3H9EO 3PA8A 2WD7B 3HADA 3HKBB 1EGHA 2C4HA 1QIMA 3A9SA 3HP4A 3LPNA 1G21E 1BFKA 3T3OA 4KR3A 4A1OA 1KQ3A 1NY6A 4C03A 3AVWA 1DKPA 4XB6B 4A82A 3R75A 4M7OA 4FLFA 5IDQA 5E2AA 2CHVA 5CXQA 3BN3A 3OOWA 4ND8B 1LI7A 1E0DA 4HDOB 3AEKB 3LQ2A 3HY3A 4MB2A 4FR2A 1GA4A 2I33A 3DBLA 3WR5A 1AKUA 3GC6A 2ZKLA 2XMCA 1KR5A 5F1PA 1V71A 2H06A 2NUPA 1G5HA 3VZBA 1O97C 1XKQA 4Y9UA 5A6SA 2C0CA 1JHUA 1KEWA 4QYTA 5COAA 1YL5A 4G1BA 4DPKA 3J80A 1GPNA 4FMPA 1BX0A 2ZBGA 4QYWA 3A1VA 2P9ZA 4IKPA 2X76A 1QH9A 3GEEA 1VLHA 1P72A 3BRCA 4HZUA 1EZZA 1RAIA 4M9RA 4DDVA 4DUYB 1R12A 2GO7A 4B79A 2VT2A 5IMBA 5IXJA 1NV9A 2B20A 2YWEA 1Z37A 1ZI6A 2NVOA 2EX1A 4E22A 4CR6A 4KYTA 1ELOA 1XAJA 5T7BA 2X1VA 3D7MA 1NXTA 5CT9A 2QS9A 1WCYA 2RAPA 1IJKA 2JLSA 2FG5A 1HH4A 1PZGA 3MXTA 3OFVA 4G6ZA 2YNMA 1QHNA 5CNMA 1EK5A 1LTKA 2GJSA 3I9MA 1TK2A 2D0OB 2W6OA 2Q49A 5CB4A 1GYPA 1K5PA 4PC6A 1BDBA 2J07A 1QV6A 3P94A 3QWIA 4IYRA 4PBRA 1PL8A 1XF1A 2WIGA 3KJGA 1EVIA 1F1JA 2KBEA 3CTPA 1WM1A 2O14A 1Q19A 4DLRA 2SKDA 2F8TA 5TVKA 4PAQA 5CH8A 3UYKA 3X43A 2GN4A 2XRZA 2L19A 3KEQA 1EBBA 1OFHA 3STHA 3ZD9A 2W58A 1WJGA 5FJJA 4I8IA 5B4UA 1DS6A 3BJRA 1CP2A 4Y1RB 5TEVA 2X1LA 4INJA 3QNMA 4RTKA 1A1SA 4P32A 4UM9B 1M6HA 1Y6JA 3B3GA 3NAZA 3O2JA 4CCAA 5A7FA 3H8SA 2WV9A 4OHVA 2Q4EA 4UBJA 2FWNA 2XGOA 4WT7A 4DADA 4JLJA 3ZCVA 2Z3ZA 4L4XA 1VL8A 4CRWB 1IY0A 1PJ8A 4X93A 2VUUA 4KO4S 4ZKEA 3UGQA 3DNFA 3CS3A 2HIMA 3TZEA 4D02A 5KHOC 4WKPA 4IUBS 1C9KA 1QS0A 3I4FA 3KDPA 4A8TA 4DMHA 3MWKA 3S70A 1PEDA 4BY9E 2DEUA 1PNTA 1ZOOA 3HRIA 1EDEA 3IAXA 4A73A 4IEEA 2IHZA 3K1AA 1DJOA 1IZ8A 3T5PA 2PLWA 2XMPA 4ND6A 2ZZMA 1DWOA 4OK5A 1SQGA 3ZY3A 2WAOA 1NN5A 2W71A 3NDJA 1W49A 1M1YB 1WY5A 1ZK1A 4OMFG 4H0CA 5GJBA 2FR0A 3PNQA 4AKGA 2Z9DA 1YR7A 2DHRA 4HK4A 2I3ZA 4UCWA 3DBHA 4C22A 3P1JA 1UM9B 2PYIA 2OD9A 4LMRA 3QLVC 1NQ5A 1Z0DA 3AJAA 1AQLA 3E22B 4N7RA 1NHGA 3N0VA 5K6TA 1VJ0A 4OHFA 4A36A 1PVOA 2E85A 2AUMA 4X3OA 5TSDA 1AS2A 1Q21A 3E3MA 1F17A 1PTJA 3ICPA 3V8VA 1HQCA 1QF6A 4MVYA 2A1UB 2CDRA 2V45A 1P1IA 4U9UA 2JFPA 3K9BA 4MYSA 2ZJFA 1S96A 1T8WA 2W43A 4TS9A 1Z39A 2R1VB 1RXYA 4YGYA 3P2JA 2Z43A 3TD6A 1XCJA 2IYAA 3Q9UA 4MPPA 1EFAA 2W6MA 2FK8A 2LBPA 1UK7A 2SICE 3AVQA 4OQNA 1M2NA 1I32A 3EDRA 1NVBA 1PO7A 2IK8A 3K8QA 4CL8A 4E3WA 1WXGA 2GK4A 3C1OA 3RS4A 5KTOA 1WPQA 2FCAA 3UCXA 4TYNA 2P6OA 2Q1XA 1LU9A 1R7RA 1VGRA 2PMBA 2W9XA 3QP9A 1H6CA 4BUJA 2JJYA 1TJ3A 1E5QA 2EZTA 5E95A 1SIOA 1Y7PA 1M8JA 1GGHA 2BUBA 3RU2A 4RC9A 3PDIA 1DLIA 3TAUA 2C04A 4RZXA 2RGRA 5K0TA 3V48A 1PLLA 1Z6XA 4NS1A 1QPBA 4MV7A 4BZWA 1UXKA 1LD3A 5HIIA 3RSSA 2GN6A 3SKVA 3GJSA 4JLVA 4NMMA 4X90A 5J9FA 2RHHA 3DMTA 4D74A 5C0OE 3CKMA 1ECFA 4I1UA 5EXSA 4P92A 3RS0A 1C0LA 4MJ7A 1RXVA 4K7JA 3UGTA 4H4CA 3N6VA 1FDSA 1KKMA 3ANSA 3IXQA 4YJ3B 1XJWA 1Z6GA 4QBGB 4U8GA 1P3Y1 1GAJA 3EF0A 5GPBA 3TJMA 3NH6A 1H0RA 5HM8A 3GLIB 1J0AA 4I3GA 2GZ1A 4YLEA 1F5SA 1EWYA 3PHGA 2IDKA 2PRSA 3M0EA 1TPYA 3B13B 2XMSA 3ODGA 2NIPA 3ROQA 2R25B 4JYBA 1RNLA 4JQOA 2MYPA 2BR5A 3K4PA 3ZD6A 4EGJA 4RV4A 4DGSA 5AVJA 3ANNA 4BQIA 3W8EA 1V1RA 4HBZA 2QD1A 3LY5A 1DSSG 2D3WA 3QU9A 4BQRA 3PGKA 1L7EA 2IHVA 3HU3A 3NASA 3RDPA 2ECPA 2FYTA 2BKAA 5TDHA 2EFHB 4EW3A 2A30A 4DV3B 2REXB 1U3UA 5HUJA 4M9ZA 4ZOBA 4D81A 3AIIA 3F6YA 2CD9A 3HJAA 5LZ9A 2IH4A 1BXRA 1G5IA 4ZHQF 3E27A 1A7KA 1NQOA 1R0BA 3NIBA 2IHYA 4ZREA 1CE8A 4FKBA 3RE1A 3EXHA 2IKSA 4DQKA 5KZMB 1FNBA 5CFOA 2W6QA 4JEHA 3P0JA 1L7PA 1X39A 2ISSD 2PWPA 3PJFA 5BSVA 1HF3A 3Q5GA 2VPIA 2X58A 4C3VA 4QTYA 1U4NA 3K94A 3OC0A 2XOEA 5FADA 4CLHA 2QMZA 4COOA 1XPUA 2AFHE 1DDGA 4WA7A 4I66A 5ECDA 4CU2A 4D9IA 1AV7A 4EVRA 3G85A 3HM9A 4LF9B 3QTTA 4XIYA 3BL5A 4WVLA 3A9VA 3G2LA 4Q24A 2OLEA 2C7OA 3RSFA 1YB2A 2IW1A 4HEA1 3VZPA 2Z2JA 4DXDA 4Z4IA 2CFTA 3HBJA 3DAHA 3M9WA 1G66A 3KHUA 2PBLA 1UJ2A 1JXAA 4DLWA 3JARB 4BZPA 3GVHA 3QVVA 2IY9A 1L5WA 3TLEA 5ABPA 3L92A 3L2OB 2I2CA 4EVQA 3V8PA 5JT1A 1YQEA 3UN1A 4ANFA 2EYQA 3OF5A 4ZT5A 5EUCA 4MEBA 5CR9A 1SULA 5DMHA 3PJRA 4BX9A 3CIFA 1LLCA 3DC2A 2ZYRA 3V4RA 1A5ZA 3A1TA 4MVJI 4D92A 4A91A 2NMVA 2ZYGA 1SXJC 4EKGA 1OV6A 1BWRA 1DJPA 2CYBA 4P3YA 2P2LA 5FUVA 5BPFA 1I30A 1ZXXA 1M1NB 2ZB7A 5TQ0B 2QXTA 1DX4A 3R6GA 3SJAA 1LJLA 2GZHA 4W4TA 2X8JB 3OEHA 4LRWA 3I04A 3VSDA 2QIOA 5JNTA 2OCIA 2IL1A 2IT1A 3WIDA 5FUBA 4L75A 2G5TA 2EKPA 1SEVA 3TWOA 4EY6A 5DCLA 1YI8A 1QFXA 3H9GA 3O7MA 1M8PA 2A5YB 1DAIA 4AZSA 3WNZA 1AUOA 3VJLA 3MQFA 4E0BA 4EHJA 3OM0A 1HTWA 3KT3A 3ETJA 5DN6A 4I3FA 4IQGA 2VK4A 3UK6A 4POOA 5HP4A 3ITKA 2WK1A 5LYJB 2EAUA 5H7XA 1XD9A 1QJCA 1CR2A 1U3GA 3GIDA 2JGAA 4RLHA 2ET6A 3CNEA 4MWCA 3VO9A 4D9BA 1L7OA 4KGXA 4XUGB 3DFFA 4PO3X 2H1CA 2HCBA 2HT6A 4ZXFA 3B5IA 4K9OA 4BGIA 2VK1A 2JC3A 1RAHA 1PSDA 2GAIA 5AW8A 1E4EA 3A1WA 3LQQA 2A0FA 2WE7A 3CHYA 3FJOA 4RY9A 2O8NA 3HCEA 5ENVA 4ER6A 5HKKA 1F2DA 1JNXX 5FAKA 3HWRA 5DXFA 2X40A 4PCLA 1PFWA 4BWFB 2FW7A 1UOEA 4BVBA 4FSXA 2X4DA 5EMHA 1M2OB 4GECA 4XWOA 4TV9F 5BPHA 1Q0ZA 3NTLA 1J2JA 5D7NA 4KQCA 1UK8A 2NM0A 4RYLA 5JAIA 1F48A 5BQ5A 7REQB 4MWBA 3RVJA 3CINA 3D0QA 2ZU0C 3HP1A 2O2SA 4M55A 1DUVG 4RLSA 3D3JA 2G9NA 4OGLA 3C74A 1GCIA 5C8VA 2FRVA 4L8GA 5IJ0B 4Q82A 3OLWA 5C8DA 2N1MA 1W44A 2D1SA 2HQ1A 1F2TA 4Y3UA 4LTMA 4AMVA 1DMRA 1LRKA 1C2TA 3N0RA 2XGJA 1ZOPA 1NQVA 3QELA 2Z83A 1XZ8A 4QOFA 3T41A 1QH1A 2MIIA 3LP5A 1K08A 2P7HA 4N5LA 5FEUA 4RMNA 5I9BA 1WMDA 3U7GA 2GRUA 2EZ8A 2VQ3A 2E49A 3OCCA 2Q41A 2JATA 2ZR7A 3FNEA 5CT4A 4JEUA 5H02A 4P33A 4D25A 5IH7A 1QDUA 4DDWA 1QV9A 2UZ3A 4I6JA 5BN5A 1QRUA 4UUPA 3KL4A 1D2HA 3LO5A 2DSTA 2PT7A 4I9HA 4M1YA 4U7WA 4DCUA 2NXWA 1GLNA 4N3GA 2R8BA 1N2HA 2AG8A 4US2R 4GOKA 3A10A 3KAKA 5KVVA 2GHRA 3K0EA 3R9XA 1X7ZA 5EQFA 2O6HA 2QB5A 4QBIA 4WGGA 3NUGA 3FDZB 4KO2S 5T4EA 4M0KA 3DUFA 2YFKA 3QU5A 3NIDB 5JLAA 5HKKD 3EPLA 4TZTA 4IDHA 3HBFA 3Q3JB 3CLRC 1LFDB 4LRSB 4AG3A 3UF0A 4X54A 5C52B 1F0PA 1EDZA 2A7XA 2CVPA 2GXUA 4I1YA 4TXNA 1RIFA 1LGYA 3L3BA 4BEBA 3F8SA 1XTPA 2C4NA 1DP4A 1JG6A 1KKLA 1P2SA 2P0AA 3FWHA 1U2ZA 2AEMA 3I0NA 4WJZA 4YMWA 3VZSA 4Y9RA 2HB6A 5REQB 3ZHYA 5KOHB 3EGOA 2LIPA 3Q1KA 1TLLA 4YC7A 5LBTA 4ZYXA 1QVAA 1GFWA 1ZD5A 5HMMA 5TJHA 2PMFA 1H65A 5EP4A 4ZZ3A 3IT3A 2J67A 5K4HA 4ZD6A 3AGPA 4JT2A 4BLSA 5JZBA 3BTVA 5AP9A 5AHWA 1PS0A 1LI5A 5BW8A 2UU9B 2AGVA 3UT5B 4YIHA 3RYFB 4E70A 2PL3A 3PKJA 4MGEA 4MWEA 5K3DA 2WILA 5DV9A 2QAIA 4JP1A 4MRMB 3FPEA 2IF2A 1X1BA 2IOYA 3PWSA 3G1TA 3CX3A 4UW9A 3JQAD 4BX8A 5FI3A 3M2TA 4PQRA 3ELYA 3GF4A 4H60A 3KELA 1IBMB 4II2A 5E6RA 1IQ0A 1W93A 3SE7A 3UXEA 1N32B 2FI1A 3NDRA 621PA 3NTVA 4QTTB 4HEHA 4NZMA 1V95A 4QUGA 4IF4A 5EKDA 3UHFA 5LD2B 1AKQA 4J49A 2RJ3A 3AF4A 4JBHA 4TWJA 2SNIE 1Z4QA 3BMQB 8GPBA 1I5EA 4EJSC 3EXG2 4ZZ1A 1C3EA 5BT8A 3KSRA 1T1GA 3U1TA 4Y8VA 4LSGA 4BTEA 3DULA 5EL0A 2D5BA 4B3FX 2JIMA 4QXRA 4YRZA 3RK4A 3CR3C 1PNVA 3V2UA 4BDSA 5IBPA 1A9SA 3WRXA 1OXBB 4WXRA 3DF7A 3C7CB 5T8KC 1Y4DE 1GZ3A 3OU6A 4JENA 1OZFA 5KU7A 1G59A 2IBTA 1P9RA 3WGVA 1UPUA 2GN9A 4GE0A 3HB4X 1NBEA 5K8TA 4ENVA 2ZUUA 3E84A 1HL7A 4YYEA 2NU7B 4LYHA 4V1CA 2F2TA 3U3ZA 2OC4A 1KZGB 3QXJA 2G4VA 3FKSA 1LBEA 2FW6A 2QAGC 4FCCA 3IP5A 3PEFA 4YQYA 2P6MA 2Q2NA 1S8OA 3FUVA 2FZCA 5FBRB 3VHQA 4RKRA 1S3SA 5KNLA 2VTBA 2HHCA 2GPSA 4LV6A 1TAUA 3OICA 3LOUA 1PI3A 3NEYA 1RZRD 1IG3A 4I6GA 2A92A 1BTOA 1ACLA 1YUNA 2CXUA 1ZHFA 3ABOB 5CLHA 4DQXA 5A02A 3A4TA 2F9LA 3PPXA 4MQEA 4OQQA 2B1JA 4NDZA 2OA0A 3D3EA 1M6NA 1DJNA 1L7AA 2FX2A 2GJ8A 1CJCA 1XZJA 1DQYA 3WMFA 4MPDA 1L6RA 1X8JA 4G0QA 3F5QA 4RA9B 4WA8A 3RTDA 3NRCA 2QK4A 3L0PA 3CBGA 1JN0A 3BGVA 1XZKA 3KKZA 3LUAA 4XSGA 1USKA 1G5QA 3JD4A 1C3VA 4UARA 3T1VA 2UXBB 1RZUA 3W1EA 4ER7A 3SEFA 5JAHA 3IAUA 4L8LA 1KHTA 1M66A 2CMFA 3Q3CA 3MWEB 1F06A 2C03A 3VNRA 2X0DA 1WXQA 3HJBA 2ERXA 3SDBA 4A10A 4ISCA 2IYXA 4E4TA 4FE4A 3O8QA 1SHKA 3B2QA 1ZI9A 2OCPA 4YRQA 1Y9EA 2ODTX 1G17A 4EY7A 1KSJA 1YGPA 5G4KA 4A5OA 4YCBA 3I09A 3P9NA 3BUSA 5CW1A 3WQRA 5KKAA 2VQFB 1CUGA 2DBZA 2X8WA 3CQ9A 5E1OA 4PHCA 4NOKA 4HQLA 3X0DA 3DFMA 2V8BA 3BRWD 3M1AA 2FW0A 3TRKA 1E3IA 4GZLA 1PW5A 4BN5A 5AW1A 2WWWA 2LXNA 1W5FA 5CK4A 3O8OA 3CB2A 5J2TB 3JAWB 4HAZA 4J2TA 3V42A 1V1MB 2GBGA 2REBA 4R8KA 2AK2A 3QEOA 1I6MA 2ZSUA 2A9FA 4P7KA 3A2NA 1CUXA 1DOHA 1YR9A 3LUPA 1LVUA 2JKZA 4ZVQA 2EQAA 3ZWXA 2CNDA 4RESA 4J6EA 5G3ZA 5KNDD 2LR0A 1W36D 1P9OA 3S40A 1QE0A 4Y2XA 4ED9A 2C84A 1A3CA 1NF8A 4RA6A 4KN9S 1G16A 2XUKA 3H86A 3FOEC 1N3BA 3D8SA 3T7EA 3E9EA 2Q3EA 1CDEA 1CRWG 4BWVA 2IE8A 4LI3X 3CPEA 1DIRA 1FTYA 2AQHA 2H1RA 2YWBA 2I6GA 4FOSA 4RD6A 4YS6A 5KYUA 1R8YA 2W6IA 3NRBA 5I4BA 3NWOA 3UG7A 5KQLA 1NBIA 3GPBA 2NXJA 2POCA 3M5PA 1MKYA 3BWYA 3IIKA 3O74A 4ALNA 1SQ0A 3QMMA 4ZRDA 2C7PA 4H7FA 4PSCA 1Q16A 3QOXA 1NA5A 2YW9A 3H84A 4EYQA 2WWYA 3ONEA 2BH9A 3ESBA 3K72B 2FG7C 5AW6A 1CY4A 2A78A 2H1FA 3BHIA 3P19A 1B41A 4DNOA 1XQ1A 4CV3A 3A6EA 2CV0A 4XVCA 3CF4A 3U62A 3V5NA 1DC7A 3UK2A 1HY3A 2FU5C 3SBDA 4TQ9A 1ND6A 3H8JA 4D4LA 1NQXA 3MGGA 3GA7A 4Y2RA 5C1DA 1BN6A 1Y3DE 2Q45A 3GGJA 3MMPA 2I03A 5JJCA 3G9XA 2A4MA 3I6YA 1DTEA 1FYWA 3I32A 1M6WA 3MMNA 2ZT8A 1FX0B 3H2IA 4UZSA 1YJQA 4B6RA 4B8ZA 2XUOA 1YZKA 3N0XA 4M54A 1Q2XA 3JALA 1S01A 4WVFA 3U61B 3D5EA 1GCGA 3H5LA 4ILEA 1G21A 1C1DA 2QVCA 3CKKA 4HQ0A 2QLTA 4QXMA 2R11A 1Y3CE 3O90A 4P84A 4X97A 1ZN2A 3NGXA 3SKYA 5AVQA 3CNOA 4ARSA 2XRMA 3WI7A 4TRMA 1FNCA 3ON5A 1I24A 1Y7TA 4Q9AA 5JO9A 1I4EB 3WK7A 3HXMA 4R9VA 3GFQA 2OORC 3NG1A 4L4YA 5B6IA 4RPIA 3WLKX 5AW7A 2CN1A 3PGXA 4D9FA 2FFBA 2XYRA 4TZ0A 4OY3A 2K7FA 2ZIXB 5GM1A 3OZ7A 3ZWCA 2W2OA 3F6BX 1SCAA 4OHWA 5K45A 2RBEA 2FH5B 1UBLS 4PNPA 3CURA 4Z9AA 3LCVB 1N7HA 3RTCA 5JD6A 3DZJA 1OGYA 1B8PA 3U4AA 1CK4A 3WLPA 1LSOA 5A0TA 3CRMA 3ZDAA 1KH1A 1EIZA 3UPDA 1JFRA 1FPQA 2YHAA 1S2MA 1GTMA 4U2CA 4W1QA 3P2MA 5ES3A 4A3SA 3VHRA 4QO8A 1P7WA 1UKAA 1SQFA 1ZO8A 3L6DA 2GEFA 2C54A 1XQ9A 2DQSA 2IDMA 3TF5A 4MKHA 3PDHA 2GNOA 1W2WB 3IPXA 1U90A 4YLGA 1H6DA 2A6PA 1PQPA 2EG9A 5T6BA 2L18A 4BMYA 5GIOE 3MUFA 1MD9A 1MJ5A 2JAWA 3EQ8A 1MFZA 2J9ZB 1N0WA 3QOFA 3VOAA 1ORDA 2HQBA 4KIWA 3RYHB 3H42B 3TH5A 2ZBRA 2FPGB 3MT7A 1RI3A 2TS1A 5TRTA 2DPLA 1LSJA 4DDUA 5LVAA 5DM0A 1Y89A 3ZE2B 1IZ7A 3C3KA 1AN0A 5DTJA 2HM7A 1OFUX 2DKNA 2HBRA 4AZ0A 4FCTA 3SJCA 4QVGA 4L6IA 2QM0A 4BFWA 5KYVA 2OV8A 2NUAB 1G19A 3I0ZA 3A1SA 1V7PC 2AR7A 3HI6A 4GBED 1CIJA 1A9TA 1PGPA 1TB4A 1Z4LA 5E4JA 3UJPA 3EYAA 5FPYA 2BEUA 3T9EA 1KETA 1VSVA 2VF8A 2DKFA 4TN1A 3LDAA 3WYAA 4YHHB 1A97A 4PBTA 1R37A 2VYCA 3ZXIA 1IBLB 2J0QA 1U8XX 1MO2A 3WBKA 4ETWA 4OAOA 1TE2A 1DAGA 1EUDA 2HJVA 2CUTA 2WJ4A 2XB2A 4R0VA 4B09A 1HI9A 1OA1A 2GX6A 1TVKA 2W2KB 4QAJA 3FB4A 2Z4SA 2D1RA 3OIFA 3FDFA 3R7WB 1ZJWA 1MZPA 3HGQA 2IVFA 2QTRA 2H1LA 3QVGA 3AETB 4RJ2A 2GLTA 1YZUA 3RVPA 4E5DA 1K6XA 13PKA 4Q9JA 3ZVLA 1FDWA 2M6KA 5EJGA 4DMCA 4S04A 2BGWA 4LQLA 4B3CA 1DC6A 5BORA 5JQGA 1MB0A 2H1WA 3FZEA 3GNQA 4JROA 2ORWA 2OGSA 1DAEA 3IUJA 1PJRA 4KQHA 5EEGA 5FBHA 1M10A 3NKFA 3T0FA 4F7DA 3RRFA 5I9NA 1RXSA 3J7TA 2XB6A 1P17A 3HYNA 3MRXA 5DWVA 3GLHB 3VH2A 1QLJA 4J0JA 4BKMA 3RC1A 3REOA 4D9KA 3N28A 2W83A 4FMBB 2GPNA 3FYDA 3A6HA 1XI2A 4OFBA 5EPOA 4OP2A 2VATA 1Z16A 3X1XA 2NOAA 1NJGA 4W7IA 5D51S 1IHPA 4E2YA 3A7EA 1TTQB 3HCAA 5DEOA 3TFQA 1THTA 4A15A 1YFLA 2WJ3A 4YT8A 3KYIB 1XMOB 1UXJA 1XKTA 2J09A 2XWJI 3KEOA 1E3WA 2D5CA 5B1IA 4PGAA 5BV1A 5IEJA 1FQWA 4YX9A 2FPMA 3D8NA 4NR0A 1AUPA 3N2IA 3K1ZA 2A33A 4URWR 4UBKA 3R5KA 3K96A 3PR3A 3WSTA 4ZI7A 1IU9A 4HATA 1E7SA 3LW7A 5D5PA 3ECCA 5JLJA 1KDTA 1MFPA 5CDFE 4FYIA 4W99A 4X94A 5BUQA 3T7JA 2JGIA 1I4TD 3WWZA 2WKPA 1BVUA 1ORHA 5B1DA 4BIMA 3S8EA 4MS1A 1RM4A 3KXIA 1YUBA 1A8HA 2J30A 1VIYA 4PVCA 4RFVA 2XVMA 2Z5VA 3WGGA 1E7YA 3TLXA 1UBKS 1USWA 4HB3A 3GNTA 3GIWA 2IZ7A 4Z9FA 3QV1A 3L1UA 2X0EA 2PKXA 3RFXA 3E23A 4CUKA 2IYWA 1BZYA 4IKEA 1EFDN 4WPGA 1LLFA 4X6UA 3NKVA 2AJ8A 4B6OA 4J1TA 1UAYA 2HYIC 4MGHA 4HWTA 5FULA 4YN3A 3QFCA 2GF9A 3ZWBA 2OG1A 3HB7A 1Q91A 1RRMA 3SMQA 4ALKA 1VKJA 5A0VA 5MFPA 5DTIA 4U6NA 2R7AA 3ZW8A 3G0IA 2R9VA 5I9TA 5LLDA 3L06A 2SBTA 3B1VA 4XASA 3RSLA 1UKZA 1WVMA 4WIAA 3RASA 1RXUA 1X0VA 1HC7A 1E1CA 3FROA 4DLTA 4M99A 4EELA 4UTVA 1LF5A 2D2XA 3AHFA 2BWJA 4L0QA 1NVMB 5E7JA 4X64B 1Q17A 1U2DA 1MEEA 1Y5RA 2GCEA 1CQXA 3AERB 3BIOA 3DEZA 3IDFA 3EOZA 1E7RA 3PHJA 4MI3A 3OIVA 5ALKA 3WFZA 4C6TA 3FMPB 4TROA 1RYYA 3ASVA 1D2GA 4B3BA 2GBPA 1SKUA 2O1XA 2RIPA 1RT9A 2IZ5A 5IKXA 5LNK1 3FUCA 1GCAA 2QT9A 2QN8A 1V5WA 3K8OE 3OWOA 2QVBA 1N2SA 1R0RE 1U0HC 2AZMA 2FSSA 2JK1A 2VJYA 4B5KA 1H2AS 3MYYA 1SCUA 4TKUA 4AJLA 3TG2A 1DV2A 3M81A 4XJXA 5CVUA 3QLEA 2I71A 1HXHA 1EU1A 1WMEA 1G20B 3DM5A 2YVQA 2P8JA 4NNPA 5GONF 3BZWA 4IXMA 5JSHA 2Y4NA 5CM2Z 2AYXA 2ZSHA 1KYVA 2VWGA 3LHKA 1K7SN 4H1UA 5AXBA 4OM7A 4QBHA 2M1ZA 4IFEA 2BKXA 1U0TA 6ADHA 4KACA 2Y68A 4MINA 2AX3A 4L57A 4W5WA 4XARA 4XWAA 1TUIA 3T7TA 5LIPA 3IUPA 4A8HA 5CRIA 3LK6A 4TXLA 4XUCA 5A4IS 1I4LD 1ZVKA 3ABRB 5C51B 4P98A 4K1XA 4UHCA 1JALA 3K9LA 4PC7A 1XTKA 4RS4A 3V4LA 2YIDA 1LQTA 2PBZA 1E6CA 3EVEA 1DFIA 3EUFA 4N6NA 4OLFA 4N76A 4Y30A 2P4EA 1NXSA 3LF1A 4CFYA 2EKDA 2JW5A 1RI4A 2YVKA 3WNQA 2H11A 3WK8A 3C4VA 4L8FA 2ZI5A 2CUNA 3I2YX 1I5OA 5G40A 3LOPA 5ESDA 1IWOA 2VRBA 2NSYA 2AFHA 3REGA 4ZYVA 2WEKA 1EUYA 1U28A 4TXJA 3FLAA 4OAQA 4PZLA 4Q7QA 4LVUA 4XR4A 2HHAA 3VR5H 1CR1A 1PK8A 3CVOA 1BYIA 1OBHA 4TWIA 3HHPA 5J47A 1FSZA 3P9RA 3I9NA 3U7RA 1W0JD 3AHJA 3LGXA 4CMIB 1BS2A 3DE5X 4BNYA 1IPEA 3MLAA 5DNUA 4GSLA 1GTSA 3C7AA 3ESYA 3GEBA 4HH4A 3UOWA 1Z0FA 4E6EA 4TS4A 1DUSA 3A1NA 4M49A 1UMBB 2ZWAA 5FKJA 3SXUB 1DADA 1B43A 1JNYA 1KAQA 2NSDA 3S6JA 4B75A 4IR7A 4LZLA 4V2IA 4RTLA 4BQNA 2C99A 1QIGA 5AH0A 3G8CA 2OHVA 3Q9LA 1JVNA 1LVGA 2VAPA 4E5VA 5KHAA 3NALA 1K5GA 1U02A 2Y1OA 3CH4B 4TTAA 3IE2A 2NXNA 3MS4A 1GG5A 3RSOA 1C1XB 1B8NA 3PEVA 2Z0MA 3HMQA 3UXMA 2BR3A 4KXFB 3AOGA 3V8QA 2VYVA 5KYNA 2W42A 4OSOA 4ER0A 3WLFA 4JOQA 1F51E 4ZDWA 2VH2A 1EP9A 3KE9A 3VYTB 1HA3A 3ZBPA 1ZWKA 4YECA 4YUAA 2CYAA 1H1LA 1DRWA 1X74A 3VGPA 3DZFA 4CMCA 1UQUA 2V4MA 4P36A 2P9QA 4YRLA 3EW9A 1IQUA 3GJQA 3O4JA 1AXGA 2HIHA 4HNRA 4KQWA 2B9EA 4LE0A 2PSEA 4E5NA 4O63O 1V0JA 4R3NA 3W9YA 2GTIA 3ER6A 5JSZA 1ZUIA 1ZH6A 3ZDRA 3HPQA 4ZVUA 1Q5PA 2G09A 4BP9A 4QPCA 1W85A 1L5HB 2AEFA 5G41A 4CKCB 2W00A 3CH7A 2E4WA 1II9A 2VH5R 4CNBA 2I4TA 3QE2A 3H1TA 4M0FA 2OSBA 4JEMA 4PIMA 3UTDA 3W1WA 3ZDYB 5SYMA 4PZEA 1EXNA 4QOJA 1DCKA 1EKXA 3BAFA 4CHTA 1OUMA 3I73A 3ASUA 3DV0B 5K8LA 2IYFA 1VHQA 3WIVA 1OYVA 2UYOA 3R41A 1SK9A 5JH7F 5EP3A 4RHTA 3GMTA 3VBCA 3U9SA 1SOVA 5DRTA 2E87A 3GV0A 3IVMA 1P0PA 3QBVA 5EXXA 5LQDA 2VYVD 3T12A 4UUNA 5HF9A 4FXPA 1ZESA 1YRWA 3RYIA 1OLUB 4JYAB 3VKVA 2O4UX 3K6SA 2C7VA 3AR3A 4QJ4A 4RXTA 1PAUA 1YNOA 3TFWA 2PPVA 4ME6A 1QC5B 3HB1A 3I5UA 4HB2A 1FS4A 1L0BA 3DMGA 3D8TA 1Z0JA 4JLAA 3NHBA 3WQBA 1G42A 4XDGA 5PNTA 3V7YA 3AUTA 4MKFA 1NNLA 5B7QA 3REFA 2YHIB 3K0FB 3VR0A 4EY5A 4B3IA 1MO4A 2Y1LA 4G67A 1GZHB 3QTBA 1X3LA 1NLYA 4UXHA 5AI0A 4MR8A 5FT9A 3D6FA 4FNAA 4Q3AA 1WEKA 1KAHA 5GQSA 3UB2A 4U6SA 1FFAA 1FNNA 2RGEA 3AJEA 1I9GA 1YDMA 3KKLA 3P27A 4EO4A 5JMTA 2IHNA 4K9KA 3HXLA 4EDFA 1W8DA 1V5IA 2O5RA 4X7BA 1BFUA 1AKYA 2KW5A 2IUYA 4QRDA 2KPOA 2IZZA 4BQPA 3WKAA 3CIOA 4IOKA 3RVMA 2NSHA 4OQPA 2D0DA 4DT1A 4PLPA 1G2QA 2OKCA 4BEJA 2BGJA 4Z6KA 1FZTA 3U13A 5BV0A 2H16A 2FPUA 3CEPB 4O4JB 4ZVTA 3TGPA 3GT0A 3H17A 4JI8B 3TD2A 4A92A 3IEVA 1G291 1QDLB 1M3SA 2DVMA 2K5UA 3I34X 1T6XA 2CFIA 3OTWA 1EE2A 2ZRFA 2H52A 4L27A 4JVMA 3VDXA 2ZZKA 2QRVA 4L74A 5EIFA 2GLXA 1ML3A 4UPVA 4WQMA 2RK4A 2HUPA 2O3TA 4KXYA 3TTXA 4TMXA 4AS1A 2VRNA 2YXDA 4RVSA 3RAPR 1P29A 3K9FC 4AY2A 2YZ2A 4DV6B 3HJCA 1Z28A 3ZUGA 3GRYA 2J4DA 4XPZA 3LFUA 2IY7A 4FFLA 3UPUA 2IPAB 2C4WA 4Q18A 3MT0A 3P32A 3ZDFA 1L5SA 3A4LA 3GZNA 2GN0A 4YR9A 1PZFA 3CY6A 4PX5A 4CM6A 2BSQA 1H5UA 1VOTA 4J6FA 3PQ8A 3VPCA 3W5HA 5DCYA 4E5PA 4XLTA 5ICSA 5T3YA 3GBSA 2WHPB 3BE6A 2I29A 2PSHA 1JZTA 4I1SA 5K0EA 3FGPA 4JP2A 4DBLE 3VRHA 1A95A 1L8OA 3BF7A 1KS2A 3KTAB 1F4VA 4P4SB 1SQ5A 3G7NA 4B4VA 4MDFA 2REQA 4LTDA 2WDPA 5FA8A 1OXSC 2ECOA 2C0QA 2GM5A 1VL1A 1GA1A 3JRWA 4IDOA 4MVJP 2OHXA 4URUR 2J59A 3UAXA 1W6RA 3C15C 2FDRA 2E4ZA 4FTWA 4ZC8A 4CM7A 5LLTA 1EGQA 1RWVA 3AUXA 3F3MA 4FZVA 4LRQA 1HSZA 2X0KA 3WHLA 1B00A 1QFZA 4Z2YA 5JAZA 3KJHA 3WL8A 4CLRB 1DL5A 2JJ2A 4Q34A 1VJ1A 4TN5A 1K7CA 3D4IA 3ZCUA 2XA2A 4X62B 1QXSA 2IHTA 3DP9A 3EX7C 1ZIXA 2EZ9A 3HGTA 1R16A 3BIJA 4KJZA 1KE2A 1PZMA 3ZGVA 1RBZA 1XB2A 2M98A 1A5SB 1J6UA 3AM3A 1ND5A 4WKNA 5EWJB 1HFJA 4P82A 3WA6A 2JH3A 1GV0A 4JL5A 4YIKA 4XWWA 3AOEA 4WKCA 2Q6LA 2PMWB 5EMNA 3TZKA 1GG9A 1QH0A 3GEGA 2XW6A 3BHJA 3B12A 4LYJA 2VLIA 2EFCB 3IBSA 4KI0A 1XDUA 3LQFA 1RRVA 3MSXA 3ITDA 1FFXA 3K9HA 1O4WA 3ORYA 4RQTA 4YRCA 3T95A 1QYVA 1QAQA 2HLPA 3K6RA 2MJLA 3S2UA 3ZDZB 1MIOA 4PYLA 4ID9A 1IM2A 3RJTA 5AXDA 4YAOA 4FDLA 3LY9A 5LIRA 1W46A 3PLAE 4IZIA 4WCFC 2QN9A 3D4PA 4QSHA 3ZWVA 3AKCA 1CUJA 4NYIQ 3ENVA 5EXPA 4D0SA 1OJ7A 4RD1A 3DMTC 1N2GA 2GN1A 3MCUA 4XM2A 5K99A 1ZM2A 4FS3A 3GH3A 1M2KA 3R4CA 4YRDA 4A8JB 3RPEA 3MBOA 1KBQA 2B78A 2C94A 3EDQA 4ZVPA 4MYTA 1JTFA 3WHKA 3HSKA 2QQ5A 3PC4A 2HDWA 2JJ2D 3LUHA 4H2DA 3ZH2A 1KRHA 3WVNA 1F4PA 4L9WA 1G3RA 2W2MA 1J23A 3SVTA 3MILA 2P41A 3CUKA 4YT4A 3B9RA 5CVJA 1IY9A 1MABB 3S8MA 1KXJA 3DC7A 5C3UA 2D59A 2QLBA 1JQBA 1S89A 2IEYA 3EGDB 5IANA 4DA8A 3A6JA 3AMVA 2NXEA 1P4HA 1VG9B 2PY6A 2OY0A 2VAXA 4OFXA 3ZZ0A 2IYUA 2WT8A 3HB0A 4D4JA 4MVWA 1ZCBA 4LE1A 1DKUA 4IDAA 1PIWA 3DKPA 4KFTA 4TTPA 3VU9B 4UPEA 5DOZA 2I1WA 3SS8A 3RI3A 2P9EA 3BXHA 2YZGA 3MC1A 4FP9A 5IYZB 4UXIA 5L45A 2JIPA 1EUZA 1V2GA 2XTMA 3CF0A 3GUHA 2VDJA 4G5HA 5D3QA 3T3NA 3Q8KA 1O58A 2AC4A 2EP7A 4XDZA 3HJNA 5FUWA 3N53A 1A9PA 2JBHA 5EQJB 2KSQA 4B2PA 4FW8A 4XGKA 1BDMA 4DMMA 2DR2A 1IZ9A 1GAWA 2EL9A 4IX9A 4ZEOA 1ZC3A 3K0SA 1FW6A 1QHXA 2B8TA 3EWIA 4ZCLA 2VDWA 2ONCA 3A06A 3F7OA 3L5OA 4H7EA 4JUDX 5TEWA 4MW7A 3G5LA 3CUUA 3BFJA 4IDGA 1PZNA 4YJGB 3WMEA 3DLAA 1XUOA 1DELA 1E7QA 4EHBA 3RT9A 3D2CA 2H1IA 5A1JA 2HA4A 2ATEA 3L1HA 2R1ZA 3CLHA 4ZI3A 1QAMA 1Q74A 4L72A 1WU7A 4CLOB 1Y6GA 2PWBA 1FVHA 1Y63A 4L9RA 1E1QA 4URHA 4BNVA 4I1PA 4C01A 1ADGA 2GMWA 4Q9NA 3C6MA 2VSXA 5EPUA 5SY6A 4LJRA 4FINA 2P4SA 3BBLA 2MSKA 2JZOA 4RIGA 3QPCA 4QGGA 2RKBA 4UCQA 2GHIA 4ZZ2A 4AYXA 1YZHA 5I3ZA 3TDNA 2OTCA 1NYRA 2OCBA 4IO1A 1X7GA 2GETA 2JAUA 2QMUA 2R6ZA 3QFSA 1KARA 4LZOA 5DI9A 4ETIA 1T9DA 1LQ2A 1YONA 4G8BA 3R7FA 1N5LA 2GVNA 1PNRA 3SYMA 4TL9A 4ZVNA 2IOFK 4GOND 3IH5A 3KR0A 1ZFNA 2VS1A 2PSJA 3FBWA 1T0UA 1XMPA 2P91A 1J99A 3LFTA 4XVHA 2JFHA 4JWTA 1TK9A 3GDGA 3IKVA 1R00A 1WW8A 3EASA 3E3LA 3ET4A 1EJ2A 3DT8A 3M6AA 1TJNA 3MOIA 5LA6F 1E6LA 2FEKA 3H8VA 3JAKB 5KVCA 4KWEA 3X3HA 1SG0A 1V9SA 2MHCA 4E51A 4ZHSA 2E2WA 5JNUA 3ZXUB 1IRXA 2ZROA 3K0HA 1NV8A 3JASA 4OHPA 4W1RA 5B2ZA 1MRZA 4HBGA 3GOQA 3ROMA 3AHGA 2VNKA 3EGVA 1NC3A 4O1HA 3F4KA 1ZOIA 4XFKA 5K0LA 2ZB2A 3HB9A 1EP1B 5KOJB 3LT2A 1ZCFA 3MMSA 5I7SA 3OPMA 1WULS 2R1TB 3I2FA 1V8BA 1E1QD 3VMFA 1IQPA 2BF7A 1TO6A 1TZJA 4O5AA 2R60A 1W1UA 3EAGA 4H15A 4K1LA 4LV5B 5HXAA 3WGZA 3HCDA 4TYQA 1CV2A 1P91A 2WWGA 4YEDA 5H82A 3I3SR 4I55F 1NWCA 4F8JA 1QE5A 3UGKA 4G0MA 3RS5A 2H4FA 2PIDA 3FHCB 4DAOA 1XZHA 4FYWA 4L1KA 4JI7B 4YAJA 4EJ6A 3ZUPA 2BLNA 1U7UA 4WGFA 1NWHA 4KMRA 4EHNA 1BRTA 3IHTA 3STXA 1HFKA 1L7QA 1W48A 3L8GA 2EKZA 4QYXA 3UA3A 1ZMXA 1PUJA 1RYBA 4BE4A 5K0JA 4FI3C 4REMA 3ENZA 3U3OA 4R01A 2IKQA 1WD5A 1Q57A 4QUEA 1LA2A 3STYA 2FQXA 1JGTA 1M8KA 5I7AA 3IDSA 1PL0A 1Q7EA 3C8MA 3D6UA 4DAEA 4JK3A 1W2HA 1XRMA 5JADA 1CUCA 3N8GA 2P79A 1B2RA 5CB4B 2XUZA 1P8AA 2BJWA 3I37X 2J5RA 2W4QA 4OJYA 4UU7A 2V1XA 1K88A 1D6SA 4I6EA 2QRQA 3S44A 3TAHA 4W5HA 1GN8A 4L8VA 3FIJA 1X7XA 3H4MA 2IYNA 3AFGA 3VQTA 3ZDXB 2QR5A 3TFOA 1KOGA 4C4OA 1N5OX 3MLEA 3L9WA 2CLFB 4J4BA 4KYUA 5EE1A 5IARA 5TF4A 2YVAA 4B84A 4F1WA 4DGQA 2N9UA 3TNDA 2V74B 2QSUA 5BSMA 3BD6A 3DUWA 1YBAA 4UBMA 4FOPA 1M7BA 1EE9A 1PVDA 1ESCA 3MUEA 3OFNA 3WYGA 3G1WA 2ID7A 5DSTA 2WW8A 4YMIA 2Y9PB 1XCLA 1U5BA 2FW1A 1PZHA 2ZVPX 3KJQA 5JHHB 1FTGA 2RGYA 1HUQA 2ZS8A 1I2MA 3LE8A 4R1MA 4BNMA 4D6XA 1AKNA 5K3BA 4UHEA 4AY6A 4P3NA 3K70D 1UP4A 4HWKA 4FJ2A 3B5EA 3EQ2A 4D6YA 1PQYA 4X71A 4ZHQA 2DE0X 3DQQA 5KOYA 1ZD3A 3OP1A 1NW5A 2YC2C 3MK31 2FN3A 2OMEA 2H4HA 1HL3A 3NTRA 3BB4A 3C14C 4Z99A 2R4UA 1KJWA 2OZLA 2RONA 1KRWA 3DBHB 1NQTA 1NJ1A 3ANTA 1KPGA 3CJTA 4G0ZA 1W0KA 1TOAA 1DZ3A 1OGJA 1IPHA 7AT1A 2I67A 1MOSA 4I81A 5GY7A 1XCGB 4Q16A 1LVHA 3O93A 5HNKA 1DGQA 5BQ3A 1UM8A 5DTEA 1AQIA 3OIUA 1MEOA 4GAEA 2AQKA 1WMFA 1KJZA 3AV0B 2J0UB 4EZEA 2X7HA 2VCHA 2ZAGA 3UK1A 5F98A 1RC1A 3FYUA 1JQ3A 1TO2E 1S7GA 4J16A 1NXXA 2C2WA 3CVYA 1YUMA 4Q4JB 1JZQA 4GD3Q 3ZGXA 2O8DA 2BFAA 5DK6A 1LX7A 1BH6A 2E21A 3OFND 4KHZA 1XTQA 5HE9A 3VC3A 5CDYA 3WBFA 1U3VA 2QRUA 1Z33A 4HEJA 1J09A 1I3CA 3GJ6A 4AMYA 3RRMA 4YRSA 1T5HX 5EE3A 1O0SA 5C5DA 1JIQA 2JBAA 5IXSA 2PO7A 4EX7A 3PL1A 2OXFA 1QIHA 5CPBA 4Y2YA 4CM5A 4CLDA 4DV1B 3ZJ5A 3WRXC 1PR5A 3TNYA 1T8PA 3G7SA 3NIWA 1CUVA 1SBHA 3GO4A 2AW3A 5AKKA 1UFKA 3MIZA 4OHZA 3QGMA 1J7JA 1JV2B 3I5AA 4RXMA 2PRJA 4KWIA 5EJFA 1LJ8A 1VMKA 1EK0A 2G5CA 3P20A 5AK0A 3UMGA 3R5HA 4BASA 1WNFA 1ZU4A 3GJRA 3P9ZA 4EM6A 3RIGA 1H3NA 2FR8A 2W8ZA 4LWOA 2H5IA 5E6SA 2C3PA 2HZBA 2IA5A 1GGEA 1P81A 3LQ1A 1CVLA 2WU3A 3OQOA 3ZLJA 2HRDA 4F2GA 3E82A 2Q6KA 2IQIA 3MGCA 4LHVA 1QANA 5FL7A 3TN7A 4PAGA 1F8XA 3R0XA 2AC7A 4L9SA 2JLVA 1SB8A 3E4CA 4M83A 1NVTA 3JAMA 4MW9A 4RZIA 1YVPA 2PKEA 4C4RA 1ULHA 1NYQA 3GH1A 1KEVA 4L73A 2MTBA 4NYIR 2DRIA 4B5LA 1H9CA 4AT1A 4DLXA 1IB0A 1IRIA 1CR0A 2WTXA 2G9QA 2R87A 2XUGA 1GRQA 1V1RB 4FGKA 4MYDA 1W36C 2AKYA 1T9KA 1AXRA 2H57A 1PDVA 3VC1A 3RD5A 1GUFA 1FYXA 1EHIA 3DOIA 3H3JA 4GI3A 3W4JA 2GKOA 2O23A 2QLMA 3N2LA 4IHJB 1KP9A 3ZNOA 4E2FA 1Y37A 3MJEA 1BC5A 2RAUA 4J3FA 5IC5A 2O20A 3RCBA 1MLDA 6ABPA 2E9SA 1GPKA 1M34A 3I12A 1JWLA 2I3GA 5FOUA 4TV9A 1U6KA 2JGMA 3AM4A 2Y0DA 3DCYA 3PUIA 2NQ2C 1LF0A 5KEIA 1CRZA 2JAOA 1HMPA 1I2CA 4TZKA 4IH9A 5LMUB 1IXZA 5CK5A 3GFGA 2VP9A 1B15A 3EXHB 2F1OA 1BGWA 1D9ZA 4RGQA 5EP1A 1KYZA 2ZSAA 3LLCA 2GI4A 3WO1A 5AKZA 3UAOA 3BE8A 2HIGA 3KYDA 4HGQA 4RHCA 2IE0A 3OKAA 5J59A 3H1PA 3PFIA 2H3HA 1XAGA 3F9IA 4GWLA 4PWYA 4QODA 5FL7D 4YQEA 4MZDA 3M3DA 3UK7A 1CJUC 1UJ5A 1BMTA 2IHJA 2JIDA 3IEMA 1BRMA 3FYSA 1AKTA 1T3SA 3F9RA 4M1OA 3WGYA 2G40A 3G2NA 3K2IA 3LI2A 1EQ2A 2EX4A 4HWOA 2W6NA 3G0GA 4PINA 2ZUTA 2QMYA 3SQWA 4J76A 1E62A 4W1PA 4CL0A 2AUTA 3IAAA 1YA8A 1ZRHA 4NVRA 5HQ3B 1CRQA 5ALNA 4H1VA 2Q3MA 1T91A 3VTKA 1TL7C 1X1RA 3ZNNA 2GPYA 2P9CA 3EBOA 2XNKA 4GI2A 1TYBE 2IEGA 4U9HS 4DIKA 5LDDC 5LUBA 3L4SO 2GWHA 2VAWA 3CO5A 3PX3A 1I3LA 4KC0A 1JR3E 2P3SA 3HJGA 3TNFA 4EYOA 3A8TA 5LD2C 1QNLA 1YSCA 1Z5UA 3G2OA 1K27A 1QX3A 2X86A 4RHYA 3NATA 5TC4A 1UJCA 1ULZA 2RKWA 3TE7A 4UTNA 3MGBA 1SVOA 1X7WA 4G0YA 5JY1A 3TD9A 1OZ0A 3TMAA 2BFMA 3COPA 4GKBA 2ADFA 5BWBA 3GJTA 4J7CA 1VP3A 1QQ5A 2RHDA 1WNTA 2VJAA 4GZ5A 2VBIA 3VFDA 1WLYA 5CMLA 4YMSA 2I54A 2NLOA 5ALZA 1YCHA 3CKYA 4NIMA 3SR0A 2PQ6A 3HYSA 2QUAA 2IXDA 3HNOA 2QKYA 2W7TA 5D00A 3TO5A 5HSGA 4AYWA 1DG3A 3AYXB 3AUSA 1Y9AA 4BUCA 5C1PA 3DDWA 1N34B 2IYRA 3QA9A 2C1ZA 3IV6A 3V1NA 2R7NA 2ILTA 4NMHA 4NDAA 4O2AF 4Q3NA 2VPQA 3L7AA 4G65A 4BYGA 5GZ1A 4NEQA 3AJDA 3MB5A 1D2RA 1I33A 3TL2A 1LZLA 1PT6A 4MUHA 2PN1A 4A2PA 3PI6A 4QL3A 3CN7A 5IVPA 3DMFA 3KSBC 2RI0A 3ZTWA 2PGAA 1A9RA 3WNCA 1QIIA 2O8EA 2ZJAA 4RW0A 4TL6A 3G17A 2ZJBA 4IRUB 2H4YA 4BKRA 2WTUA 4HDAA 2I3DA 5CG1A 1HYBA 2E89A 4I1OA 5GM2A 2BTEA 2JFXA 4KFSA 3NS7A 4RAOA 1Z88A 4A9AA 1UJ4A 3USES 3SSOA 3HDGA 3ZJ4A 2F43B 2B5VA 4DF3A 1CUIA 5GWXA 3RF6A 4IDEA 3PL5A 1GNTA 3PX2A 2PM8A 1J0EA 1L9XA 1X7YA 4PNHA 3PU6A 1CJKC 1X86B 3DV9A 2QTWB 3PUKA 2XE4A 4O2BF 2HUNA 5AK5A 4LDRA 3QF7A 5CAEA 5JJBA 1A9XA 1X92A 5DIFA 4F4FA 2ZT7A 2XI4A 1HEUA 4HVLA 2FN4A 4YJFA 4C0SA 1F2TB 3ORQA 4KLNA 4PR3A 2C59A 2R96A 4Q4CA 4Q5IA 2CZCA 2AYZA 1N78A 1RKUA 3IAEA 4EG8A 3ILYA 5DX0A 5JSUA 1TXGA 1JQKA 3Q5EA 4OBBA 3CWZA 5LOVF 2BMJA 4FMDF 2ID4A 1EM6A 3CEJA 1UOOA 1FYEA 4G8DA 4KLCA 2HMWA 4WNAB 1FK8A 1YE5A 4B7XA 1RHQA 1MAAA 3T7DA 5KQPA 3RFFA 5ELXA 1PX0A 2CVOA 3MIIA 4LRUA 3OZTA 4YV0A 1PR2A 2UZ0A 3BGIA 2ZIFA 2O2HA 4PWZA 2A1IA 2FQWA 4D8VA 3DBIA 5CDHA 4J3JA 4NXMB 1J70A 1X7ZB 4IV5A 1LV8A 1ODSA 3A1CA 4K28A 4WY8A 4EJFA 2PJUA 4NENA 4KR7A 1KF0A 1MB4A 4K6KA 3SZRA 3WADA 3ONDA 4M1MA 4R1NA 3T9AA 3LWZA 2MINA 3W6OA 1E4VA 3TEFA 2AOVA 2PS9A 4GH5A 4QXAA 6GPBA 1K0UA 2QSZA 1UKYA 1QQAA 3ZOKA 1CLUA 5BRAA 1WQ4A 4I4LA 1DIAA 3OA2A 2QY9A 1BCSA 3UJAA 3C24A 4DEXA 1P6UA 2EBWA 4Q39A 3O2QB 1U2PA 4YO8A 3T7AA 4NEGA 1J56A 1NPTO 1T4CA 4PF1A 1U7WA 4GXQA 4YV2A 3P0IA 3EIHA 2PX8A 3UAGA 1R6TA 2XWSA 4NNJA 2IELA 4UNNA 1XZQA 4WN9A 2Q5CA 3X2SA 1VQ1A 3R3XA 1LPMA 2F64A 3LZ6A 2GTPA 4DMFA 2XCRB 2IZ6A 3HP7A 1ZA1A 2P9BA 5BMVB 1PJ4A 1K06A 1PFYA 3L7NA 2AWOA 4GPIB 4RBNA 1QIJA 4YCLA 4OJQA 3UHPA 3X2FA 1WBDA 3KSDO 3CV3A 4HDKA 2R5FA 5ETJA 3U39A 3ZK9A 3ZDCA 1M1ZA 5A06A 4H08A 4BNWA 2JLCA 5U1PA 1KDOA 4B9EA 3HUTA 2AWNA 1XMXA 1YI1A 2GA8A 4IV0A 2WIJA 5E6RB 3TKYA 3Q41A 3P52A 4E15A 2CJYA 4PIVA 3VX4A 3WYEA 5LU8A 3ZLBA 2K7ZA 4CF3A 4EI8A 3I39X 4FBLA 3NEAA 3L7CA 4HDMB 3CU5A 3VVBA 5AKJA 4FDTA 3V55A 1D0SA 2XVYA 4A0GA 3HYCA 4DBZA 4TMWA 3VC7A 3DL2A 3V1KA 5SYAA 4LNUB 4U7JA 2AA3A 1TEZA 5M5BA 3O8RA 3K09A 4KHPB 1XO1A 4B76A 1Z5OA 1LDEA 3VR4H 1J9GA 3NX4A 3FCUB 3PVSA 4JU8A 4UDNA 2IBSA 2PH7A 1GUBA 3VH1A 2O1SA 1E2HA 3AB7A 3WLOA 1CEXA 1DQRA 3R7BA 4OUDA 3KQKA 3QFTA 1WDWB 3FLMA 4OCZA 3GAFA 3NBUA 3LL7A 4QBFA 4Q9KA 3RBVA 3D7RA 3TJRA 4U0KA 1W35A 5FO1A 1AHIA 5BN4B 4B2YA 5E9WA 3QPAA 5AJUA 5HIMA 4W5JA 4BX2A 1G63A 3ML1A 5EUBA 1KMHB 2AOUA 4KVGA 5EMLA 1U8EA 3KT8A 3GGSA 4PONA 5DBHX 5J3JA 3F6SA 3F67A 4QA9A 4GW3A 4FZJA 2O8CA 1IY8A 4IWYA 2K6GA 4TTVA 1XPOA 4R40A 1JFTA 2AQ8A 2RAFA 2C7BA 3CRVA 1N0HA 1XZCA 3DZBA 1YJ5A 2Y0BA 3ND5A 1KYTA 4Z0PA 3R5JA 4RANA 3KD2A 2BD0A 4YMTA 4E5YA 5EJEA 3TR5A 3TQFA 3GFFA 1FFCA 1CHNA 1UBMS 2HCRA 3M4NA 1IZYA 1Z7YA 1U2DC 2WA2A 3JVDA 4W63A 4MGYR 1LKZA 3L7YA 4MVJG 5KQMA 3DMDA 3NBQA 1ZMOA 4KBGA 5L7WA 1J25A 4QPJC 1L6IA 4IIJB 4BEVA 5HJEA 1WXFA 3TLAA 2XQKA 4EUSA 2RJOA 2JLBA 1YZQA 2VRCA 3ZWPA 4BMSA 2WMNB 4MMYB 2EJVA 5AHOA 2FZWA 4IX1A 1A71A 4O08A 4B6SA 1SA0B 1U4OA 1T24A 1OI2A 3H1FA 2SKEA 3KVNA 2JVKA 2X5OA 3KZOA 4XWYA 3OTIA 2FQ1A 1NRJB 3BWDD 4P83A 5AHRA 3QWBA 4JJIA 5G4KB 3WFJA 1G8HA 1WUTA 2JLZA 2FN9A 2AKAB 3K6JA 1S1MA 3V1TC 4E08A 5FX2A 3N6RA 4IDDA 2ATXA 1YRAA 3LQ4A 3T94A 4NI5A 1PCXA 3VC2A 2GBLA 5KNCH 3AVXA 2R4TA 3C3AA 5CNIA 3RFTA 1QG6A 2BKEA 1F8FA 3N76A 2YWRA 4GZMA 4BJHB 1TMYA 3O8OB 1Q7GA 5B37A 2VDRB 1QGZA 3DE6X 2HIAA 2Z95A 5FB3A 1YZLA 2UYYA 4NJEA 9ATCA 1GSHA 3QKRA 2F1HA 4OF4A 1XNJA 1DT5A 4C06A 4ZFNA 1ACJA 5IEBA 4ZAYA 3SMVA 3QHAA 3BCSA 3NBFA 3OWXA 2WZDA 2EQ5A 1ZIPA 4P93A 4UVHA 4Y9DA 2PUVA 4ABYA 1RJ9A 3AUUA 1F20A 5T67A 3TGLA 1B2LA 1OAKA 1UEXC 4BAZA 4RA6B 3N2KA 3QBJA 1X8XA 3AGQA 2VL7A 2XJ9A 4TLCA 3GT4A 1MUUA 2PSFA 1U28C 3JV7A 2MDTA 1Z4NA 4RHEA 1I7QB 4W9MC 3R5TA 4NBLA 1FXUA 5K8IA 5KYUB 2VRCD 1JT9A 3M2PA 3UBMA 1BDIA 3C1AA 2EYUA 5DT2A 5GP1A 1M8FA 2DPYA 2OBYA 4JBIA 2Y1WA 1R4MA 3QFRA 4NPAA 5D1HA 5K3OA 4BFVA 4AQ7A 3NGLA 5NULA 3OKFA 2ZB3A 1JPNA 4GR4A 3CXRA 2DGDA 2HWUA 3L8HA 4WZBA 3SS9X 3QA3E 1A8SA 3IO5A 5T4FA 4L15A 1STOA 4Z9YA 1X6VA 1T9HA 1IEQA 1T26A 4D5GA 3EPJA 4LSMA 5DXJA 3CM0A 3GN2A 3WP1B 3ZWWA 4C0AC 4M37A 5LQNA 4RWZA 3HYRA 4C05A 1WCXA 2AJCA 2CXSA 4IEIA 1R8SA 3TTVA 3WLMA 1ESNA 2ZAIA 4QRIA 4QJBA 4J2OA 5FV4A 4F93B 1JHZA 4DB2A 2XVAA 5LQJA 3OX4A 4G4IA 3JATB 4G9GA 4XRGA 3MJVA 5ALHA 4GRAA 1HDYA 4X1KA 4G1MB 1R9JA 3IURA 3KR1A 2BCGY 4E2ZA 1QM5A 4KRFA 4QAQA 1C9MA 2V59A 2OBXA 4EPWA 1QIKA 2HU7A 2HH9A 5BVHB 3QE4A 2ZFUA 3ZIDA 2PE5A 2XUPA 1BG6A 4F12A 2PX3A 1BMFD 1P61B 1XYYA 4G5OA 2H29A 1DDIA 1FRQA 2E4AA 2PH3A 2QP3A 1YDHA 2QUKA 3DCNA 4M1TA 4MX8A 4R31A 5LCXA 4JI1B 4CMJA 3UMCA 3WSVA 8AT1A 5JRJA 3W90A 2VA9A 2WM8A 4UUAA 4FQ7A 1S5PA 2Z5LA 4UE6A 1YQUA 1IHXA 2E5FA 2HYDA 3ZTTA 4BV2A 1NMQA 2WSSA 1QYWA 1Z36A 3A3KA 2CLKB 3B9PA 3Q40A 4K2HA 1E6UA 2GR9A 4XB2A 4QLOA 5HG0A 5LQSA 2FUEA 3QYJA 1ZINA 4GP9A 1P0FA 2HEIA 3AXSA 3WK9A 1P39A 4Y2JA 1D4AA 4YCAA 4HNQA 2ZUEA 1GLGA 1OAOA 1TJPB 2WP8J 4H4EA 4H0FA 5BSUA 1QO9A 1O0CA 2O8FA 4AX8A 1RDFA 5COQA 5CX1A 2VCYA 3IRUA 5EC8A 1Q14A 3E03A 1NT4A 1PK7A 3W04A 1YRHA 2D1QA 1G4HA 3HACA 4G4SO 2OV1A 2Y0CA 1MB9A 3GNSA 3Q8XB 4KQMA 4EYSA 4MVJH 2Q1UA 1A9OA 3BL6A 4L76A 1VLQA 4BWGA 2XYVA 1RIIA 2VPXA 3PWKA 4CEJA 3GG2A 1BE6A 1A2OA 1KZ1A 1NLUA 1Z07A 2A5JA 2H2DA 2VJMB 3BMCB 3ME5A 2TECE 4HY3A 1NUPA 1UBCA 4KIFA 4PGGA 4QHTA 2FAXA 3EG9A 1AD2A 5DLQC 2FJUA 5F35A 1V3UA 2KE5A 1P5ZB 3V00A 4AZ0B 2P5SA 2VQ6A 2IP2A 4EABA 5IAAA 4BPRA 1KMIY 3HFSA 4I5EA 3EQ9A 1YS7A 1JBQA 1NJSA 1Z08A 3FCXA 4ZWNA 4YY3B 3MELA 5A5FA 4CQJA 4O2RA 4QDOA 2YJNA 4WN3A 3EGCA 2C9YA 3FHJA 4DYDA 1DZIA 5HZHA 1HETA 1R64A 3SGLA 4G0VA 4UVGA 2V9PA 1JIKA 3UZUA 1F2VA 5FTKA 1VMIA 3OJFA 4R1UA 2HRBA 4G26A 1XDDA 4MHSA 3AIMA 2WSSD 2ZJ7A 5ALSA 1M5RA 4LF7B 2C61A 1IUKA 4KGDA 2GH1A 3HXOA 2F7SA 5GONA 3M6MD 5CD9A 3MEQA 2GZ3A 4B3RB 4K2AA 3PC8A 3VVMA 3CSUA 3VVLA 1TTHA 5J63A 2EEPA 4UHHA 4OTZA 4BRUA 1U2GC 1KERA 2J9RA 2B94A 1JR4A 1QX4A 3NDIA 5D85A 4EPTA 1ZNYA 2CF5A 3TXXA 1TAGA 5SY9A 1WUYA 2YICA 3L05A 3L0YA 2WUDA 3CH6A 2JAPA 3WLAA 2FVXA 2EW8A 1NI3A 1A9YA 2BTQB 2QU8A 2TMGA 2VXOA 3LBYA 4LN1A 3HPRA 1RQPA 2CHQA 5HCUA 4Z54A 2DQKA 4BFXA 3CVXA 1GP2A 3BGSA 2PEYA 3B9BA 2JA1A 4ZAXA 5DHFA 1F1BA 2JL1A 3TDKA 3VNQA 4GRDA 4V0LA 3F46A 4E5KA 2AJBA 1MF7A 5EA2A 4XD7A 4OGWA 5AWFC 4C5BA 1JIUA 2YHSA 1V8FA 4G5XA 1FX1A 4KVZA 2OCLA 1KEKA 2F1KA 1Z73A 3H8WA 5AQ1A 2ZJ8A 2Y3IA 2QG9A 1JEJA 3A3YA 1OFGA 1GL9B 1WF3A 3KLOA 1J20A 2G9UA 1NM5C 4X66B 5H5JA 1UWLA 4H31A 4N3BA 2OM2A 3C5HA 2SECE 1Z4MA 2P30A 2WSMA 4JJ4A 4WASA 4X41A 4WWHA 1YDFA 4BP8A 5JSFA 5F5XA 1TADA 1XEWX 2FRXA 2ROQA 5DB4A 1QG0A 3D3WA 3BEDA 4RTQA 5IZCA 5FV7A 4LE2A 4PC2A 3EPKA 1TYZA 1SBYA 3NP9A 3A0UA 1JT2A 1TD1A 3H1GA 1NR7A 4DCMA 1OKKD 4C04A 2C20A 2XPCA 1X8KA 2GQ0A 1I0LA 4WOPA 1WAMA 1PF7E 2J3JA 1GRVA 2C97A 1OIVA 1GSIA 4GEGA 4NCHA 4FMCB 4QM7A 1W0CA 1ISFA 5G0VA 3ZDDA 3FBGA 3P2YA 1WZEA 2V3VA 4MIOA 1JG7A 4EG6A 1C1YA 2IBMA 2O7RA 3TZQA 4MV9A 1YHNA 2XMQA 2CUZA 3BXZA 2FFJA 4PYQA 2H7VA 2FVYA 3GEPA 4ENSA 2SCUB 4UHJA 1BHSA 3HA5A 4TQAA 1QZZA 3FMOB 4DWVA 3CNBA 2PGJA 2PKWA 2VT3A 4X5OA 4I9GA 2BBOA 2ZYDA 4F91B 3CVJA 1XN1A 2HQSA 3I1FA 3CCBA 3H2BA 4HEA6 2IS1A 4XD7D 4E1AA 3IMGA 1ZD4A 1K8YB 4C6TB 2CBZA 4YUXA 4O8ZA 1ZNXA 4LBZA 1UPTA 4Q4DA 3VR6A 1N7GA 3ISJA 5E4FA 4BLOA 4RHXA 3BQ9A 4DSUA 3V4OA 4UOZA 5KVAA 5A4KA 2W8BB 4ZRMA 3C97A 5FHRA 1TIBA 1VJRA 3CW2A 5F77A 4HNTA 4D1YA 3GUYA 4MLPA 3VDRA 4N9WA 4DVJA 4X6XA 2I1QA 2ZYIA 1Y1QA 4A2QA 2ZU6A 2YS6A 2H17A 4BNXA 3U5TA 1I1HA 5JVDB 3U16A 1W4ZA 4FIDA 4GZ6A 3RVRA 4JUIA 3V2GA 5P21A 2QRPA 3LHSA 3TSCA 1D6NA 4C3ZA 3EUWA 3RRYA 4CHGA 4N40A 4HOYA 3VTFA 5LZ2A 5JH7A 4OV6B 5B3AA 2WJVA 4ENTA 4P7FA 4F8EA 3DEYX 1YC2A 4I19A 1OWLA 4P58A 4WBNF 5JOQA 3UWSA 4MA5A 1T15A 1TKRA 4CKWB 4U0JA 2QZ9A 2CLIB 1WABA 4WW0A 4H7PA 2XOXA 5EEHA 3NVMB 5JU6A 4R8RA 3FN4A 3MJDA 4D9MA 1A1VA 5G2OA 2GPWA 3L7IA 4LQCA 5EGSA 3QMPA 1OAAA 3MWFA 4I1RA 4MV8A 1AK9A 1G8JA 1ZP6A 3VTZA 2BEKA 4R1TA 3TL6A 1W5EA 2O54A 2Q21A 4MQ4A 3VR6D 2Q0SA 5DYIA 3OQ1A 3KVVA 1GDDA 3I8XA 1TK3A 3RRBA 2NVBA 4NV1A 4Q3DA 3Q15C 3R7DA 2BM9A 2P2ZA 2WTEA 1Q0HA 3WRWA 5SICE 2CHGA 2HXGA 5LMCA 4GOLD 3NHUA 1OJLA 3IQFA 2AD1A 2I1VB 2YV4A 1TLFA 1J8FA 1OFTA 5ALPA 3TOVA 3NAGA 4ZZIA 1NPDA 3GYBA 3PG5A 5CG2A 3UIEA 4JU9A 1JR3A 1N8KA 5HF5A 4E03A 2Z98A 3MTBA 2WWVD 1SR8A