2KLBA

Nmr solution structure of a diflavin flavoprotein a3 from nostoc sp. pcc 7120, northeast structural genomics consortium target nsr431c
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
154
structure length
154
Chain Sequence
b'SIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAAVDLQELRELVGRCTGLVIGMSPAASAASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDPLLSKFRNLGLTTAFPAIRIKQTPTENTYKLCEEAGTDLGQWVTRDRLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative diflavin flavoprotein A 3
molecule tags Oxidoreductase
source organism Nostoc sp.
publication title NMR Solution structure of a diflavin flavoprotein A3 from Nostoc sp. PCC 7120, Northeast Structural Genomics Consortium Target NsR431C
rcsb
total genus 43
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2klbA00
4NULA 3HLYA 3UXHA 2OYSA 1YKGA 1OBVA 2HNBA 2HNAA 3D7NA 3JSXA 1RLJA 2GSWA 1DX9A 4ICIA 3TZBA 4YAUA 3UXEA 5ULLA 4D02A 1FX1A 2QMYA 1KBOA 2BN4A 1AKQA 1ZWLA 4S24A 3U7RA 3L9WA 5FUQA 1BVYF 3FJOA 3O73A 4YAFA 5JROA 4XDHA 4DY4A 3FNIA 1D4AA 3NHJA 3NHWA 1AKVA 1FLNA 1XI2A 2Q62A 3NHKA 4CF6A 1J9GA 4BMOB 4R81A 5B3KA 4HS4A 2FVXA 4QOHA 2KLBA 1T0IA 2QR2A 4LA4A 1ZX1A 2FLVA 3ZHOA 1OBOA 5EAIA 5LJLA 1CZRA 1CZOA 1J8QA 1DXOA 1YDGA 1D04A 2B3DA 3NHRA 4QOGA 3B6JA 2R96A 3SVLA 3F6SA 2MOKA 1RCFA 1I1OA 3F90A 4LTNA 2XODA 3KAQA 3OVMA 4H2DA 1B1CA 4XDGA 1E5DA 3K20A 5EA2A 2QX8A 1FLVA 1DXQA 1AKUA 1CZKA 1AG9A 1QRDA 1SG0A 1RTTA 1FLAA 2V5VA 3KEGA 2ZKIA 2M6RA 3GAMA 4DILA 5F51A 3KLBA 1AKRA 4Y9UA 2N1MA 2BPOA 1CZNA 3NHPA 1H69A 3TEMA 4QOFA 2W5UA 4LTMA 2F1OA 4FX2A 3B6MA 1AHNA 3HR4A 5LBUA 5F12A 1X77A 3OJWA 4J8PA 5TGZA 2FOXA 4ESEA 4YAWA 1YCHA 2OHJA 3ESXA 4QODA 5LJIA 1KBQA 4C0WA 3K1YA 2MT9A 2QWXA 3O2NA 3OX1A 3GFQA 1YCGA 4FGKA 4HEQA 3OX3A 4ZVNA 4NLLA 1C7EA 1FTGA 1RLIA 2BZSA 4GQIA 3OX2A 1WSWA 2R97A 1CZHA 2XOEA 1F4PA 3FVWA 1JA1A 2Z9BA 1D03A 5NLLA 2FAXA 2Z9CA 3G5MA 4C0XA 2QMZA 4YAOA 4ZVMA 3GFSA 5B3LA 2V9CA 5FX2A 1YRHA 2M6SA 3LT5A 3TE7A 1J9ZA 1FVXA 1NNI1 1GG5A 3FW1A 3HA2A 1JA0A 3QE2A 5LMCA 1XT6A 4QOEA 3P0RA 1J9EA 1VMEA 1BU5A 4H6PA 1V4BA 2RG1A 1SQSA 5EMNA 4LAFA 1CZUA 2HPVA 2Z9DA 4ZVKA 6NULA 2FZ5A 2FDXA 3U7IA 3EDOA 1FUEA 3FX2A 1CZLA 3QFRA 1WSBA 5FA6A 4YALA 1FLDA 4U7FA 4ZVLA 5NULA 4Y7CA 3NHSA 4Y9RA 1H66A 3OWHA 3B6IA 5LVAA 2FX2A 2Z98A 3GFRA 3F6RA 1OFVA 3NHYA 4N82A 2OHHA 2KQUA 2MWMA 1TIKA 3NLLA 1XYYA 3W77A 3B6KA 4F8YA 4C14A 1AKWA 3OJXA 5A4KA 1TLLA 1ZWKA 1AZLA 4N65A 4BMPB 3KAPA 1YCFA 2QX9A 2AMJA 2QX6A 3R6WA 2A5LA 2Q9UA 3RPEA 4FGLA 4DIKA 4CETA 2BMVA 4U7HA 4QOJA 3LCMA 5BUCA 4YQEA 3NHUA 3S2YA 3W7AA 2FZVA 1YOBA 4PTYA 2WC1A 1XYVA 2FCRA 3N39C 4GR9A 2ARKA 1T5BA 3NHLA 3QFCA 3ES9A 1QBGA 4GI5A 4U7GA 5LBTA 1C7FA 3ESZA 4PTZA 2V5UA 4PU0A 3W78A 3EYWA 5LLDA 5F4BA 2BF4A 1QR2A 3NHFA 1AMOA 3L9XA 4LTDA 4N9QA 3F2VA 2MTBA 3W79A 3N3BC 4M0CA 2OHIA 1QHEA 4FGJA 3OWXA 3N3AC 2QX4A 4OXXA 3NFRA 4QOIA 4C76A 2X2PA 1AKTA 2D5IA 3ESYA 2X2OA
chains in the Genus database with same CATH superfamily
4RK1A 3W8DA 2QLBA 5K6AA 2C4TA 1YKGA 3U7RA 4GPEA 1PTKA 2AH5A 1ABEA 1IFXA 1SUSA 3NXKA 4S12A 5DT2A 1L5GB 3N7TA 3KLOA 4TL6A 4DEXA 4A5SA 2JGDB 4NAUA 2AX4A 4KIJA 1H1DA 5D85A 4ZPXA 4JHLA 1KRXA 2NSYA 2BT4A 2X9NA 1JIQA 4MRSA 4N8DA 5F77A 5GY7A 3UJCA 4OATA 3FIJA 3PL1A 4GWLA 5KU1A 3DE0X 1XF9A 2EIXA 2VYFA 4GBJA 3GLFE 4Q4AA 1H5QA 2QRVB 4RKRA 3A6HA 5TQ2B 1ZM7A 3ZWAA 4XVCA 2JLZA 3A14A 5EQJB 2ZIAA 4RPCA 3WJ1A 1DEXA 3IJEB 3LQYA 1RMYA 2G3YA 1PL8A 1JEDA 1GQYA 1XOIA 2HU7A 2HU5A 2GZMA 2ZSUA 3LA6A 3LW8A 3QVGA 4LKOA 4K6GA 1E4OA 1EK1A 2EYUA 2ZTSA 4PAQA 2XWPA 5AVYA 1U7OA 5DCLA 3T1YB 1L5WA 2LRHA 5EJEA 1UM8A 3GMSA 1R5BA 2C5LA 1LDEA 1G8SA 4LTMA 8ADHA 2ZYVX 4DF3A 1MIHA 3A1EA 4W5HA 3PYXA 5KYWB 4M2LA 1NYTA 2JBWA 4HAUA 2AE2A 1X2BA 1XTSA 3HVRA 4BXOA 2QSZA 2BIFA 2J5BA 3L7JA 4G1CA 5KNLA 3F73A 1A1SA 4G6ZA 1QO0A 4KDRA 3KD2A 4IIDA 1F4PA 1AF4A 2QR5A 1DZIA 1GNRA 3TDNA 3ZY6A 3DBHA 2AHRA 1TF2A 3FMPB 1QXSA 3GRFA 3I9NA 4JUDX 3DMTA 1T8YA 3EC7A 2AMFA 3PB3A 5AUOB 4WUVA 4YTEA 3CG4A 4FYYA 3AEXA 5HP4A 5KTSA 4EP1A 1VMEA 3K2IA 3LUHA 1V4BA 1E1CB 1X7WB 2ZJOA 4NQRA 3FWKA 3NBFA 4Z3KA 4ER5A 4KP7A 1UXIA 1IULA 1JJVA 1G18A 2VK2A 4XYLA 1TVCA 2RI0A 3EVEA 3H3JA 5EP4A 2L17A 3T0FA 5HM6A 5I9SA 4PZDA 1CP3A 1QIHA 2WAMA 4OM8A 4GOLD 4N5LA 4NESA 4I7EA 2X0EA 3IA7A 4NTZA 1NUHA 3IXQA 2C97A 3X1YA 4M1YA 2WMDA 3TPZA 4L4RA 1H6DA 1L7OA 3FFBA 4GKVA 2ZUBA 4BP1A 5B7NA 1ODFA 1YK1A 1NE7A 4TXJA 3GQVA 4FK8A 4GRDA 1U6IA 1P0IA 3DBLA 4KFRA 1K66A 2VK8A 3K31A 4UZFA 1E60A 2P4HX 3H5IA 3KZVA 4GP7A 1X7WA 3C16C 1MC5A 4U7HA 3TIIA 4F8EA 5FCDA 3ZLVA 1NURA 2X7XA 1GNVA 3A0UA 2AFHA 4L4YA 4KKVA 5EZ6B 4KCGA 4EO4A 3ZW7A 4M55A 1EZ4A 4KXQA 5I47A 1E5VA 1XQXA 2EKBA 3CRVA 5LBTA 4HFNA 1YFLA 2D0OB 1JLLB 4ZOLF 1E20A 2MSEB 4Z49A 2Y2UA 2PJDA 4YJ2B 3REFA 1F51E 1UEJA 4EKNB 1NX6A 3L77A 2C5AA 4ARAA 4HB3A 3TNLA 2PD4A 2AQHA 5B6JA 3W7BA 4ZJZA 2ZM6B 3S81A 2CGEA 2X8WA 2XGGA 2ZT8A 1AKEA 3BIFA 3GJ8A 3FLAA 1Q11A 1V25A 3JARA 1QB8A 1XP5A 3KFLA 3NUZA 4NULA 1O95C 2JBHA 4X7MA 3T3DA 4R3WA 8GPBA 1W5TA 2ATEA 2Y1CA 2H0RA 3JVIA 2Y05A 3VC7A 2EFHB 5C53B 4M9CA 4CW7A 3ZGVA 3DNPA 1PEAA 1XRSB 1MJFA 4JELA 4MQ5A 2C3MA 1RYYA 4OP2A 4US0R 2Q3MA 2I6XA 4JBXA 1E5LA 4OB6A 4R6XA 1WPQA 3JQ9A 1YFJA 3LUBA 3IUNA 3FFTA 4FGUA 4KQXA 5FPPA 2Z8YA 1KGSA 2DT5A 4E7PA 1EXNA 1GZ7A 4X6XA 3UY4A 2JGFA 3KVRA 2PL5A 5F7OA 1KRHA 2B3DA 3WDMA 1EP1B 3K0CA 5HR5A 1PP4A 1ZP6A 4BC0A 2XKAA 5T8KA 5TQVA 4LTNA 3HO6A 3D5TA 3RKRA 1JB1A 1L5MA 3BD9A 3THSA 5D3ZA 3KQOA 1USUA 2PM8A 3UFXB 3T7DA 3IXMA 1IN6A 1UBKS 2FWMX 3OJ0A 2BTEA 1U8UA 1KEUA 4DA7A 3FPAA 4Y98A 1R8QA 4X20A 2B1QA 1RYEA 2GT1A 5HZGA 5SY9A 4P0QB 3CUEF 4XYBA 2FSUA 1QJCA 2ZAMA 5IXJA 5TX7A 4DV4B 2IEGA 4NZNA 3F5FA 2C4HA 4HYEA 2JGDA 3LW7A 4OHWA 1QGED 4ZJUA 2HMSA 2EX4A 1K0FA 4I4IA 4F06A 4I9HA 4KGVA 4HVCA 4AY4A 1SQ5A 4OSPA 1K8XB 4NP6A 2GM4A 1MDBA 4KC0A 4QEZA 2IYFA 3IPCA 3I04A 3R3YA 1G2PA 2PGIA 5FX2A 4WV3A 4D82A 5KTMA 4F5EA 4ZREA 1U8XX 3G2IA 2D1RA 3GFVA 4BJHB 2AUTA 4P98A 3L82B 1JWAB 5IC5A 1JECA 1XT6A 3CVOA 4KVZA 4ZOLB 1EZZA 1ESEA 4DIMA 1NUSA 3WK8A 2I4TA 1CXZA 1UMBB 2RG1A 1RYDA 5H4GA 1JLLA 4UHDA 5JH7B 1CFJA 3KXKA 4QUJA 3SZRA 1E5QA 3G2KA 1TAQA 3PLNA 4BO0A 3TJZA 2GXSA 3SC3A 5GADl 1Z5WA 2EWMA 2GN2A 3CYFA 1CEEA 4JU9A 2YN2A 2XPCA 3BTOA 1G9XA 4LZAA 4GPIB 3G0IA 5C18A 3DM9B 1HL7A 2WPNA 2N46A 3AP3A 3VHLB 5JCXA 3O3NB 5K99A 2E4YA 2OUIA 3RJ5A 4BMNA 2FSFA 2G82A 5A9TA 1NBMA 1YZUA 3Q7EA 4PHFA 2DECA 1KJWA 4MRVA 4HRVA 3OTIA 1ABFA 4PTLA 1XFDA 5HBGA 2EATA 4UMDA 1CUSA 2WUEA 3VZQA 3WNCA 1IN5A 3U2QA 5JADA 2QX6A 2A5LA 3ETJA 1RPAA 1OILA 3WMEA 1YDFA 1TOAA 3RUDA 2ZSKA 2ORVA 1V3UA 4RTRA 4BWFB 4QBGB 2ZRBA 3BMQB 4RL6A 4L0QA 4S1TA 4TTQA 3IB3A 3UG7A 3UGQA 1R0RE 4PXAA 4TTPA 5EC8A 4BV2A 3IO3A 5TPWB 3ESZA 1LBHA 1TT7A 1DX6A 4Q4AB 1T5SA 1P39A 2VP9A 4HMQA 4BFYA 1K92A 2X4LA 3SYMA 1K5DA 1CRZA 1I6LA 2GPYA 1FRZA 2O8DA 1O87A 5DI3B 3MYYA 4Q9LA 2BHNA 3WGMA 3ER9A 1JTEA 1HDZA 1ZOOA 2Q46A 3BDIA 4IIXA 3NT5A 1JLRA 4JSTA 4Q4HB 4DRXA 2J5KA 5ED4A 4QUKA 4RESA 1UMDA 4PX2A 3UOWA 4DAOA 3G1WA 2G9RA 1UJ5A 3N59A 3V8MA 4F4JA 4LBVA 3OPNA 1SVLA 1FNDA 2Q4OA 5ALFA 1BDBA 1OWLA 1USIA 2RGAA 3UTDA 1AF7A 1M83A 1S1CA 2R6HA 4G63A 4RZQA 3PR2B 4FIZA 2RJNA 2NGRA 4RPJA 3G3EA 2IDZA 2IEDA 5FOUA 5I3ZA 1QE5A 2ZYHA 5JAIA 1T0IA 4KXNA 1JQBA 4G36A 2BGNA 4PGGA 5CT6A 5HM8A 1YDGA 1PHPA 4OI4A 1PEDA 3QLJA 1QCZA 1CRLA 1Z5ZA 4HXFB 4YWHA 4JLKA 1DAOA 1RCTE 4H1TA 4JC4A 4QJIA 5ALZA 1E5XA 3WQBA 2DKOA 4XVHA 1SBZA 3SF0A 3TGWA 1SVSA 1F0KA 4PAGA 4R8MA 4PYNA 4CDNA 3U0VA 2A0XA 2HA4A 5FUXA 4FUTA 5F51A 13PKA 1ZRSA 1GKKA 2CFIA 4LWOA 4YRGA 2TMKA 1LTHR 4LGCA 5CM9C 2JVKA 5HCUA 1O96A 3C8DA 4CTOA 3L7MA 2C0QA 1HE8B 1ID1A 1VTKA 3HQ4O 2HRDA 4YPFA 2CV2A 3L0ZA 3NQ41 1J2TA 2OHJA 2QRKA 4PHCA 5KYUB 1Z8NA 3RROA 4C0SA 1J7KA 4PINA 1MO5A 4MVJF 1ZCAA 3IKJA 2XCRB 3ZVKA 3WO1A 1E7RA 1DQPA 2I4RA 3CNEA 4M4SA 1K3FA 3I6BA 3NIFB 1JYSA 2FPPA 3KTFA 4IRMA 2HHLA 2NW6A 2O5RA 3GROA 1NIPA 4BB9A 1XZBA 4W8GA 5ER9A 1XEFA 3FLEA 5GQSA 3AMVA 4DA9A 2IDMA 2VF2A 4EMSA 5LZ9A 2XVYA 4L5CA 2DHEA 1ILWA 1LEHA 4LNUA 1WB5A 1PNOA 1VBMA 2VBIA 1P81A 1JFFA 5BN4B 3RVJA 2DETA 1KMMA 4AJLA 5KO2A 5FR2A 3DFMA 2X3FA 5C8YF 4OHVA 5JY1A 4HXGA 1HT2E 3ZHRA 1QYDA 4IVNA 3NC4A 3Q8KA 1ADCA 2OO7A 5BSMA 3SIXA 4AZSA 2HQ1A 5CK4A 2NSDA 3NV9A 4TYNA 4I1PA 2HT1A 3JRWA 4Q9HA 4ZGBA 4QRDA 4JUIA 4GL2A 3QJ5A 3H11A 2OGUA 2R48A 3OPMA 1KJYA 1PI3A 3WLTA 1A2OA 1Z83A 2C7OA 2MWMA 2Q7OE 1QV6A 2JEZA 3A6LA 3JYHA 3O4JA 4QQ8A 4URFA 1TF5A 2P3OA 2W0MA 5JSKA 4INJA 4D9EA 4DLRA 1BH6A 4BX3A 3U9SA 3ADBA 1JR2A 1L8AA 3TZ6A 2D59A 5E4JA 5TJ9A 4E2WA 2WVJA 1YMUA 4YX9A 1H3NA 2C9YA 2JLAA 4YJFB 1H6AA 2BYTA 3H2KA 1YO6A 1IWOA 1W85A 2DY0A 3EY9A 3PXDA 2HXGA 1AQJA 2B5OA 1F12A 2JHGA 3GFBA 1EIZA 1JHOA 1N2CE 2ZPTX 4B2LA 3K0EA 4Y7DA 4XR4A 2L0XA 4HR7A 1DQZA 2OQ2A 1DTWB 2JCXA 1PKEA 2BF4A 3E18A 1FFEA 1ZQ9A 4YIHA 2MTBA 3I30X 3O26A 1FVOA 4LGVA 2FEXA 4UQLA 1VGVA 1SKMA 2O8FB 2QZPA 1VCIA 2WG2A 1C3JA 3HVJA 3EPRA 4OTZA 4Y18A 2KI5A 3FCOA 1G59A 3JZIA 1F2UB 3HRHA 3QPVA 2JFXA 4MIYA 1YS1X 4PX5A 3ZGNA 1VRWA 2VTKA 4FIDA 4A03A 1UJ6A 3BTUA 5JSZB 1KZHA 3DONA 3LP6A 2BOVA 2EZUA 1T8UA 1I30A 4KEAA 1DKMA 4MINA 4ZHQB 2QR3A 4PONA 1U2RA 4AJOA 3AT1A 2W00A 1NVVR 2LWIA 3LNCA 4JR2A 3D1LA 1A88A 3WHKA 2CK3D 1D0VA 1NU6A 2X4DA 1IHPA 4CF6A 5AVSA 4RORA 2FVXA 3M6AA 4KXWA 2IY9A 3IP8A 1DC6A 1EB9A 1K1EA 3ABSB 4M54A 1CDEA 1MPXA 4P4UA 5IEJA 4V0MA 4ENPA 1IOLA 2WJ6A 1E61A 3P2OA 2JGIA 1YVDA 3ZI7A 2VHQA 3LLVA 4QQNA 4LW8A 2IGTA 5JRZA 3M1LA 5KMGB 4Q7KA 1CY8A 1U8TA 1OI7A 1GGNA 3KWFA 4QVIA 4JI8B 4NCAA 1Y6RA 4BQNA 2OCAA 2C31A 3C7CB 1QRDA 3B48A 2YDYA 3GPDG 4U00A 3K30A 3GAAA 4IIJA 1AIPA 5HQJA 5BQOA 3NIBA 1WDMA 4OQMA 5JQWA 2O0HA 4OYRA 2PX2A 1Z0AA 1E94E 4FYWA 1AHNA 1XMPA 4ZODA 2YV2A 5KPJA 3B38A 2VDNB 4JX9A 5SYMA 2V3VA 3N2YA 3UAXA 4M0MA 2OXEA 5F1OA 3E23A 4MAMA 3THXA 1VKHA 2YJ5A 3PQEA 3H9CA 4IHJB 1P7WA 4YRQA 3WGGA 1AUQA 4TV8B 1FC0A 4DJDC 3L04A 1U94A 2G76A 3L8HA 4B81A 4N6OA 4IL5A 5L7YA 3CZQA 1KO7A 2PS1A 1VLZA 4WVFA 5ABPA 3SOPA 3TIGA 1UAAA 2Q9BA 3CX6A 1M2HA 3AF6A 5CT9A 3LSTA 5CP8A 4DV7B 1CY0A 1XZHA 2WJPA 1RZRA 4TT8A 2VLBA 4J1NA 5AJXA 3LX4A 1GCOA 4Q9NA 1BDJA 3L7LA 4IHKA 3QZUA 2PWAA 3GB9A 2PMFA 3CGWA 1F2UA 3JQQA 4UXIA 2F9MA 4HOYA 2IH4A 1EVLA 4IICA 1KU6A 3D8SA 3TD9A 2QN7A 1K86A 3ODGA 4GPZA 4IX1A 1GAXA 3VBEA 1MQ8B 4AECA 3Q3IA 1EFVA 1ZGZA 5CD1A 5EJ9A 2C9CA 2Z3VA 3EGXB 3BDVA 1SKBA 1UPCA 1T3GA 3F3MA 4I5EA 4TOIA 1SUAA 1IPEA 1QB7A 4CM4B 1OYOA 1ZK1A 4YFVA 1ZN8A 2ZJ5A 3I9OA 3C3CA 4XUGB 2FZVA 4BMVA 4DLKA 3JVDA 4RGVA 4P2GA 1DRWA 4H1HA 4OMFG 3STWA 2PAAA 1PFYA 1IZZA 1RQNA 2BI8A 4OXKA 4QLBA 4UFNA 2IF2A 2C29D 1BVRA 2MYPA 4G97A 4HJXA 4NONA 5C7YA 1UWCA 6LDHA 1WR8A 621PA 4GDFA 4WWHA 3N0TA 3KKOA 5CDTA 1QHEA 3DBRB 1J8VA 1FTNA 1I3MA 5HQ3A 3LRXA 1XAJA 1SCJA 4NV1A 5J4HA 4A10A 3IELA 1EJ0A 3A58B 1TQ4A 3IAUA 1Z4MA 2ODAA 2XTAA 3BFXA 4L73A 1VHJA 1QYVA 3RU9A 4WZAA 3CRRA 1RIIA 3DM5A 1KBOA 2R6CA 5BSHA 3TPCA 3AETB 3A3PA 2LKCA 1OXKB 3EY4A 4O1HA 4WERA 4DLPA 2P2GA 1XPOA 4O8CA 3FCEA 4RIGA 3U7QA 5DGXA 4K0KB 4RPKA 2FKAA 5IANA 3K9GA 4OHOA 4U5XA 4UTXA 1KJNA 1C0LA 1FYVA 1WMFA 3TX2A 2F8LA 3K92A 4UTVA 3MAAC 2YNMC 2P1DA 1HZZA 1YB6A 2ID4A 1ESMA 4JSYA 3K8YA 3ERCA 1T2NA 2GF9A 3PLRA 4GD3Q 4XQGA 2DWQA 2GAOA 2W2NA 4HAWA 3F97A 1BQ4A 1JJFA 3JZMA 1ZD3A 4YNBA 1T1EA 1KDVA 4DXHA 3L8MA 3D6HA 1LD3A 1C8LA 1N25A 3HCDA 4KK3A 1A7UA 2QU7A 1XALA 2VWQA 2YJ4A 2M6RA 4I14A 5C4GB 1X94A 2I2CA 4Y9UA 4AN4A 5AKKA 3SI7A 2OOSA 2QRQA 2IYRA 2WF6A 3F8TA 1F6WA 3RYTC 2VDWA 2ZYAA 5HRCA 5ICMA 1GV1A 4WW0A 4IEFB 3D6VA 5CJJA 3W5SA 1Y4DE 4BNWA 4ML3A 3V7UA 1LWOA 4Q05A 4GL4A 2V7EA 1R0LA 3R3UA 5MFZA 1F7UA 1DGQA 2QQ5A 3NVMB 1VI2A 4HDSB 4N3AA 5LP6B 2FG5A 2G17A 3TBHA 2DB3A 1N8TA 1H6CA 1QK5A 1M8KA 3KSDO 1IXYA 2PFSA 4C0XA 2GRAA 2M98A 5L4LA 4E2ZA 5F9FA 4D8UA 4XD7A 3ACCA 5J2TA 5A0FA 1Z0FA 2YYYA 3U4DA 5HWSA 1TQHA 3ZLBA 4CF7A 3JR7A 3PSHA 1CQZA 3NAMA 5T8KC 3EGDB 2FHPA 3ZS8A 2DE0X 1A5ZA 1PK7A 1I0ZA 1LPSA 2Q6VA 3AEUA 4CFZA 4ZVRA 3K70D 5LMUB 1L5HA 3HVUA 2NZYA 4UUOA 5U4QA 3INRA 3V1LA 4AX8A 2R7NA 2QG6A 1K4YA 1Y1QA 3WOVA 3IIKA 5AJTA 1B73A 3VH4A 2Y6UA 4FHCA 3LLSA 4PZZA 3CX7A 4UARA 1NUQA 16PKA 2CKMA 3OD5A 1TL7C 5ALXA 1BXRA 1O4VA 2WHPB 5C1DA 1L9XA 4LRYA 5FLKA 2FN9A 3AEKB 3QXGA 3WBBA 4KXVA 1ORRA 3ROMA 3ZZTA 1V7QA 1KJ8A 4RZXA 5E8RA 5F7XA 3BSYA 1Y3AA 2AI3A 3M1YA 1RI5A 3HYSA 4A73A 1DV2A 4EI9A 5KTRA 2C2XA 4R16A 1DPGA 3DWIA 3GRVA 4I55F 3G8CA 3TQRA 3V1NA 4MW5A 3TQSA 3O1IC 4EYGA 4XOIA 3RIHA 3BXGA 1PO7A 2PR2A 5CT5A 2PUVA 2XJ4A 1I3KA 3BB3A 4AMGA 1PRYA 1R0BA 1VKNA 2HRRA 3RYCA 1DIOB 1QP7A 2OXCA 1YQ9A 1QIDA 3CX8A 4P0TA 4DCSA 4YO8A 1RWXA 2D0DA 3DTVD 3JY6A 2W2PA 5BYJA 2PUGA 1JSLA 3KHTA 4XIFA 3N3BC 4EL0A 1LJUA 1TAGA 2IEYA 3KCNA 2NQ2C 4OXRA 4QZVA 3B9RA 3WYDA 4XDYA 3QUCA 1T6ZA 4C76A 1M34A 3TTWA 5K0GA 1X92A 1FP4A 5E9WA 4LQ4A 4I1SA 1IE3A 1SC9A 2ERCA 3C4JA 5FIUA 3EAGA 2A9RA 3QLUA 4MJ7A 5CX1A 2K7FA 5J3JA 1YNSA 1DFHA 2EU8A 3AHJA 3FXAA 4QAQA 1L1FA 2ZJ7A 4S24A 2C57A 5KX5A 4WL0A 1K97A 2GRUA 2ZYUX 4PWYA 5AM5A 1BDIA 3DAPA 4ZALA 2XYRA 4NJEA 1OAAA 3W2GA 3AHIA 2AV6A 4YJ2A 4JOCA 2VF4X 4MW6A 2NYUA 3JZDA 3PNYA 3QITA 4EO9A 1NONA 2HA5A 3IVMA 4Q1DA 3FOCA 3TFQA 4BRZA 3PXEA 2VCEA 1JVSA 3I58A 5ALWA 3OPQA 2HMYB 4L16A 3BIWA 4AWXA 7GPBA 4WNAA 1PSWA 3L7DA 4UXJA 2UXDB 1KZ4A 1NHGA 4UEJA 2JFUA 3RYIB 1R64A 2ERXA 3HLKA 2XE6A 1GEGA 1TZCA 1L4FA 4KGDA 4LQDA 3ZQ4A 2Q07A 2VXOA 1XA4A 2IJGX 5HJ2A 3FGNA 3OBBA 3SC6A 1MU0A 2ZVQX 5JH7A 3O84A 4CT0A 4ZOEA 5BWLA 3QTBA 2JZOA 1JWLA 1CBUA 3TLBA 2C1XA 4D74A 1KZGB 4OHYA 1UWKA 4PC1A 4ABYA 2HV9A 4KH1A 2O3UA 5CAEB 4CM8A 4D8TA 1T2DA 1BA2A 2FAXA 2QUAA 1B00A 3PNQA 3KQHA 1KAHA 3TTXA 3BWBA 1TM3E 8ABPA 2AOUA 4R6WA 5AI5A 4DEVA 3A8TA 3PNMA 2AX3A 4MGIR 2D13A 2GPNA 4UPDA 3UMSA 3O1LA 3UEOA 3LPLA 4XM1A 3SC2B 1C3OB 1JIVA 1JXMA 2RHTA 3E0QA 3NBZC 1KC1A 3X44A 3DXXA 5BMVA 3ZDDA 2BKVA 3NO4A 4IVPA 4GOKA 4RPIA 2CVZA 3L4SO 5DSXA 4HTFA 1F9AA 1OXTA 5COQA 3Q0EA 5HZHA 1IN4A 4RNDB 5KYVA 4HQOA 3LLMA 1P80A 1ESCA 3MUNA 4U0KA 5DHFA 2EF1A 4R1QA 3I01A 2WT9A 4AJJA 2HA6A 2C5GA 5KYWA 2CZQA 4TQAA 1M2EA 2CBGA 2QYSA 5JAQA 1FXWF 4N0MA 4NCIA 5IT5A 1KAOA 2HK6A 3VO8A 2RGNA 1H3FA 3VJKA 3TE6A 2GHRA 4ID3A 3TJRA 3TK1A 1E1DA 3DLCA 4YRZA 5A4DA 1HYQA 4BKUA 1J8DA 3DJFA 4EGSA 5KVCA 1KJ9A 4L6IA 2QV7A 3N87A 3ROPA 1E4VA 3H97A 3ZY3A 4EOGA 3IJRA 2Y1FA 3R3JA 4B3XA 3SZMA 4BGUA 4CU5A 3AM4A 4E5SA 1YZGA 1P4AA 2FEMA 3UUFA 4AS1A 2OY0A 3K9WA 3S2ZA 1F38A 3KUKA 3P2JA 4HLCA 3NP9A 3TL6A 5JEDA 2AGVA 4ZAXA 1OC2A 1AUPA 6GPBA 1OTHA 4JUBA 5KYNA 4WRRA 5K8LA 1J4AA 3CF2A 2VQ6A 3LD9A 3G8BA 5KDLA 2GBLA 2X2OA 4C7OA 2ZFUA 2O2SA 1PR3A 1VFPA 5B3JC 2OYCA 3VAAA 2TSYB 2X2EA 5JAHA 4W5TA 3ZGZA 1UJ4A 1LWNA 2O3QA 3SYTA 2QMYA 1XCBA 3HJRA 4PZUA 5IXSA 4XB2A 1CUIA 1U2GA 5IABA 1P91A 1CY2A 1SCAA 2P9ZA 2XUKA 3KALA 1VLVA 2JEOA 2QF7A 2EJUA 3NH9A 2CXNA 1NVEA 3NYQA 1QC5A 1Y3HA 4HFRA 2Z4SA 3M6MD 2CBZA 4UBOA 1N8SA 3WRYC 5BWNA 3UHPA 4ZDJA 4CI9A 2QR2A 2W2MA 4Z4EA 2FMKA 3T3PB 1HG0A 1CWUA 3CUYA 3E9QA 1UKCA 2XMBA 4MUKA 4O0LA 4U3JB 3SVLA 1QUEA 2XUGA 3HG7A 1UJMA 4LYGA 3EXHB 2YFHA 4DSNA 3FNQA 4QUIA 2EL7A 2QQGA 3ESQA 2IV2X 4HH3C 3MTGA 1JALA 4X71A 1OV6A 1M34B 5A6VA 4XJTA 1H2EA 5PGMA 5AUPB 5I3CA 3MOIA 1Z4PX 1JWBB 3TQHA 3WTBA 3T3NA 2IITA 3VYRB 4ZWNA 2QRVA 1WNFA 3ESXA 3DCNA 2OXIA 2H4YA 2PMKA 3N2LA 2QHXA 5G2OA 3CNBA 1KO8A 3TFWA 4F12A 1PVDA 1OZAA 2DTDA 1NVVQ 1O6BA 3CGGA 3KPVA 3OX3A 3H75A 3PZBA 3KV3O 4NOKA 3VYVA 1P9WA 1M34E 1TC2A 1SOUA 4TWRA 5AK4A 4QDTA 2Z9BA 3UGKA 5CUQA 1NF8A 3GLHE 3OSUA 3SGLA 2R2AA 3TLGA 4C7BA 1NP7A 2I76A 4X1KA 1Y8ZA 5LXTA 1Z07A 3CLHA 2VHWA 3ZZUA 5BQFA 5BSFA 3BFJA 4KSBA 4BNDA 1NNI1 5IWAB 2JI8A 1WEHA 5A0VA 1X9GA 5GINE 5LUAA 2GJ4A 4F4FA 3CN7A 4B7CA 2AG0A 2NTNA 4II3A 3KC2A 3DE6X 3GJSA 2Q6IA 5JMOA 1CDDA 1MT3A 1NN5A 3X2FA 1QP8A 5DH9A 3FSJX 4RPHA 4HUQB 4L2IB 3LQRA 4UUPA 4U5QA 1XMOB 3P4UA 1OWMA 5CB4F 3H16A 1F6BA 1NR5A 3LT4A 1DNPA 4I6EA 5AW9A 4DABA 1R4MA 2V7UA 3B6KA 1XU9A 3W2HA 1C2YA 1JR4A 2QZ4A 4H7DA 4RF2A 2Q27A 1WXFA 2BZ0A 3P5BA 2UUBB 3L8EA 1JEYA 3CONA 2QRGA 1PJ4A 3FTDA 3EIOA 3HCPA 4GT1A 2D5AA 3M82A 5HKKD 4DCOA 2YWBA 2FEAA 3E5HA 2Q4DA 4UVDA 3IBSA 1M1XB 3PQ7A 4YRSA 5I01A 1OFIA 3WAJA 1MDFA 1MVNA 2GHQA 3R5KA 5AXAA 3PXGA 3K1TA 4B5LA 2HPAA 3P5SA 4J03A 5BNIA 2BI4A 5CXQA 1WIWA 3LI2A 3B3AA 4I2VA 3L92A 3OU6A 2JCYA 5L3QA 1DE0A 2P7IA 5KYTA 2IXGA 5CDFE 1VKZA 1PT9A 2ZT5A 4DUPA 2AG1A 1OF1A 1B14A 2C8LA 3EE6A 4K6MA 2PWPA 3MBKA 1A69A 4KLCA 5K20A 2ODNA 4KI0A 3SHVA 4NE7A 2RIRA 3S2FA 4EY6A 3K0SA 1TT5B 3B1XA 1M8JA 2OC4A 5IKPA 1L7PA 2YOHA 3QKRB 1UPBA 4KX3A 4XFKA 1AKQA 5C5DA 4EPWA 3L7AA 1Q3TA 5ED0A 1Y9JA 2X4GA 4DY4A 4D80A 4LOAA 1OOEA 4HSEA 2QGFA 3HU1A 2QP4A 1IMOA 5E9JA 3QEAZ 1O94A 1PDWA 1RD4A 1O6FA 2E37A 2AJDA 4N3CA 1KTVA 1ZU5A 3VTKA 2X1HA 3RH0A 4BNJA 2O1XA 1FBNA 2Q7DA 4QNMA 4MVYA 4CLDA 3R23A 1N5KA 4GEKA 2IYPA 2C7BA 4ZQEA 2O05A 5EJ7A 2LIPA 4RAOA 1LSSA 5L7WA 3MLEA 3R74A 5ITWA 2FPLA 4H3VA 3E4DA 1S1MA 2P62A 1TF7A 2DPGA 3CH6A 4LBYA 2A57A 1H8EA 4TYWA 4RV9A 3AXSA 1RLOA 1PD0A 3KSRA 4TWAA 1Q14A 4U02A 2P9FA 5LDHA 1A9ZA 1VA5A 3EVZA 2XCOA 4C2BA 5JAZA 1YZKA 3PC2A 1DC3A 2DF8A 1KO5A 1ZJJA 3AB8A 2X7JA 1H2ZA 1P75A 3JQAD 3N0VA 3NJ4A 5FR1A 4A6DA 1JL3A 2A9KA 3B7WA 3CZRA 5EZQA 1RKQA 1ZMTA 2D2VA 2NUTA 3OMLA 4A6PA 4N5IX 1G6KA 4IDCA 1ZOPA 3MS7A 3TW8A 3HM2A 5AJUA 4DUYB 3L8GA 1KE1A 3X1WA 3D8BA 4N7MA 3BFVA 2QLJA 3FPSA 3WXBA 1KVQA 1EESA 1ZC4A 1E1QD 1QLJA 4BEVA 1J5EB 4DN6A 4ZAYA 2QZZA 3FD8A 4F5DA 3NRBA 3D8RA 4IYRA 3BA6A 4S1PA 1HE1C 4M1MA 1L4NA 4Y1GA 1Q7BA 3T3HA 3ZY4A 4ZQHA 1ZH8A 5JLAA 1EMDA 2J0VA 3KELA 3NM6B 3Q3EA 1NXXA 4TZ0A 1CLUA 3KZKA 5JPCA 2DU8A 3E3LA 1ITZA 121PA 2VYVD 4JVSB 4XYMA 4IXDA 4WNYA 4PZ0A 1RWBA 1BEZA 5K3SA 1QNFA 2PUDA 2W9XA 3AVVA 3VDRA 3DMYA 3UJPA 1XTVA 1WQ3A 2HU8A 2POQX 3B5JA 3KWMA 4GW3A 4UCXA 4D4HA 4D4GA 4AY2A 1IUPA 1UKAA 2CHGA 1Z47A 1PK8A 5I7AA 1PZFA 1P7PA 4K9NA 3HZZA 4GMFA 4NENA 3VR4H 3ZU2A 1X2EA 2J0QA 1IUKA 4LYFA 4AZ0B 4Z8YA 3QELA 4YJ3B 5G4KB 4ZT2A 1X1CA 4FWBA 1TI7A 2XUIA 3IVAA 1GM5A 4F56A 3M8KA 1PWHA 4KQHA 2V8OA 5IK2A 1TMYA 4LY6A 5I5EA 3FYUA 2G06A 4MV3A 4EG0A 1E1QA 1LDGA 4O1MA 1B0ZA 5EHQA 3D81A 2JIQA 2RHMA 3OE4A 4LDNA 3SR0A 2EZ9A 2YRXA 3H9UA 2OGTA 3HP1A 3L7BA 4O4IB 3HFJA 2VP2A 2Q3JA 2QM0A 2Z1NA 4MV9A 3WWEA 1X6VA 3Q3VA 1S5PA 3VFDA 1E2KA 2KPOA 1AGNA 2DR0A 4QBTA 4L8FA 2FX3A 4TUYF 4O6VA 1FSGA 4L75A 2Z8XA 5LZ2A 3JVUA 3N05A 3LF2A 3OPYI 5JC8A 3VPSA 2IIBA 1VJTA 1F60A 1RVV1 5KVSA 3FPHA 2P0YA 1KOGA 3MWEA 4NPAA 5HILA 2A9PA 4BKRA 3PQCA 1OH5A 4D26A 3M7IA 4B6PA 2EAUA 2FSSA 2J1LA 1NMQA 3NXSA 2W8BA 3OQNA 5L3SB 3DBRA 1S2DA 4QOSA 1L7XA 4TKUA 5GGYA 3ZQJA 5HK9A 4YJ3F 2VYNA 3H9GA 3AUXA 2ZRFA 1IIRA 3GO4A 3R9WA 4FHGA 4AB1A 3SHFA 1JDTA 3QVJA 3W5BA 1GU7A 4HZGA 5BV7A 2YIMA 3W5UA 3EQ9A 4EHLA 2GAAA 4FHFA 3O47A 1BC5A 5IZ4A 1GU0A 1SD1A 2JIMA 4NF2A 3CX3A 3H8JA 2QLFA 2YCLA 4V3BA 5EHNA 5H4HA 3I92A 4ZHQF 5BVGB 2QTCA 2ZBDA 1QE0A 4W1SA 3K72B 3E9MA 1SR8A 3C43A 3FZNA 4IQ8A 1TUBB 1VLHA 3K8ZA 3KB1A 1TZMA 2I71A 5FOWA 4JBYA 2P4QA 3V4VB 3RJMA 4ZVNA 5CBKA 3LVQE 2IZ1A 3DR3A 3FPJA 2BE7A 4GX5A 4WESA 1A9XA 5CCDA 4D0NA 1XAGA 3VHQA 3EGXA 3GN2A 4JEUA 1AQNA 4GX0A 1V9CA 1IY0A 3DS8A 3H04A 1EFPA 3D4PA 3LM8A 2ES4A 4M1KA 5FQOA 3OE5A 3SYRA 3UMBA 3OBIA 4EJ6A 4MUEA 1TO1E 1QJ4A 4K1LA 1E79D 3EVAA 3V33A 2N0SA 2Z83A 3GDHA 2CLCX 3HBFA 3FTQA 3BCHA 3FYUC 1SC6A 1MUUA 1VJ1A 3H5NA 4HNHA 3O8BA 4MVJG 3QEMA 4NJMA 4FHEA 2QRJA 1COWA 5G3YA 3C87A 1BMFD 3R5HA 5EJFA 3RG8A 3QKTA 4MAAA 3F6RA 4IXTA 2HMAA 4H15A 1APBA 3DBIA 4G1MB 3BOSA 4PCUA 3OPYB 1NVDA 3TRDA 1OFGA 1RPNA 4HX2A 4FYKA 4L85A 4V0SA 5SV2A 1XRMA 5AVVA 1QGAA 2JH9A 3SCZA 2W2TA 5DHUA 3VU1A 4FP9A 3QF4A 5DLDA 4BMCA 5A3JA 3FNGA 1E9AA 2PZGA 1J8MF 3I1JA 3LT0A 2NV2B 1JT2A 4DZZA 3GOHA 3E8SA 3CCBA 2PBZA 3OH8A 3SZLA 4ZEMA 5E6RB 2YVKA 3P2EA 2OORC 3I62A 4WJZA 3T3EA 1UBCA 4R0VA 1Z2OX 1GG8A 2J41A 2ZROA 3HCEA 2GN4A 4Q4DA 3UA4A 4CCSA 5KYKA 5LYJF 4AQ7A 4BO4A 5TE9A 3EWIA 1AMOA 3WNZA 4LTDA 4QQKA 4XGIA 4RA9B 1WXEA 3C3JA 3ORQA 4G23A 2I55A 1M2FA 2PKCA 2ZR9A 4L0MA 4MKZA 3U49A 2FX5A 4NK4A 4XVQA 4U0JA 1QDEA 1BKSB 1XPRA 2YXBA 3WLKX 1LBEA 2WU0A 3FE2A 1VLLA 1G63A 3REQB 1U7DA 5FPHA 3GJ4A 2OXFA 4AMVA 1W85B 2PHZA 1JNYA 1Z6TA 1TUBA 4JQOA 4Q7JB 4DJEC 4PNEA 4U6QA 1Q0HA 5A6SB 1FP2A 2P77A 5IM4A 4TS9A 1XJ0A 3NHJA 4Q3EA 3GEPA 3W3AD 5EUBA 4CKBA 4GI2A 4RK0A 2PUEA 2JCSA 3WP0A 2R6JA 4TT3A 5CT8A 5IFKA 1U0LA 3C74A 1YBFA 1RFGE 1XTJA 3OLWA 4KHZA 5CFPA 1T3LA 1S3GA 2OCIA 3WQHA 3D0OA 1UQUA 3JQ7A 2P90A 3QVLA 1GSHA 2ATIA 1H93A 3ANNA 3OZIA 4ZIRB 1ONNA 3AB3A 3H1AA 4HY3A 2WT4A 3SZ3A 4YT5A 2DFVA 3TDMA 1L7BA 3EVBA 2MSWA 3MT8A 4I5FA 5JSZA 2F62A 5ENDA 4DMUB 1ZUWA 4XX1A 1OVGA 3LSYA 3I3OA 2ZKIA 3AIMA 4DLSA 5T67A 3E9EA 1DRVA 1ULZA 1I3CA 2YFKA 4BNKA 4MIEA 2R8XA 4E2YA 4RSGA 3NOOA 3EPLA 2VBFA 4I1RA 1HV8A 3H83A 2JW5A 4J3NA 4F38A 1U4NA 1AHPA 3RTDA 2AYXA 3RTCA 3GEEA 2MT9A 2AJ8A 4FXOA 4EKDA 1NJ5A 4JMPA 4ETIA 3DAOA 1OIVA 3A36A 2J3DA 1DO0A 4RWZA 1O4WA 1YE3A 4BC1A 3GJ5A 3EVTA 1QGZA 1VG9B 3VRHA 1PNTA 3VDQA 1LC0A 1QOPB 2LXNA 2WIDA 3QNUA 2WJJA 4L8GA 4B48A 1Z2PX 4JEIA 3EBOA 2YWRA 4LVNA 5COBA 4JQYA 1KZ1A 2IEZA 4TVOA 1O5TA 3A2NA 3KP1A 5TMDA 3X1KA 1HNZB 3D6AA 4QTYA 3W9UA 2JAPA 1GQRA 1U90A 2XTZA 3EUAA 4PO3X 4F4CA 2PS0A 1PWZA 2C8KA 2YHAA 2OV1A 2IUEA 3K15A 3M1IA 3OCXA 3PD1A 1GAEO 1WD5A 4LJ6A 2WVAA 5FUBA 4QXQA 4C7VA 4KITB 4IUYA 3BQNB 3IOCA 3BH0A 4KUGA 2PXHA 4Q37A 1E1MA 3JQBA 3DOIA 3HADA 1G17A 2XE4A 1Q17A 1DKUA 2EFDB 2GZRA 4CJXA 1V3TA 5AVRA 1SXPA 4BY9E 1P33A 1T2CA 1QVVA 2HDNB 1Y8AA 3L7CA 2RAUA 1QHHB 1DP4A 2YZKA 3A7EA 3O75A 5DI3A 2ONZA 4K2HA 1D0SA 4FFSA 3KKQA 4TL7A 4A16A 4CTKA 3BXPA 4LRUA 3Q1KA 2FWNA 2FXIA 2ZJFA 4G0PA 2QYOA 3U44B 3DW3X 5K0LA 2W42A 5TEVA 1TYDE 5JMPA 1BRMA 2VSQA 1IHOA 3OCZA 3RIXA 3QOYA 3R2JA 5H59A 4FD3A 4PRKA 1ACMA 5ALYA 3G17A 3ES9A 3B5EA 5AK0A 2AE1A 5U1PA 4KNVA 4YREA 2GZHA 4A1FA 4EDFA 4J0QA 3HKEA 1ST2A 4EPYA 3CY6A 4I5GA 3ST7A 1KI3A 3UFXA 2R79A 3LCJA 5DNDA 3J7AC 1DKRA 2BHRA 5JDCA 3OTOB 1EA5A 1VOTA 3INTA 1QUFA 1SC3A 4J16A 4KIWA 1GGJA 4FCTA 3IAAA 3VUEA 3OFNA 4DSAA 5LNK1 2ZWMA 4HH1A 5DGCA 2NU8B 1EDOA 2X0RA 3DZHA 2BMJA 1QHFA 1WVGA 4TSRA 3OTWA 4G65A 2UYOA 4YS6A 3RR2A 1F8YA 4MUNA 3BWDD 1N8NA 3PQ8A 3QUTA 4PC3A 3HCAA 2JS7A 4FLMA 2Y0PA 1D1PA 1QRUA 2WD8A 3N5CA 5HNKA 4IDEA 3E0XA 5A62A 4WNIA 1XMQB 2W71A 2XWJI 1NPYA 1VIYA 1YUMA 3NJ8A 2OV8A 2DC1A 4PPGA 4RVOA 1YQWA 2XB2A 5DX8A 3WRYA 1IN8A 4MICA 3QU5A 2O4CA 3N76A 2VJYA 2OC9A 3B8EA 1GTL1 1JYFA 4MRRA 4BZPA 3J81k 2I7CA 1HURA 1SRRA 1UMDB 3QLUC 1PQ4A 1Z33A 3WBKA 5LXTB 2PK3A 3CE6A 2DUWA 3K0FA 4O2BA 5KAMA 3HCWA 3P26A 3DLTA 3P20A 4M7OA 3PEYA 4LECA 2X15A 3PXCX 4PRYA 3LYUA 4PPYA 4QL3A 4H1WA 4IOJA 4MWOA 4GC5A 3QBVA 1NBHA 2I6UA 1UC9A 4FN4A 3IGFA 3RC1A 4EHJA 5D7BA 2FGKA 2HF9A 2PH7A 3DNFA 3GFQA 4JJ6A 5K3FB 2QLTA 4ALIA 1BDHA 4V0QA 3KRTA 4JDPA 4C0BA 3SQNA 2D2XA 5C7IO 3C3WA 2IV7A 4GSYA 5JCPA 4C9BA 4MPJA 4XWYA 3FUVA 4J9VA 1UKZA 4FFVA 4NIMA 5TB5A 3F5DA 5CDHA 1J49A 3ISTA 1XELA 1NQ5A 3EG9A 4PV7A 1VPVA 4JI1B 4GGPA 5JMTA 3Q98A 5C51B 2JFWA 5AMXA 3M83A 1GTG1 2X6RA 3QNMA 2R7LA 1DC5A 2QVCA 1N3YA 3FNEA 5H9VA 5DWDA 3TTUA 4C0AC 1B4DA 2JCVA 4KO8A 4JT8A 3WB1A 1ZVVA 2HIMA 2XZTA 3LHIA 4B3DA 3TG2A 3MGGA 2P3LA 3NBXX 2B2XA 4ZVUA 5J43A 1GDDA 4DLNA 1VIDA 1W5SA 3DH0A 3FKSA 2VAVA 3WBFA 5L53A 4IQGA 1KSFX 1SNYA 1PQWA 1J90A 4G0VA 3CBGA 4FZRA 2JIBA 1J5PA 1NBME 1OXSC 3SD7A 3I5MA 1ZN7A 5IUJC 5KYYA 3GLVA 4LVUA 4REQA 4AURA 1PJQA 3FVQA 4N40A 5A9SB 1ZGCA 2WTAA 3KTAA 4D97A 2CF5A 3DAYA 3AZQA 2AKEA 1ULTA 2FQXA 1UDBA 4G5RA 4Q47A 4IJKA 1NUTA 1I4DD 1ZM2A 4PW0A 3C4QA 4S2UA 3SC4A 1P31A 1ZXLA 1PJ8A 2FSPA 4GP9A 4Q3CA 3BD8A 4YCNA 2NUPA 3I8OA 3GOQA 1OH7A 5L3RA 2EF0A 1X8JA 3A9TA 1UC8A 3B82A 3DGFC 2IU0A 2AW5A 4A0HA 3IT3A 2GD6A 4BGVA 4B45A 1R9GA 2VDKB 4TS3A 5LXTF 4E70A 2QAIA 1W49A 3PRYA 7YASA 2WUFA 4OQEA 1NW6A 4P7FA 4C4RA 1BD3A 4K3VA 2BEKA 2PZMA 2X6QA 2Y0DA 4HGRA 1YIAA 3HUFA 4OGFA 4NBTA 4TMTA 2CFRA 4ZZ0A 1KFEB 4XW2A 5AHOA 4QPCA 5JYBA 4CN8A 5BR1A 2IK8A 4XRRA 1ZICA 2QBYB 3CX4A 3OZSA 3VNQA 1TFRA 5JDIA 4NFYA 4WCVA 4E1VA 4MUGA 2BKEA 1FJHA 2BR3A 2Y1WA 2AD5A 3AY6A 1XK7A 3P1JA 1D0IA 4HMOA 4YBZA 2RH5A 4LSGA 5CB4A 3IPAA 4C88A 2ZG6A 4HWOA 4F72A 2K5UA 3LA8A 4AJ4A 5FBRB 3FGPA 5FFFA 4F96A 1L5QA 5JBNA 4RF3A 3ITNA 4PBTA 3K70B 5HRAA 1RXUA 2BR4A 4WADA 1GRQA 4CQNA 2Y71A 3RSCA 2IHBA 4MKIA 4M38A 3BBPA 2PX6A 1UKYA 2QM3A 3GLQA 4KKXB 1CJBA 1YJ8A 4GUDA 1CQJA 4QUBA 4LJ4A 1UIMA 4QYWA 4E15A 3CT4A 5ALVA 3L4JA 4C01A 1GA4A 2WHYA 4PZYA 4PZ9A 4PSDA 4MLCA 1JLSA 1JKJA 5BN1A 3FAKA 3OOEA 4B6EA 2I33A 4ESEA 3IBYA 5A5VA 1T9BA 1YZTA 3LVRE 4BVKA 1B2LA 2JHCA 4L0DA 4Y0AA 5IF3A 4BNVA 4MS4B 2B8NA 2GUWA 5C1BA 1XV5A 4N5MA 5EJIA 1QAMA 4X63A 1WMSA 2QI9C 1YH3A 1YGPA 4K9LA 1L7NA 1WCXA 4F2WA 2WVGA 4DPLA 5KQRA 3GFSA 2W6JA 1PNVA 2AYZA 3CWQA 1UBJS 3B1KA 3DCIA 3DD1A 3JPYA 1ZRNA 5GONA 1U5CA 3IBFA 1TJPB 4EWLA 5E6SA 4BQRA 2F67A 1LBTA 1PV2A 1PZEA 4ETNA 4KK4A 3Q72A 4NBRA 2C4MA 2W98A 1WPXA 3VTZA 4E33A 2PL3A 1GGKA 2H7XA 3IC5A 2VHTA 1WM1A 1MMFB 3DOEA 4YP0A 2PGNA 2V7VA 4DDVA 3B3FA 3O3OB 3RE1A 2MSKA 4XWTA 3UPUA 4INAA 3RF6A 1NVGA 2GJKA 2C8VA 3OQHA 1OLSB 3FHLA 3G7UA 5FNVA 3HTXA 3NALA 4PR3A 1IATA 1QQ6A 5HUHA 1XZEA 1AKWA 1YZNA 2NP7A 2DFLA 2Z04A 2CZCA 1NX9A 1Y5RA 3QVMA 1WPGA 3HBMA 5AW7A 1RWPA 3PCTA 5JNTA 2BH2A 2GTIA 4DIKA 3JRXA 5EMJA 4HQ6A 4P2BA 1ISSA 5JNRA 1MW8X 1CY7A 2R65A 3KAKA 1RC0A 4KWEA 2WC1A 1NNUA 3GCGA 2AW3A 2SHKA 3EFHA 1H23A 3CW2A 3MINB 5D3MB 5LN1A 4IH1A 3CF0A 4PU0A 4U2BA 1CUFA 5DASA 3T06B 4D5EA 1TIPA 4DL9A 2M1XA 2NACA 2NV6A 5KTYA 3NWBA 2JIPA 1KEEB 1TM7E 3A4TA 2YC4C 4ILKA 5LYJA 2KSQA 3BJIC 3ILVA 1E63A 2J45A 3EA5A 4QFDA 2ZCUA 3PFWO 4KTTE 5A5GA 4EJ0A 3JYOA 3ME5A 1AC5A 2UVDA 2Z6VA 1D9ZA 3LBHA 4EFKA 1LU9A 4J0KA 4EGFA 3GMTA 1TO2E 4B6GA 1XZAA 3IQIX 4NYMR 4KQ6A 3E5MA 3RRJA 5J63A 4KIUA 5AESA 2PE5A 3UWKA 1LQTA 2P5SA 1U3CA 3GXBA 5CLFA 5H0IA 5DX0A 1MO6A 1WUHS 1P3JA 1LSJA 4WLVA 3HA3A 4MR7B 2O3JA 3CISA 4MJXA 4OJYA 4LI3X 2IP2A 3RNOA 3HVIA 2A8YA 2XVZA 4IZHA 4F60A 1MPTA 2C98A 4F85A 3V42A 3MTEA 4HX5A 3TLKA 4PBRA 1CPYA 2WFLB 5SZKB 3ZH2A 3NMUF 3AG6A 5BSRA 1Z26A 3FHCB 1F8XA 1NAIA 2H7YA 1PCXA 3PRHA 4P32A 3RVOA 4CMIB 2O8DB 2NMVA 4CQLA 3OKCA 4MYTA 3E48A 2ZR8A 3ZNNA 4ALNA 1NF9A 2ZI6A 3BIJA 3TIVA 3H87A 2O7RA 3R5JA 4PIMA 4K9QA 3IHWA 1KK2A 1KMHB 1UBMS 1H69A 1P72A 3SX2A 3TL2A 3R9XA 4D7AA 1EUYA 4YGXB 5JXIA 4JI2B 5F12A 1N92A 4DRZA 5GTDA 3K0BA 3V32A 1TEZA 2PUWA 4GZLA 5A2GA 1TZBA 1EZ1A 2GEKA 2DOKA 1V8FA 3DWEX 1BCRA 3J7TA 4F0JA 1HEUA 4OGWA 1KSHA 2HWXA 1RBZA 2HSDA 2NG1A 1CJMA 2GXAA 2JAUA 2HLHA 3WL3A 1GRRA 2YXLA 1JQJC 1TCUA 1DHTA 10MHA 1DRJA 1RMQA 4O2LA 3PVCA 4TQUS 3O4GA 5EWLB 5KKCA 3GA5A 4Q6BA 2E4XA 1A4IA 3ACDA 2IFTA 2LCFA 4TRMA 4CV3A 2GVNA 2DUNA 2DLNA 1RYZA 2HDWA 3UT6A 4A0QA 4K9OA 2YN0A 2ZQYA 3PCRB 5HK8A 2VXCA 1R15A 2H31A 3NBMA 5IYZA 4QQRA 3HNRA 2C2WA 4PZAA 4L5JA 5D6NA 4WKOA 4G37A 4HJRA 4NYJR 2I5PO 4OJNA 4BCBA 1H2HA 4BBZA 4YAKA 5BMVB 2AI2A 2Q3DA 4I9UA 1CC1S 2RBKA 1I2CA 4OO3A 4PC2A 3AFMA 4RKYA 2Q3CA 4KQEA 4UM5A 5J2UB 3U3XA 4ZT4A 4BNUA 1VCHA 4R1LA 1I1NA 5G0TA 3VNUA 3NC1C 2JKVA 4ZI5A 4MULA 1O0SA 4E3ZA 1XEWX 3R6TA 4UBLA 1EP9A 4YCBA 1CEXA 4V24A 4FJ1A 1RKXA 4EB3A 4PWZA 3GNQA 1XTTA 4EARA 4HDCA 4Q4JB 4MROA 1VMDA 1DHRA 2V03A 4N41A 3NT4A 4WTOA 1K98A 4G4SP 1PAUA 3EB9A 4MUIA 5IKOA 5C4IA 2IV3A 4HBGA 2CL7X 3R8XA 3A70A 1M5TA 3N39C 4DLWA 2XKJE 1J00A 4TQGA 1N2CB 3UHOA 3HYTA 1BN7A 1FK8A 1Z7BA 1ZU4A 1ZJYA 3UQZA 2FQQA 4MI6A 4RHUA 2IPMA 4UM7A 3B1WA 3VC3A 3Q85A 4MNTA 2FQYA 1CETA 4DBVO 2I91A 2QRMA 5A71A 4F5ZA 1V37A 1E3EA 4YAGA 3NUQA 1UMCA 2H1LA 4I8XA 1MEJA 1JH8A 5EYPA 2IODA 2C4WA 4G5XA 1W5FA 2HNBA 4HDKB 4KQFA 4ZP1A 3TSZA 3W6PA 4HNUA 4KRFA 3ZE7A 3CR8A 4HK4A 5IJ9A 4GKKB 4M0FA 3VKGA 3F3YA 4EB8A 4P4NA 1IONA 2XRYA 3IKMB 4YAFA 1PKXA 2ICAA 3ZE1B 3IEMA 1IYZA 2OB1A 2D7CA 3HO8A 3NHWA 1VG0B 1LVGA 4CM4A 3WY9A 3MJHA 1SVOA 1Q0RA 3T6KA 4WLFA 2B0CA 4ZTUB 4WZBE 3SQWA 2A0YA 4HNVA 2XH8A 1ZK0A 3UO8B 1SBQA 3DZJA 4D9BA 1RPTA 4TYQA 4NU0A 2G5PA 1DXOA 3ONNA 1UBUS 1T0PA 1NIJA 1UXJA 4O4HA 1DBSA 3ZWCA 4EBBA 2ZUWA 2HZ7A 4TQ9A 1PR5A 3Q7SA 1HTWA 1PWYE 5HCNA 2KW5A 3NGMA 5AI8A 3N8GA 3LX5A 5KS2A 4LFBB 4Y6OA 1CZKA 4Q3OA 1FLAA 1P2UA 1A77A 4UEKA 3E53A 4O2BF 3CZPA 3HSKA 4V03A 3RFTA 3ZD9A 3GUYA 1N3LA 2JPDA 3ROXA 5EMLA 3PUJA 1ATZA 3KJFA 1MXFA 5GVRA 1VSUA 4NH0A 5AK5A 3T52A 4G1UC 4QGFA 1VSVA 3STHA 3FDZB 3CBQA 2F59A 1VM6A 5JASA 2CMKA 3BB1A 4JCCA 2FTKE 5H7XA 3WGTA 2H1RA 1ZJZA 1PR9A 3GCWA 3PDJA 4URVR 1I24A 4HWSA 4UKDA 2IZZA 3QWHA 4Y67A 2PH3A 3QYPA 3D2AA 2ZIGA 3EULA 3IDFA 3SNKA 5IAAA 1ATIA 5C0OE 4XFDA 3RVPA 4LRQA 1EUZA 3IVRA 3C24A 5MN4A 1O3YA 3JAWB 4AY6A 1NI4A 1V8DA 2OHOA 3CPEA 4HNGA 4JUFA 3PE3A 5DHQA 2XNDA 4U6SA 3WZMA 1AD2A 1BFUA 4N8EA 1ZH4A 2A7QA 1DFGA 2AOTB 3AL3A 3TQQA 2VDPB 1T26A 4GE0A 5DWQA 3KXLA 3R7WB 3TCNA 4UC0A 3MS4A 2I6QA 4RHTA 4RZHA 1QAOA 4ROSA 4G0XA 4U7DA 1MO4A 2Q28A 5JJBA 2NUTB 3P9CA 2WRZA 2X8JA 2D7JA 3QP9A 5G1OA 3UHFA 4C05A 4FGSA 5IZCA 3ANLA 3K6SA 1PGNA 1C1DB 2FHSA 4D0RA 4OI0A 4HDKA 1I6WA 1LY1A 1MRSA 1B2RA 3EC2A 4KNYA 1BCRB 1YUBA 4JOQA 3V7YA 4FX5A 3AQ4A 3F2IA 2TRSB 3ELBA 4R51A 4GFDA 2X4IA 4YRNA 1Y3IA 2GYWA 3R0ZA 1VIAA 3RWMB 4N6GA 4TSKA 4TX1A 1YI0A 4BVHA 1PVOA 4XGQA 3LQ4A 1SBNE 3LPMA 5AXCA 2ZAIA 2RGDA 4FT2A 1I2AA 2X8LA 4KR2A 3S1LA 4YONB 2QPLA 3EHEA 3Q7IA 4KACA 1J21A 3KKEA 4RD2A 3U3RA 3A25A 2C2ZA 3KJGA 5JBIA 4I4TB 3KLMX 3MCAA 1N6IA 1CJVC 2CXSA 4IG9A 2FG7C 3H9EO 3EQ2A 4PR0A 5EIBC 4BB6A 1DBQA 2HQOA 1T1JA 3HDHA 4M1OA 4TLMB 1VB5A 3W90A 1W76A 2XTNA 5HF6A 4AP5A 3UGJA 3WK9A 2LKDA 3IAHA 4JU8A 4GM0A 4HN2A 3WRXA 5GZ3A 2WT8A 2P9EA 3KJNA 1NVFA 4MVJE 5JSUA 4OQDA 1CU1A 2IF0A 2OENG 5EZYA 1HBJA 2X6TA 1KQGA 4RHEA 4B3SB 2QG9A 5EHZA 1Z5OA 3F4BA 4NZYA 1SEVA 4DPMA 3ZHTA 3G8AA 2X5XA 2I6GA 4JWKA 4E30A 4ITRC 5C5CA 3RAJA 3ZXYA 5JD5A 1WHSA 5B1YA 4BMZA 3EQZA 4BBAA 4MUFA 3FSGD 3ZVRA 1OA0A 3NRCA 2PXXA 3OOWA 4BNFA 5EQFA 4UBIA 3UJ7A 4D92A 2JJ8A 3ONVA 1P4HA 3RIYA 1JFRA 5JQGF 4OK3A 5BW5A 2XRFA 4WCFB 4Z6KA 5IYZF 1IDN1 1QSGA 1M0SA 1ZX1A 2V65A 3UW1A 1DADA 1GARA 4LZWA 2C8JA 3SBOA 5DTJA 3HZRA 5E7IA 1YK0A 4ZPJA 2DBYA 1KQNA 3AY0A 2XMZA 2GNPA 1UODA 4HQ0A 1OD6A 4I1VA 2GS9A 5LDDC 1J0CA 1ECFA 1ONSA 1W87A 4EFLA 4GLBA 3TSYA 1LPOA 1VLMA 3G9TA 1E4EB 3IUYA 4CVNA 2E85A 2RGCA 2WJWA 1YA8A 1R4ZA 3AVWA 3N53A 1GCGA 2YIVX 3BHNA 4EAQA 4A8HA 5KUTA 3OEED 2NPIA 4WZZA 3TQCA 1NULA 2JLBA 2QN6A 3CEHA 2AF3C 1YA4A 4GHWA 4DOMA 1M2KA 1V8ZA 1OU0A 2CDRA 1OXXK 2FWAA 2FSHA 4QNNA 1EXWA 1AO3A 3QFHA 3O1JC 1VJGA 3L1KA 3RS8A 5B1EA 4CCAA 1M73E 2VDQB 4MR8A 4QG7A 2E6UX 3OJEA 3OY7A 4NEQA 4B3BA 3FMVA 1XCGB 3LV8A 2QLLA 4CDMA 4E1BA 5BVGA 3V1YA 3KU4A 4IZIA 1XTBA 3TQFA 4DVGA 3I1IA 5A3RA 5JZMA 2EV9A 2ZRKA 1XJCA 3HA7A 3UJ3X 5KJ6A 2HJGA 4C4SA 5BMVF 1OFHA 2G1AA 4FFPA 5HIKA 2QN3A 3GNSA 4PVCA 4R9RA 1RM4A 3OKFA 3K9CA 2HF7A 3KZNA 3TUJC 1WJGA 1HETA 1M7BA 2QTAA 1FSFA 4LPKA 4YRDA 2C83A 1Y5IA 1N4AA 3WS7A 3VPHA 3AIIA 4D42A 5C34B 4GM1A 5K8JB 4KE6A 1XYYA 3C8HA 4NYMQ 5H82A 4DBZA 3M4YA 1TCAA 4LF7B 1G291 1ZWKA 4MLPA 4R1TA 3MMZA 2V55B 4Q9KA 4BFCA 3OLVA 4CCYA 1DXHA 2OHVA 3KVOA 4GKAA 2YW9A 1LRJA 3OJOA 3GRAA 4GXNA 1Y6QA 1K27A 4LZJA 2X3UA 1E0JA 1FNMA 1E99A 1MXHA 2B36A 2X86A 3CLTD 3QLEA 4C4AA 4BCCA 5GZ6A 4LBWA 2BDEA 2GO1A 5A3QA 3GR6A 2XT9A 3V4RA 1BHSA 1CR1A 1YS2X 2PT7A 3UT5A 1ODSA 3I9LA 5IHPA 2VZLA 1JKMA 5BN3A 1SQGA 3RYFA 2JLYA 2GCPA 4CQLB 5FBKA 2BL4A 2OKCA 2QRZA 1W30A 4WLNA 3TLJA 2IU4A 1W47A 3NIWA 3C39A 1XJ5A 1MKYA 3ASVA 4WBXC 3ZOZA 1GEEA 3B89A 1L6IA 1O97D 2ZUVA 2VNIA 1CS0B 4N49A 3L3BA 2ZRAA 1MJ5A 1F8UA 1O96B 3PA8A 4JR0A 4M83A 3E9DA 2J9RA 3L6EA 1RW4A 1DX9A 4ZEVA 1SWWA 1JHDA 1K9SA 2QN9A 3QXSA 1Y1RA 1E6EA 1HE4A 1G7SA 1FFAA 1HO3A 1KI2A 1WB4A 2W58A 2G6BA 3EMKA 3F7NA 1KI1A 3G2PA 3GJ3A 1R6AA 2E18A 4J4TA 2Q62A 3HCCA 4PRZA 3QF7A 1RQGA 2QD4A 4AJ1A 2OP0A 1YKFA 3WNQA 1CR4A 1Z25A 4DXDA 3OUUA 3H3FA 1G38A 2IS2A 3VV2A 4AKHA 1NC1A 4RENA 1T4CB 2JI9A 4JLPA 1TLTA 5KB3A 4OLHA 3PUWA 4K1XA 3JATA 3PJFA 2D4AA 1KJZA 5BR7A 2FWJA 3OLZA 1PG0A 1LK5A 2H3HA 2X9QA 3CMMA 4E6EA 1NASA 5EA2A 1S2IA 4H7HA 1OB2A 3S68A 4JLAA 3I2HA 1KJIA 2Z95A 4CKCB 2ZYTX 1Y89A 2FH5B 1MVLA 1CZNA 5C5IA 4Q4HA 5EE5B 5T6BA 3JCZA 3U48A 3KZMA 2AQ8A 1DEHA 4J0CA 1BMTA 3MXTA 4JHXA 4Z4HA 2YINC 2BW0A 3ZUGA 3BTVA 1KEPA 4CMCA 5I7EA 3HE3A 3MTIA 4HGPA 2R6DA 1WHTA 2G9UA 2P6NA 1KH1A 2NT4A 1XKQA 1AURA 1HE3A 1JUDA 2XOEA 2ID7A 2PZJA 3AVOA 1BX1A 1K8ZB 3H6KA 3ICVA 3ZWPA 1BHJA 4CMJA 3SKXA 2J67A 3UKJA 1E7SA 1RJEA 4PIPA 1WSAA 2I2FA 2XZPA 5BUZA 4D56A 1V43A 4O4LB 4OFXA 4JI6B 1LC3A 4DA4A 1DELA 3CVWA 3WGHA 3WGKA 5FTMA 5SICE 1POXA 3E81A 3ZWOA 4CLEA 5L4SA 4R1SA 1T25A 4PEVA 1HE5A 1VHDA 1ZNYA 3EAQA 1G5RA 4TM8A 1V7ZA 4KH0A 3B1VA 4YXWD 3RWOA 4I8DA 1H2WA 5BQPA 2ZK7A 3NYWA 4KYTA 4JYZA 1SUIA 2P40A 1OIXA 1C9DB 4KV7A 4DR4B 1WO8A 2B8TA 5FI3A 5FLYA 1Z73A 1PQPA 1WMAA 3AF2A 3ASUA 1PYDA 5ALQA 3FOZA 2H1OA 2J3EA 1FVHA 2RGWA 3GPIA 4HT3B 1XEWY 4TXNA 1LVUA 3IH5A 4O08A 3W5HA 1QHXA 4MRPA 2H2HA 1Z8DA 4P84A 1N0IA 1VSTA 2JVIA 3EEIA 2G28A 4ENRA 2XUPA 5CA1A 3H5WA 2O8BA 4AYXA 2R8RA 1AT1A 4CF4A 3BS4A 4Q19A 5A5FA 1E1CA 4ITUA 5FNZA 3WLOA 4OLFA 2XQIA 4H4CA 2A35A 4RE6A 4F86A 4HB4A 2YX1A 4NYJQ 4O63O 3QSYA 1JZTA 4WBNB 1XRQA 2WZDA 4N76A 2WM9B 1P1RA 5F35A 2HEIA 4ZA2A 2PQ6A 3PGLA 3SF8B 3U4HA 5T64A 1QO9A 2RFLA 3GWGA 4KQKA 3S8YA 2EHDA 4YDSA 5HXAA 4F4HA 1H9AA 2I99A 3C48A 4G4JA 2GXQA 1X7YB 1VCMA 5D51S 3O83A 4ZRMA 2Z30A 1OZHA 3GX1A 1G64A 1UFRA 3KAJA 3TVDA 3OU7A 3NX4A 1RYHA 3W2FA 4IMIB 1K7YA 4CN9A 5M3BA 3KBOA 4X41A 4ZN6A 1W52X 3DNMA 3KVYA 4RA6A 3TYXA 5B3KA 1U1GA 5CH3A 1QVRA 3P9IA 2FVYA 4OBXA 1GPAA 3ZWYA 1O6CA 3GVPA 5DSZA 4QFMA 4LMPA 5LJLA 3U81A 5CIYA 4XJSA 3NB0A 1ULHA 3G49A 3U09A 1PVVA 3C3KA 3ESCA 1B0AA 3EIFA 4FEGA 3IUBA 3OIGA 4ND5A 2FPRA 2B0JA 4OL9A 3KJEA 3B7PA 3C7TA 1JN0A 2HO4A 2YASA 3KUXA 4CEJB 2CDAA 3O5AA 1CNMA 2B61A 1SXJA 2Z4RA 2AA3A 3OICA 1SOWA 4TKVA 3H86A 4MR8B 3GL9A 1NZJA 1W6RA 2QN2A 3LJKA 1QGOA 4D0LB 1FVFA 2YIJA 3G0HA 5MN5A 1P74A 4TL9A 3ZD7A 4B3RB 1C8BA 3LHFA 4MW7A 4CMBA 1QG0A 2CLSA 4WVLA 4M0UA 3EEYA 3X1ZA 3ZNPA 4DA8A 5KX5B 2X41A 4CFSA 2VHCA 3WYFA 3F49S 4GQIA 1IOZA 4OU4A 4PF1A 4ROTA 2AFRA 2Z3ZA 3SXJA 3TMKA 4RJLA 2NLOA 3PUIA 5ITSA 3GLIB 4Q9AA 4Z3DA 3ICQB 1DUVG 1CSEE 2OMEA 2QD2A 1TKCA 4BATA 5E9AA 4REQB 5AW3A 5IS2A 1IBLB 1KRWA 4UTPA 2FRVA 2CJWA 5T5QA 2HQSA 2EKPA 1UQTA 3JATB 1HYEA 1TB4A 1E2MA 3IAM1 1YB7A 3RF7A 4BNYA 5C8XA 2Z9DA 3CRW1 3QJGA 4E22A 4LC9A 3AY3A 2CSXA 4C78A 1Y7PA 2ZTUA 2C5EA 2M1ZA 3EZ2A 2UYYA 4F97A 3VPCA 3CUWA 1ST3A 1GL7A 1NRIA 2BGKA 1Z6PA 2QD3A 1N1MA 2W4IA 3NHSA 4L28A 3V8PA 5M04A 1AZSC 3OI7A 4IF4A 1XMSA 2XY4A 4KO2S 5LCXA 3TL3A 4CQMD 1GD1O 4UCWA 3IQGX 3RGWS 3W77A 5IASA 3VNBA 1QPZA 1RRGA 5I9LA 1AZTA 1WHSB 3T4PA 5FWYA 4KBFA 4FMBB 3DA8A 5K01A 4FNMA 1H1LB 2GBGA 1X74A 2VUUA 4P58A 3CSUA 4RIEA 1TC1A 2CCKA 1X8LA 1G3MA 3N2GA 1MA0A 1J99A 3GMIA 3KJXA 5TQ2A 1XN1A 3NM4A 4LHWA 3P0EA 1P61B 4M98A 4DMKA 5KC8A 3L7KA 3VMFA 2C9BA 2H1FA 4X0EA 1M7GA 1RJ9A 1HQYE 1UBLS 2PRJA 1EX9A 1WE2A 3B9QA 2HNKA 4JJAA 4NJEB 3WMWA 3SQDA 1WZUA 4URUR 2DPYA 1TUGA 1R5OA 2BGMA 2WA2A 5C8DA 1WQ1R 4ZMBA 5KYYB 2GYUA 4O2BB 4B74A 5A7FA 2EHJA 3PFBA 4JJ4A 3K5HA 4HWKA 3ZV7A 1EYZA 4PM4A 2BEVB 1T24A 3HLYA 1TGYA 3D4NA 3JW8A 1K4MA 3MN1A 1U65A 3DDSA 3WAGA 4D99A 1HDXA 3R44A 5HS4A 2HWYA 4CKCA 1SC1A 2HX1A 3HDJA 1RLUA 4TV9B 5HIMA 4X8LA 3W4KA 4P54A 2E4ZA 3MOGA 2F3PA 4HGYA 2HCFA 3DHWC 1E5TA 5TVKA 5JFOA 2WMYA 3VPFA 3VTFA 3QXJA 2HYIC 3A2LA 1M1NB 1WU7A 1DC8A 2EIHA 1SHJA 4LXGA 1WPRA 2JGAA 2H4XA 5JD3A 1CZOA 1GKIA 5DWVA 4Z9XA 2ONCA 2BI7A 3GBSA 1DT5A 3L0OA 1GIAA 5AKGA 1I1OA 4BFTA 3WK4A 3UK6A 5JS6A 2I7DA 4LZOA 3OSZA 2QRPA 4BGIA 4POOA 3ADDA 1T2AA 3T1VA 2XNKA 3QWAA 5JZSA 3AF4A 2FEWB 4P7JA 2E5WA 5IBRA 1CY6A 5TGDA 1VE3A 2FW9A 2G25A 3KK0A 4LZNA 4KMMA 2QJTA 4MRNA 3TLYA 5AM3A 1P9NA 3LWDA 2IHYA 5E2BA 3TSCA 5I8WA 2A78A 3BKXA 1YD7A 2H2DA 1N9ZA 3C6QA 4LJ7A 4XVRA 1XZLA 3K1JA 1ZR4A 4TKMA 3PCXA 2ATVA 2YNMA 3QVTA 1EP2B 2OSBA 4MQLA 2BBWA 3GT7A 4ZIRA 4EHBA 4MQ6A 4RXMA 3O0TA 3QOWA 4MWBA 4JBLA 4R83A 2AZTA 1CVRA 5DYIA 5IH3A 4BE4A 3UNXA 3IMGA 3URKA 4KWIA 2DP4E 2AYYA 2J87A 5CEEA 3AQIA 1XAHA 1MB9A 1PS8A 2HRZA 1QHHA 3JVVA 1HTTA 2Q2VA 4OHKA 4S1WA 4W1QA 2MDTA 4YMSA 2W7TA 3SU8A 4B4UA 4PX9A 3R3HA 3FWYA 4R01A 4ZMSA 1NV8A 3BIOA 1U0JA 1UBEA 1JQEA 2NXWA 2NSJA 3EN0A 4JZKA 3LL4A 4Q1AA 4Z9YA 5FPSA 3IO5A 2BFEB 4RXUA 5LQCA 3ZBTA 1TNDA 5AR1A 2FDCA 4XQEA 1EGVB 4NI5A 3RRFA 2YQ4A 5BQ5A 5C80A 3AESA 5NULA 3Q8MA 1PIWA 1QP0A 4J0FA 1KDZA 1SXJE 4U1RA 2HFJA 2NVUB 3FLBA 4JL5A 3UUWA 3NLLA 1BNCA 4BQSA 1Q6ZA 4TMXA 4TV9F 2F64A 5F78A 1Y1TA 2KBFA 2FN3A 1G6Q1 4GZ3A 3I61A 1N36B 1QH1B 3FFXA 4M36A 4JI7B 1KWGA 3RSQA 3H05A 3HGMA 3VR0A 4BE7B 5I7FA 2NUBA 2GBIA 3TR0A 4D9KA 2RI1A 1X80A 1YE5A 3LY7A 5K0CA 3AL0C 2G1KA 2WD7B 1N34B 3HYNA 4UATA 4YRMA 4BNNA 4F9EA 2WSMA 2ZPUA 4ND1A 2FCRA 1SH7A 3IV9A 3Q3CA 1ML3A 3WR5A 4D0SA 1NQUA 4P3YA 4EMUA 2LTAA 2C00A 1V1MB 2VZ0A 1BA3A 2HH9A 3BSSA 4UUNA 3EYWA 3UN1A 1X42A 5JUWA 5K3EA 1XPUA 3ND6A 1S8FA 5DYGA 5LYYA 2GKSA 4EAAA 1TJ4A 2VJMB 5JHHB 1RWWA 1XU7A 1AU9A 1JFSA 4UE3S 5L3SA 1P77A 2X42A 3L06A 4MB0A 2NXEA 1YMVA 4PC6A 3DMRA 4P92A 1KY5A 1ZL0A 3NTXA 1Q7EA 1SN7A 3O4VA 4UDXX 2GVDC 2YV1A 3DB2A 5HG0A 3RU7A 2Q3HA 5E1MA 1B41A 3H8WA 1EE2A 4BVJA 4YAUA 1Z2EA 2Q50A 3VR4D 3OM8A 3OPYA 3V8EA 1FXSA 2XOKD 2C2OA 3CEMA 4NE9A 4GPAA 4DM7A 3PYMA 4O02B 2W6PA 4LE2A 2G63A 4P5PA 4CE6A 1U8YA 1V2HE 2YBDA 4TV8A 2VK4A 1US8A 1II8A 1UK9A 3C1UA 4DSUA 3K35A 1U99A 3S70A 3NTOA 4PPFA 1EFAA 4K3UA 2JHAA 2VCYA 1JTVA 1TA9A 2WYWA 1XEAA 2RHBA 3HNOA 2B21A 3UJNA 4O4IA 3IQZA 1TRHA 2GD0A 4HNAA 4YA6A 1XNRB 3NORA 1SZDA 5FBWB 1WV1A 5TPZD 1X39A 3KOWA 3MUEA 4XOUA 4XLTA 4AZ3B 4KYIB 4RHCA 4BFUA 3CLTC 3A6JA 3F1LA 5B58C 1Q7CA 3VOSA 3VQTA 5DTIA 1XQ6A 3DE1X 5EHIA 3C8ZA 2RHCA 3HUTA 3KUDA 1XRLA 4OVKA 3O94A 5BSVA 1Z39A 2VH1A 4R8RA 2OK7A 3Q40A 3FPKA 2MMCA 5IJ9B 4KAJA 3VSEA 4TS1A 2A86A 2EW8A 5K9ZA 4CR8A 2Z6AA 2MCFA 5KNCD 3LQ2A 4Y0VA 2K7ZA 2BZSA 3CO0S 4COKA 3UC5A 1USWA 1J1UA 2FW7A 2NYRA 3A9WA 1ZINA 2GWRA 3PC3A 1ONOA 5A05A 3IKVA 3M70A 1H85A 1XWIA 4G86A 4MQUA 1VMAA 3L8YA 2JLUA 3HBJA 4TKZA 2Y92A 1WW8A 1F2TA 2HD4A 3I76A 1QIFA 1Y9EA 2LR0A 5AXBA 2RCNA 4N9WA 2WYVA 3NYRA 1GILA 2XBLA 2F8MA 4O1IA 1V1MA 4EY7A 1Z5UA 2BMFA 3NWEA 4JP8A 2XV1A 4MEJA 1S9DA 1W94A 2IBMA 4GDMA 3HMKA 4MVJD 1BE0A 1HOTA 1RHJA 2PJUA 3ENZA 4MYHA 1F5SA 3AB7A 4OAOA 4ZVPA 2DULA 1XHFA 3KDPA 4F21A 2C61A 2HO5A 4DQVA 3EW9A 2JDIA 4RD3A 5HZKA 2V7BA 1RADA 4RTPA 1ZSVA 4G5GA 5CHYA 1UFQA 1IC6A 2CXPA 1L3CA 2GSDA 3UH1A 4DDWA 2QI9F 3EGWA 1AGYA 1PFKA 4NZMA 2JIOA 1KK0A 3A1SA 3IEIA 4C29A 3QMVA 3RB8A 2C3OA 2QK4A 2PWYA 2CLEB 4BNXA 5LQSA 5FUMA 3R7AA 3BMCB 2Q9UA 2XADA 1REQA 1R8YA 3ZTYA 1H42A 2WB4A 5DJ5A 5JWOA 2OQVA 1US8B 1CJTC 3JTEA 1LVHA 2IYNA 2PIAA 3OTGA 1U0OC 1OUMA 3CH5A 2GTHA 3KXIA 4HLDA 1KYXA 3LKBA 4QBKA 4Z7OB 4HWGA 3FCUB 2OFFA 2QJRA 1E89A 3H5VA 1D4FA 1VE9A 2GPTA 2M2IA 2O1WA 1NPTO 1NY6A 3NRJA 3H11B 3B2QA 4I99A 4UMFA 3WE7A 3DP9A 1V1RB 2BFEA 1I0LA 1GLGA 3ND7A 3T61A 2EVWX 5C9ZA 1AK1A 3AI3A 3O21A 3ZI0A 4L9AA 4R84A 4BZWA 3H2BA 5COAA 3P9XA 1MAWA 1WABA 2AZMA 4V0LA 3W1VA 2C07A 3WQSB 3UBTA 2C2HA 2ZREA 4J49A 3ROKA 4QVGA 4GQAA 1OTXA 5ERGB 2UZ1B 5KYXB 1BRTA 3T5BA 1D1SA 3A2KA 3WGIA 2XRZA 1LI4A 3PKIA 4B46A 3UOAB 4D9FA 2Y1LA 2SNIE 4JEMA 1GRVA 4KQJA 4YRTA 5BOVA 3RTEA 5E7QA 2DTXA 1SA0A 2QORA 3LOQA 4K05A 4X93A 1HFKA 4I46A 4QGBA 2QTBA 5JRDS 4W7SA 2LDBA 3WWPA 4AXXA 4D9GA 3WJ7A 4RJTA 4MGHA 3GLRA 2J8ZA 1AN0A 1NW3A 1UPAA 1T0HB 5LA6A 4QM7A 1XEXA 3DPUA 3P0JA 4U7PB 4LJSA 2DSNA 4JXXA 2PKEA 3G2MA 2I34A 2RGYA 1YL6A 4IDDA 1V4NA 1C9KA 1EDDA 3P19A 4B32A 4B71A 2J3JA 1U9CA 1SPBS 5FUYA 5GONB 3SSOA 4B4KA 4TV9A 2RAFA 1NJSA 3FYDA 3ITKA 4EI2A 4EW2A 1KYZA 4P35A 4UD6A 4TRJA 1WKCA 4XB6B 2A0FA 1QU3A 2XOKA 2GPWA 1EB8A 1GGEA 1Z5PA 2H8KA 3JQFA 3MWJA 1T8SA 1WVIA 3SQOA 5IVHA 1ORHA 1WW2A 3G6WA 1HPLA 4HYQA 4LGMA 1C7EA 3WGOA 1GTJ1 2ZJ3A 3LLCA 4R7ZA 4B34A 1O94D 4NCBA 2IYAA 4D8WA 1GQ2A 1OGJA 5BW4A 1D2RA 3ETCA 3QYJA 1MVOA 2G88A 4XWAA 1X1BA 3G02A 5B1HA 4EY4A 5DNCA 2Z43A 5A02A 4N7BA 3GVIA 2QQEA 4RKQA 1WW3A 1MTZA 3EDMA 3IMFA 3IX7A 1U0GA 3HI4A 4FCVA 4RL4A 3RUEA 1M67A 1WNTA 3L0DA 5EN4A 2NZJA 4ZARA 5B4TA 4RHFA 2MINB 2NTYC 4P1ZA 4Y6LA 3H4TA 3CW8X 3EPJA 5BR8B 4WJLA 1WSBA 2CYBA 5E0OA 4CMGA 2SECE 3DPSA 2JG3A 3KFVA 4KJXA 4AMUA 3WDLA 3DUWA 3G23A 2FN4A 1SUPA 1DQSA 1E2LA 2VI5A 2VH5R 3CFYA 3LOUA 2HJRA 1KYYA 1NKTA 3FPFA 2XVXA 3PQFA 1FPMA 3QGMA 5F1KA 3M9XA 4PAOA 4IGIA 1GZDA 4M0DA 3VYSB 1P2BA 5K8VA 1LQ2A 1A9SA 2D1QA 2P0AA 5FWNA 1Z4OA 1DQRA 4BN4A 3LX6A 4I19A 1CHNA 2PKRA 1E58A 4P82A 1X1SA 4HDNA 4F2HA 2R9VA 2J32A 2AMJA 2FRXA 1OBCA 5JSHA 3WDKA 1R16A 4E4TA 1NVMB 4YEDA 4Q7MB 1U9YA 4DG9A 2CXRA 1WDWB 2PRKA 4KFTA 1UFVA 3T15A 4CM6A 5CFNA 2OXRA 3MLBA 4C20A 3EVNA 1SD5A 1UPXA 1XZ8A 3UK7A 2I3GA 2YVUA 4AKSA 4MSUA 1DMRA 2BGGA 4DREA 4HFMA 2QSYA 1R0XA 1JV2B 4EQZA 2BHLA 2CHVA 4YCDA 1LH0A 2OV2A 3OQBA 5THXA 5IULC 1N5DA 2QPTA 4D1YA 3A2MA 3ND5A 1NSTA 4MKXA 1P3Y1 3RKSA 1I4TD 1WMEA 3FRJA 5ETJA 3FETA 3ZLUA 3JQDA 2XCIA 2YNMD 3R5SA 5EKDA 3OEHA 4YHBA 4YQFA 3OOHA 3T9BA 5KOJB 2P9TA 3MIZA 3ZN2A 3UCXA 4EG8A 4P33A 3W4IA 3JYQA 4WXHA 2HDHA 1QM5A 3D0QA 5BUQA 1MO3A 3DXYA 4M87A 1ZA1A 4MV0A 1WF6A 3I12A 4FWIB 4G1BA 2JBAA 1IVYA 3EHDA 4WCFC 1DIGA 3KXDA 5KYUA 2NQ8A 3I6QA 4F84A 3M49A 1U0SY 4MJ3A 4MQEA 2R68A 4QOGA 4U2EA 5E3JA 1FF9A 2PT6A 3BE5A 5M2QA 3KSAC 5G02A 1Y1PA 5JNLA 3JWEA 1NLMA 2E1PA 3A7DA 5K0BA 3NASA 5DF1A 1LPNA 4TWIA 1MEOA 2ZS8A 3Q7QA 3LS2A 1ZNXA 1ELOA 1M2NA 1SVWA 2XD4A 1SCNE 2REQB 1MORA 3KFXA 1WUTA 2P5YA 1TZ2A 2FSVC 4HEHA 1JHMA 4K03A 2HBYA 2XA1A 2ZRGA 4LVCA 1KKMA 2BUAA 3TB6A 3VKWA 4AT1A 4II2A 4ED9A 5BWCA 1G5HA 1SY7A 1U3VA 2OA0A