2KLSA

Apo-form of the second ca2+ binding domain of ncx1.4
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
157
structure length
157
Chain Sequence
HAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKGGFTITEEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKSTVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ca2+ regulation in the Na+/Ca2+ exchanger features a dual electrostatic switch mechanism.
pubmed doi rcsb
source organism Canis familiaris
molecule tags Metal binding protein
molecule keywords Sodium/calcium exchanger 1
total genus 23
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2009-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2klsA00
2DPKA 2KLTA 2QVMA 3E9TA 3H6AA 3US9A 3EADA 3RB5A 3GINA 3RB7A 3FSOA 2FWUA 2FWSA 3E9UA 2LT9A 2KLSA 2QVKA 3FQ4A
chains in the Genus database with same CATH superfamily
3N1GC 3LH8A 2P5EB 3TJHD 3KHQA 1FPTH 2BXZA 3RUGB 2HVJA 5D8JL 2Y1VA 4ODSL 3PYCA 3ULAB 2V5RA 3NUKA 2QPUA 4XTRC 3X1GA 1EH9A 4M1DL 2VABA 5E8OA 1CFQB 4YL4A 2APVA 4PP1D 4NO0A 4YO0B 5D2NC 1GA2A 1MY7A 3GGWB 2VDRB 4NLHA 3QG7H 4X4ME 3QI9B 3PHQB 4U6VL 1FFPB 1S7UA 5IFAH 3SYOA 4PRPB 1PY9A 4O2FA 4I85A 1GYAA 4LSTH 5AYTA 1I8IA 2WGXA 1FZJB 3PY9A 5DD0L 5DMJB 4MA3A 5EIIB 3GBNL 3WNOA 4ZMQA 3P73A 4OZIF 2FR4B 1E6OH 4CDHA 5DGRA 4YSSA 1M71A 5KVEE 2R69A 5D2LA 1WEJH 3TH2T 4YE4L 3VW3H 1D9KB 1IKNA 4NJAL 2I9TA 2DKUA 1ZK9A 3O11A 2ADFH 4PJGE 4I1PA 1JGDA 1WEJL 4DCQA 4R7NA 3TNNA 4O02L 4QLRA 3IFNL 3AJ7A 3VFRB 3VXQA 4Y2OB 3D52A 4KJYA 3QQ4A 4KKNA 5IMMB 1UZ8A 5KJRH 3N06B 1UA3A 4HFWB 3RPIA 3NCJH 4LLMA 4Z7UE 3WIIL 5DURB 3UMNA 1MKFA 5I17B 3MODH 3WKML 1AHWA 2VXUH 3OJVC 4F9LA 3X1EA 3H9SE 2K7QA 2QVKA 3QG6B 1DO5A 4WFHD 1CT8A 2YPVA 2X4SA 1NCJA 3EFDL 2OXHA 2X09A 5DVOA 5BRQA 3RDJA 3ULUF 1JD9A 3TP4A 3N0PB 4P23A 4MDJA 1SOQA 3N43B 4PG9B 1O7DC 2DQJL 5IREA 2K6ZA 5LVEA 2WXIA 4OCWL 1OSPL 4X8JA 3FOLA 2WTOA 4ETYA 4O2CB 4KXAA 3WV0A 2F5BH 1M7IB 4PR5A 4FNQA 1HCFX 3O2DL 3LRLA 1JWMA 5DC4B 3GHPA 3MREA 2PPDA 3FUEA 3ILDA 3CX5K 2WOBA 3JSSA 5E24E 4LASH 3U4BH 2G30A 5DJ6B 4ZXBC 2PF6A 1KN4L 2XQYK 3WTVA 4YFLF 1IAIH 1UXSB 5ICUA 5KOMC 2ZKHL 5EU3A 4PQXA 4XVUC 3H9HB 1JRHL 4F1ZA 1IM9B 3F3HA 1HWHB 3K4ZA 4EXKA 1FQ9C 4AKQA 1L9PA 3FYIB 3S88L 1S9YA 5FYJD 1MIML 4LHUB 1SJHB 4CN4A 2IOOA 5CEXA 4HG4J 1JV5B 5J1SC 2AJ3A 4G5ZL 1ESOA 4P4KA 5ADPL 2R0KH 1IKFH 4JKLA 2AMUA 4N0UE 4JFOA 5DC2A 3A6BL 4ZUVB 3UTPE 2WNGA 4PLKD 1BECA 1FHNA 1XZ0B 3UAJC 3SE9L 1E9PB 1R3JA 4IRJC 4CVZB 3BUDA 1BEXA 3MOAH 1I8UA 2IXQA 5C0NC 3FF8A 4WI0A 2CDFB 1I9RL 2RALA 2QSCH 3VD7A 3BH9A 2V4LA 4HWUA 4MAUL 4JRYD 1E4XI 3ARBB 4ZTOH 3SPHA 1F3JB 1KTKE 6TAAA 2L8AA 2J8UF 3IGFA 2Z4TA 3LMJH 3S0PA 3U1PA 1RK1B 5DHEA 2BW4A 1CB4A 3MBEC 3CCHB 3GXDA 5E4AA 4X4YA 4FFYH 3R06A 1FVDB 2EYTB 1ZPUA 4XP5L 4XMWA 3G9VA 3EYUL 4TXVB 4IU3B 1EXGA 5AAWA 3L17A 3AROA 2QR0A 2R69H 1TJGL 2XQBH 3NGBC 5DA4A 3FN0L 1WS7A 2ENYA 1PLGH 4P04A 4K7PL 2FJGB 1OP3H 3V0JA 3Q7JA 3TEYA 2HLFD 3LV3B 5FGRA 1D2PA 3DUSB 3ZE1B 1QR1B 2BIQA 2YPVL 3QEQA 2X1XR 4ZPTA 3T3PB 4A6YA 4MVBD 2Z91B 3ZL1A 1EBPA 4XCYA 3ZGIA 1G1YA 2XG4B 4R6UA 4U7KA 3SO3C 2Y06L 4W81A 2B9BA 4K8RL 3BVNB 3M46A 3ZTJG 3IF1B 1RP8A 2WXQA 4RDQG 3FTGA 3O0RL 2XVKA 4XMKL 5E1GA 4HAFA 3ARFB 2RTTA 3KJ6H 4L23A 4AL8L 4FA6A 3E8UH 2FX9L 1P84K 1L0XA 1UVQA 4AOFA 4MJ5B 4H13C 4JRYE 3BUIA 3LTVA 5I1DB 4YDVB 5FYJU 3US1A 3L3HB 4OLYL 1CCZA 4KXCA 4XOCA 5ITFB 3LH2L 3TBYB 3GUFA 3KYOA 4N9GB 4WK2B 5KZCB 1CICC 3OKOB 3CVBA 2JI3A 2A83A 4OKDA 3RWIB 1KPUA 3D3VD 5EEVA 4OFPA 1MFAH 1YY8B 4QRTA 3KM1A 3OGCA 2XPZA 1JZ4A 1HXYB 4PGBA 4TSAL 3QXDA 4Y5VB 3WS3B 1G9ML 3AREA 4WWKB 3CHXA 2DQ6A 4NYLA 2B8OT 2FJFA 4GKNB 3QUYB 5D2NE 2Y36L 3ALXA 4ZO8A 1ND0A 1FCGA 2A4EA 3FU3A 2AAVA 4QO1A 5DHYA 3V7MA 3C5SA 3QIUA 1CU4L 1PZDA 4WFED 5EZIL 5ITBL 3K6OA 1S7SA 4JDZB 4LBEA 5E1HB 1IFHH 1U93A 1NTDA 3G04B 4GQ9H 1U8LA 4GW5B 4KQ4H 2D2CC 5J6HA 1RURL 1FP5A 1L3NA 2CGRH 4UNIA 1PY4A 1Q9WA 1RZJL 1II4E 1DBML 2A77H 1NFIB 2ALAA 1KIRA 3MV9B 1C5DB 2RHEA 3NN8A 4YE0A 1WTGT 3KLAA 3MJGX 3ET9F 1INQA 1J1PL 2VR4A 3TBSB 1A6WL 3SGEH 2MFNA 4Q9RH 1NIAA 3JXAA 5I24A 2UUDH 1NFIA 4QHNA 5INDA 3FAWA 4GEIA 5CS7A 2FCBA 3NEEA 1R75A 3Q8AA 1T22A 1YMHA 1CFSB 3BSGA 3H9ZA 3MV7A 1XF3B 4QHLA 1AQDA 4PTUB 4BH8B 3QYCA 4PSPA 2WXLA 1GZPA 3N5AA 3O2WH 4CVXA 5I75C 5DRWB 3BSZL 3IDJA 1DYZA 4WENB 3K6SB 3QRGL 3NDZE 5HJ3A 4FABL 5I28A 4OJEH 5I19L 4QJ5B 2YGVA 1D5MA 4G6MH 4A68A 1M57B 2PTUA 3MRLB 4IRJD 4Z7QF 5BW7C 5I1LB 4M7ZC 5C8JB 1XBRA 1A3RL 4PRID 1VFOA 4XOAA 5F7UA 2IJ0C 5JYMA 2ZIDA 1N70A 3KWVA 4ZAKC 4OT1L 1E7VA 3TF4A 4AWJC 3JTTB 3G3LA 1G7PB 4NT6A 4PRHE 4U3SB 4YDZA 2C4FT 4Q97A 1FGNH 3KVQA 3SJVB 1TTBA 3J7HA 4WW2A 4YWGH 3D39D 2GSIA 1QUNB 2IWEA 3E3QE 5GRXG 2PETA 4GSDH 3KEHA 1E8YA 2XZAH 3KL5A 1U8NB 2QSCL 3KLQA 3FFOA 1MG2C 4GT0A 1YPZF 3C09C 1QFPA 1WG3A 5F6IB 2FO4B 4KI5D 1F00I 5KAQG 5M95B 2UZXA 4LARL 4KKCD 2ARWA 4I87A 1C5BH 3EO0B 1QLFA 1TUPA 1YAZA 2CR3A 1QFUH 3CFDA 4ZFFA 4L3CB 2WQAA 3H0TA 4OFKA 2ZOUA 2Z0UA 3VG9C 4X9HA 3DX8B 2KT6A 2ADIB 3QO0B 5TQ2H 5IB1A 4APQB 2WYZA 4WFHE 1HXKA 2BOBB 2E8YA 3CZJA 2ZNWA 4NO2B 5EO0B 1IGJA 4FKEA 4R3SA 1OAQL 1Z9NA 2EDXA 3EOBA 2UWEB 2IG2L 1GR7A 3SKMB 1AGCB 2DBLL 3ARTA 1MWAB 4D9RD 1KB3A 2YD2A 4GQ9L 3FQ1A 4FG2A 4N8PA 3QDJD 1IAIL 4Z78A 4NKOA 3GF8A 2Z8WC 2AP2A 4TNFA 4E41A 5I1AA 1SYVA 3WMSA 3D4YA 3ZTCC 2XI9A 5J56B 4FD0A 4JKKA 3S35H 3JT2A 4OIIL 3UPCA 2VNCA 1BZDA 5AOMA 3TBWB 2JIXB 1G94A 1UZ8B 2F54E 4JFXA 5I1KH 2QTVA 1I7ZB 4ZD3H 1H3VA 3QEGL 2EIZB 1AZNA 1E27A 4O58L 4LFHD 4AYMC 4YSTA 2CDGB 3SE8L 1RCYA 4RGNE 1RIUL 1OB0A 4X6EB 3V0WL 4HLZH 1AE6L 1K8DB 3DSNB 3K72B 4OCNC 1PKOA 5DZ9A 4AMWA 3FCGA 2W80C 3VXOB 3S97C 2DEWX 5DT1H 4NCDA 4WI8A 4AK1A 1JGUL 5C2BL 1R3LB 4W4OC 4Y5VC 4OD1L 1OAUL 4PVBA 5DMKA 5ISZB 2AANA 3GM0A 2M8XA 3NZHH 3UAAA 1A3RH 5DHXB 1M2OA 1JGLL 2WXPA 3D2TA 3GXTA 4LSQH 4RGMC 1JWSB 3IKCB 1WIOA 3CFUA 4HC1L 3PNRB 1TZ8A 2CQVA 2O5ZH 1SVCP 2CGYA 2C9UA 3SD2A 5KBDA 4DOHB 1KCBA 3D0VA 4NJAH 3BUPA 5ISZA 5DMKB 2XPGB 1JPGB 1FYHB 2GY5A 4MJ2A 3O6FC 1NOAA 3MLTA 2AJSH 2NY1B 1IGMH 2VXVL 1JI1A 3UJTL 3AT8A 2YPKB 2HVKA 3CPLB 3GMPA 4DZBB 2MKLC 4P5RA 5DJYB 4KTDH 4Z3JA 3IBEA 4NRYB 4XVTH 4PJIF 1E3FA 5I26A 3NJFA 2BFVL 4D7PA 1AXIB 5HI4C 3NIFE 2DWSA 4APXB 1PYWB 1S5HA 4XVTL 4LKXA 3CHPA 1OCZB 4LHQB 4BK5C 4X5XB 4PS4H 3HW7A 5CEZD 4XXWC 1E9QB 2EKSA 1JTTA 4Q9BA 4MD0A 2DD8H 3LVTA 4LOVA 1AFVL 1D7CA 3U79A 3G7TA 3CBJB 3R1GL 2GB2A 3E3QC 1M7DA 3LKSA 4IGBB 4N0UB 2ZONA 3VMPA 3IXAA 3MZGB 4KK8D 4LCWD 5BQ7A 2KI6A 2V2XB 4GRLD 4MXVE 4YLQT 5I6PA 1S46A 4QHUB 4JFVA 2H0JA 3UACA 1LE9A 3JV5A 4PJEA 2LT9A 2HG5A 2B1HL 3CFKA 3MMEA 4YX2H 1MFEH 4L05A 3AABA 4H8WH 5AB1A 3TEUA 5I76A 4OCSL 4ZMAT 1TO4A 5K9OA 3T6WA 2P8LB 2X4RA 4IMKA 3SY6A 1CF1A 3KGSA 3WG7B 2WLJA 2YC1A 2FEJA 3QIUC 3DECA 5F7DA 2B5IB 3ILQD 4HUXB 2GC7C 5HHOB 5GRVK 4DP8X 3QQ3A 3DO3A 1UWEH 1NFDF 4Y19A 5CZVL 2KZKA 2P52A 5A2FA 4OM1H 3N1MC 1FYTB 2FX9H 3MNDA 3OJ2C 2VRQA 2A74C 1VEOA 4FLRA 4HGWB 4LQFL 5DMGD 2XWBB 3AUVA 2PYFB 3CLFL 4RMQA 4YHPB 1HWWA 3GNML 3UABA 5DQJA 1XCTA 3ZDZF 3EYSH 5F7FA 4NDMB 1SLXA 5I1CL 4EO5A 1N5AA 1S9WB 1NBYA 1P2CA 2EKJA 5CJQH 3SKNB 3P2TA 1TJXA 1FO0B 1SDYA 3M86A 4ODHL 1RJZB 2NR6C 2J1KA 3X3GH 1XF4A 4A66A 2YAHA 3PFUA 1W0WB 2NY5H 4GKNA 3TBYA 2MSPA 3AAZB 3WN5A 2VC2B 3IRZA 3C6LC 3UG3A 2KZ1B 2VN4A 4NQDA 5JQ6H 3TIDB 1WRFA 2CHXA 4WLCA 5IJCC 4XNYH 4JO2L 1FG2A 1HEZB 1CXIA 4XMZA 4K3EH 5D6CA 1KCKA 5MEPA 4Y4KC 3BFQG 1CFTA 1TTGA 4MASA 2B1OA 3P0YH 2FX7L 2BMKA 2OJZH 3U48A 1U4FA 3B8YA 3FU5A 3BJLA 4WI6A 1BAGA 4MZ3A 1FZMA 4FXGC 4E9LA 1FG2B 1HEZA 4UIMB 4XO5A 2IBGA 1BFOA 3GYRA 3BP6A 2ZG2A 3PNWA 4N3UA 3WUWA 3B9KB 5BXFA 1N59A 1QNIA 3QJVB 1I7UB 4I48A 3CZFB 4S0HA 1U2YA 2A6KB 5FYJH 2WZPA 2JKNA 3DX9A 2VM4A 4O5LL 3RVVD 2ATPB 1RUPH 5IFJA 1UWEL 4KKCC 4UTAA 5HVHC 2CIKA 4QRSB 1P4BH 2V7NB 2Y5QA 1NCOA 2OSLA 1T1XB 4GPVA 4ZFOL 5KVGL 3BRGC 5C2UB 3TLRA 4K73A 1BBDL 4XMPH 3HZMA 3ES6B 2OSWA 2W0FB 1JCKA 4U6YB 4TVPH 3VGBA 4MB4A 4AQ1B 3MNWA 1E2WA 4NQCD 1UM6H 2EIEA 4BBWA 3ABLB 4TSCL 2YQBA 4YBLC 2QMKA 3ARGA 3GQFA 1W6WA 3RWDA 1ODUA 4F3FA 3K6SA 1G9NL 3OAZH 4W9KC 4YDNA 1BJ1H 1EGJH 1YNTA 1MDAA 3KPLA 3DIFA 4TOYH 3P4LA 5ESQA 5IUSA 4LOFA 4QHPA 5AZEH 2CNZA 2I7SA 1F4XL 2XXCB 3JWDL 5LAPA 3PRZA 3X1NA 3MCKA 4TQ8A 4CUCA 2YPVH 1BSIA 4P5MA 1B6UA 1KTCA 4LLWA 3BP4A 2XU9A 3D6GA 4A2MA 3KXFB 4PJHF 1G7PA 4NT6B 3HE7B 4IIZA 4JUSA 1G6RH 3O4LE 1T1ZA 3D12B 3MNZA 4IOFD 3EFDH 1DQLH 3W9EB 2X4UB 4F8PA 1M71B 3HMXL 1W72H 2XNAB 1QWHA 3MOBL 4NJ9H 4TLTA 4MX7A 1GS7A 3FB5A 3V9CA 4EIZC 5DQ9A 4N0YH 4ZSOE 1YEFH 1F3RB 2O30A 2D3NA 3UBHA 4IQHA 4IOIB 3QDGE 1OCRB 4XP6H 1DBAL 1A8JH 4YGVB 1RULH 4AM0B 2D3VA 4LK4A 4O4YH 1F3DH 1BMGA 4GRMA 4YHZL 4KOCA 4BFRA 3CH1B 2BOBA 1NANH 3QYMA 1JPEA 1MFDL 3W39A 2KMWA 4GAGL 4Z7VB 1B0IA 4I1NB 4YHYC 1JN6B 3BPNB 4JM4H 4JO5A 1RV6X 4OT1H 1WZMA 4HIXL 3X12B 1AXTH 4L1BA 3WFDH 1I4FA 1V55B 5K9JH 1V54B 4KKAC 3T0AA 3QEQD 5GGVH 4FHKA 3FOLB 1G7QA 1YC7A 3LZFL 3RP1A 3LQAL 2AZAA 3R06B 1GW6A 1I8KB 4EQ3A 2H6UA 1CDCA 3S3DB 4ES9A 1MQ8A 4QLWA 2C3VA 3K80A 4IDJH 3VDCA 1GZQB 2TRYA 3QDME 3CFTA 1QA9A 2WSPA 1ZHKB 2Z31C 3AW5A 3O4LA 4GEJA 4QJ3B 2OK0H 1X5MA 4UQIM 1OCWL 5FA3B 4AT6B 1R3HA 2X12A 5T3XD 1QTSA 5JIKA 2RAMA 2HRGA 1DL7L 2NX5A 1JXGA 1O6SB 1NBQA 4MXWL 4XCYB 3SOTA 3LEYH 3BQUD 2CCWA 3FBKA 2NW2B 1OSPH 5E8EB 1G9NH 1ZLSH 4LIQL 1XSKA 2PW2A 3KPRB 4FQHA 5TDOA 4BRVA 4EBQL 1SYSA 3KPTA 4MNQA 4LL4A 1KULA 4AYFA 2A38A 2IDQA 4FNSA 3PDOA 1QABA 2DBLH 4XN1A 2OR9L 3UTTB 1JWUB 2IG2H 4KWUA 5GJTL 5IGXH 1MCQA 4L4TB 1DTUA 1I8LC 3D5OF 5FK9B 4EDWL 1E90A 5EBMA 1ZGLA 3GZKA 2R2HA 3SO3B 5C0BD 1TEGA 3LSOB 4YHNA 5E6IC 3UTQB 1JG9A 1OTTC 3LNEA 3IMSA 1M7XA 4HBCL 4B9YA 2GHZA 2EC8A 3BLKA 3ZIYA 2BOCB 1OE2A 1S2EA 3BSHA 4U3HA 1KYUA 1YEKL 4YS4A 5I6KA 2E9JA 4W9GC 4ERSL 2ED7A 5LGYA 5DJZA 2YPLD 2CK2A 4Y4KD 1Q72L 3FRUA 5IG7B 4K3HA 4KK9C 3LH2H 3IMRA 1KCWA 4F7KA 3CZKA 3F6JA 3L95B 4DP1X 5DO2C 2J8UA 2Y6TE 1C08A 4JPVH 1AANA 4L8SC 2FQGA 4CMMA 4WI0B 3OBAA 5L0QB 3TO4D 3ABMB 4L37A 2V6HA 1L9NA 1JGEB 3RDTD 2UX6A 4FTDA 1X9QA 2VUYA 4UF7C 1LP9A 3MRQB 5EG6C 4MMYA 3OJMB 2HTLC 1BYOA 2GUYA 1JHKH 4KVCL 1O0VA 2C7FA 1PQZA 2ZCHL 4WSJA 4QKTA 3FTGB 1KBVA 3MV9D 1MREH 1NCAH 4EKJA 4P2QA 1DLHA 1TU2B 5D5MF 4Q9QL 4OB5L 5IP4A 2PXYA 1PEWA 3QRFM 1N0LB 1UVQB 1WAEA 3U25A 3GMOB 2DS4A 1BQKA 1MCPL 3CVDA 1NCAL 1ETA1 2AK1H 3F7QA 1CURA 2O5YH 3PWPD 5DTFB 2CKBB 4EI6B 12E8L 2HH0H 4H8WC 4GBXA 4Y2DD 4RMRA 2BZCA 3VB9A 4P2QB 2ZYHA 3MCYA 1XHHA 2YD8A 3FZUC 2G9HB 5DZAA 4AV5A 1NEZG 2JQAA 1I1AB 3LMJL 1NBYB 5FO8B 5KSAC 1KXTA 1KWKA 2BY3A 4G1MB 2LGNA 4HV8B 4QRFA 5DTFA 2WN2A 1T0PB 4AVIA 5HHOE 3WNPA 4GFTB 4MYPA 3P4NB 2Q76A 3GS0A 1ASOA 2G2RA 4I18C 1GTNA 3QZWA 4IRJB 3CFMA 5SV3A 3P3SA 3VFSA 4JNXA 5C7XL 1CE1H 4AW7A 3NP4A 5E4EC 4O4YL 4HWBH 3SDAB 1S7SB 3O81A 5EWIL 1D5ZB 4PLKC 1VZHA 3SJVA 1NC2A 4JO1L 5FGCE 5DWUH 2CKBL 3KPPB 3EJYC 3SBPA 4X4MA 3ZRSA 3BVTA 4NQEA 1TQCC 2PO6C 3LKNA 4P46C 4GKZB 3ZTJH 5AW4B 1G7HA 2B0SL 1LO0H 4OLZH 5IKCB 1F0LA 1JZDC 4M5ZL 4ODXA 5K9QG 5KYWB 1T21A 2VDLH 3IDXH 1ZV5A 5KUKA 4GUQA 3LKPA 1TVDA 3G6DH 4L8CA 3TN0B 5E1AB 2DH2A 4X6FB 1QZNA 4D0CB 4D3CL 1QNZH 4JPWL 4GSRA 4Y5YA 2OR9H 3OR7B 3HLAA 4EOWL 3QUMB 1HDMA 4AGOA 3NFSH 3GBLA 1S9XB 2VDNB 3B9KA 2CBPA 4GW4A 2B9AA 2NW3B 4LPUA 5FGSA 2Z65C 1T2QL 3S5ZA 2RCSL 1ECYA 2EIBA 1N7ML 4AE1A 3HNTH 4YHMH 1CXLA 5DUML 4NQDE 4D0CA 1UZ6F 5K9QI 2GCYB 3MGAA 2WXOA 2COVD 2ORBH 1LWRA 4WF7A 4PWIA 2R0WL 4AQ1A 5F1KC 3HBGA 1AP2A 3ZYOA 2BK8A 4XMVA 5EOCJ 2P80D 4PRDB 1TZAA 4E9TA 2B77A 4UYPA 2OSLB 1JTPA 4DFHA 2ZXGA 1F1GA 1OARL 3MBWB 3APDA 1Q0XH 1U0QA 4XBPA 3BO8B 1CO1A 1N19A 4RX4A 4GRWB 2CWRA 4U6YA 4UU9A 3GRWL 4OZ4A 3EJRA 4C58B 3VFMA 2OW6A 4XMTA 2UV3A 1SJXA 2NY2D 2K8MA 1QI4A 4DO6A 1OP5K 2BSDA 3R8QA 2VXQA 4ELKB 2YD5A 4QGTA 3S96B 1MHCA 5JHDB 5HI3D 1C5CL 4LDEB 5D7JB 3HC3L 5TFSH 2VXTH 4C8XA 1RIUH 1F4WH 3VFMB 4IBYA 5DCCA 3SGEI 2H26A 3EH1A 5HHXL 3PP4H 4WFFD 4Z7QE 5B7FA 3N41B 5JW5B 2CK0H 1F42A 4LF3A 3BLPX 2GQHA 3L1FA 1NPUA 3O41B 4H0GA 3VXPB 2IADA 2IDFA 1QTYT 4XPTL 3LS5L 4W93A 3RWFA 3NJGA 3IDNA 2IWGA 2VW7A 3FQ2A 3ARBA 3K2MC 5GS0C 3CZUB 1T89A 3JWOH 1TQBB 4KXZH 5HJGA 3MUZ1 4I9WE 5EO9A 1PIFA 4OD2A 3HC4L 4I3RH 3W11D 3QUMH 1VPOH 1XR9B 2UYLA 3FL7A 3WE6B 2GBTA 5CEZH 4HIQA 3B1TA 1NGPL 2NZIA 1ERNA 2ZKWA 4PY8I 3BCFA 3BEVB 3DGDA 3AADB 1OAYH 5EBGA 1DQDL 1ORQA 3TO4C 1NMCC 3KYMA 1XR9A 5AVSB 3APCA 5FLUA 2C9QA 2UUDK 3AWGA 2OXHB 4Y2OA 1OEZW 4JY6B 1P9MA 3O9WD 1GGCH 3BWAB 2HKFH 3TWYA 2ERJB 3K2KA 2W60A 3RX5A 3QCVL 3ZDXE 1EZLA 3IFLL 4PTTA 2EEDA 3ZHLA 4QHMB 5BPPA 2F0CA 2CJUL 5TGBB 3QCTH 6FABH 3H53A 4NIYE 3MCLL 5E2TL 5E8EA 4KVPA 1R5VA 2ZX5A 3UTSB 3WI9A 3RTQC 2BHFA 5AVTB 4X9YA 1ZA6A 5IW3A 3DC0A 4O2CA 1N26A 2KQNA 4GP5B 3LEXB 4AEHH 1MY5A 1M3JA 3BRFA 1T5XB 4YNYB 2B1HH 1D5IH 2EYSA 1BPVA 5D71L 1A4AA 2QDVA 3LQZA 3O8XC 3EFOA 4GMTL 3FT0A 2R4SL 2OTUB 5D2LE 2M1KA 4X5WA 1IAOB 2XJKA 3B43A 4NZRL 1MIEL 1UXWA 1YJDL 3RE0A 2HVKB 1WP6A 2PW2B 5HHME 5TDOB 3GXPA 4HUUA 1IVTA 3BKJL 1FHGA 2EYSB 4WUKL 5D7KD 2R2CA 4X2UA 5I1HL 1NDMB 3HAEG 1ZTXL 5DS1A 3QJSB 2F15A 3HRZA 3FT3A 4JN1H 4L9DA 1Y6KR 5AVQB 5F7EL 2BNRA 3MRCA 5JIDA 4IBUA 1EXHA 4EAEA 2UY7B 4R9HA 4UV7H 4ZNCD 5LXGH 1UYWH 2Z35B 1ED3B 1WAPA 3RZCA 2HLFC 1U3HB 1J5OH 3VDAA 3NESA 3S4SG 1WWAX 1OVZA 3JWNG 2ENPA 4PJCB 1FFRA 5EN2B 3RGVC 4PP2A 3UBGA 3KHOA 1FSKC 2YAQA 1EGJA 1C1EH 4XBGB 4JDEB 5D5ME 5KOVC 4ANXA 4KVNH 4H40A 3SO5A 2LAAA 1YN7A 4MKTA 1U21A 3RDTC 1TJMA 4KK9D 4A2DA 5JQHC 1FFTB 2LTQB 5GS2D 3FN3A 4Y4FC 1YY9D 2P5WB 3LIZH 1XFPA 3TU6A 4J1UA 4GUPA 32C2B 3T04D 4M1CD 2X1WL 2Y7NA 4MMYB 3VH8A 4A7UA 2EE2A 4PLOB 2DIAA 3GSWA 1IGYB 4XI5D 4HOWA 1C7SA 3TCLB 1J8SA 4O51B 3OPUA 2VITA 3BW9A 1DE4B 3KWWB 2FHCA 5DK2B 3WUWG 4AGNA 3ILEA 4GKSB 4AQAA 4HJJL 1NSNL 5ACMA 1JPTL 1ZLUK 1WC7A 3B9KD 3CBKB 4N0RA 3FSOA 5DJDA 4ZTPH 4HHAB 5D70H 1A1NA 1ZHNA 5DLML 3V5DB 1KBWA 1RZ7H 3ATAA 2X4TB 5DEFB 4X0KA 2CZNA 1PSKH 1P5UC 3NPZB 5E94A 3ZOAA 1HYSC 1MEXH 2AEOA 4R7LA 2BSTB 1H8SA 1TZHB 3OX8A 5HGAA 4PCTA 1RZFH 4BSVA 4TNWF 3UGEA 1P7QA 4OF3A 1CFVL 2AMGA 1NUGA 1QFWI 4KROD 3UEZA 3MBEA 1XF4B 3MGOB 4EIUA 3QZWG 1KELH 3HI5L 4MMZA 4K94L 1KLFB 5KS9A 2WXKA 4W68A 4HKZB 3CXFA 1DJZA 3U9UB 4I88A 5JW4R 4PWHA 2ZKXA 4AGMA 4AGLA 2X0UA 4IOSD 3UZVA 4ZFOA 4PREA 4AQ1C 3DO7A 1WTLA 4Y9FA 2VDOB 5KW9H 1FC2D 1KLFA 4NP4L 5D4JA 5D4IA 3SKJH 4XXWA 4NX0A 4LVNB 1NMCB 2ZWKA 3ROOA 4I3SL 4NO5B 3TVMB 3FC8A 1RZKL 1Y18B 3DJ9A 5I74C 1C12B 4LRIC 3GDBA 2OMXA 4XC3L 5CFHA 4AYBA 5CD5D 4JB9H 1GY1A 2NUTB 3EJYD 4GAFB 4AM0Q 4N1HB 5ADOH 4OLWH 5B1JA 5F7HA 3FNKA 3C08L 1Q9LB 5CJOH 2Y7QA 1FH5L 1JNLL 4N8CL 3VFGH 1OTSC 3EYSL 3ARUA 4NBZB 4QRSA 3GJFK 1GJUA 4NCC1 4NN5B 4ZQKA 3FRPG 4PP1C 1NDGA 4FI8A 4Q6YA 3EOAA 4JO4L 3MV9A 4Z7VA 5FA4A 3UTZB 1EO8H 2BW5A 4GQZA 2UWEE 2BCKA 1BIIA 2CM5A 3VFRA 3VXQB 4FI7A 4LEOB 3PNWB 4JQIL 4MJ6B 3WFCL 4AEHL 2DMBA 1I8AA 3RY6C 1GZHC 2LABA 1O6TA 1AD9A 3QUZB 3IDJB 2X05A 1CFBA 43CAB 1UD8A 2QVTA 4P23C 1OZUA 1NPJA 3GHBL 3HNSH 1CLCA 4MDIA 4TQHA 1SEQH 5KYUA 1F58H 4Z7NB 5AVZB 1FNFA 1FZKB 3ZL4H 5JYLA 4YX2L 1N64L 4OLEA 4KO5A 2VAAA 3L3KB 1TZGL 1BOGB 3CQFA 1I9JH 3GXMA 4DVBB 3ASNB 4Q0XH 3NRFA 1CBVL 1A6TB 5I1EH 1UWGL 3V5HA 2L4OA 3L4TA 4F80A 1JI2A 4ZO7A 3SCMB 4CJ0A 2DYPD 5CBEA 2HPTA 1RPQA 1T2JA 1HSAB 5T1KB 3CVHA 3C6LB 3WGVB 2FO4A 2ZX7A 3TT3L 4KKLC 2MQ3A 1CI5A 3N1FC 1UM5L 1AAJA 3KPLB 2CGRL 3L6FB 1JGVH 4KH2A 4WFGD 2XA8H 3OHXA 4Y4FB 4BK8A 2FATH 3NJJA 3MODL 2BVPB 3L4YA 1CTMA 5JHBA 3G08B 4F33B 1T4WA 2DL9A 4Y19D 5CINL 4C83A 1BZOA 3QIUD 1PNDA 3OHXB 3UEQA 2R1XB 3KPNB 3D69B 3O6MH 5ICXA 2UY6B 3WKPA 1MRDH 4ETQB 5CINH 2ZNXA 1EHXA 4JO2H 3ESOA 1IQWH 4XVUD 4ISVB 4RISL 2XCMC 3QORB 4JY5H 4LLMB 2BJML 5IR1B 2GJZA 1ORQB 3MV8B 1WIUA 3WFHB 1ZXQA 1CYXA 4HKBA 4Y2DC 5IVOA 2XN9A 3KEDA 3RWCA 2MOVA 1M05B 4BKSC 4N9OB 4UOW0 3WNIA 5IG7A 1T7XA 1K5NA 5D7EA 5DD0H 4ADJA 1A6AA 1E5CA 4LVHB 3LOWA 2DH3A 2Q2EB 2QVIA 1I53A 3IWUA 3BFWA 4E9RA 5FOBA 5BVPH 5TF1H 1NGXB 2BSSB 4FZEH 4P3DB 4BFNA 5IFHL 3FFCB 2IFFH 4L4VB 2YMXL 3CSYB 4GIPD 4M6OH 4N2IA 2GT9A 4PV8A 4AC2A 3H3PL 4JGJA 3NCCB 2QV2A 5EUOF 1A7PH 5LNEA 1HNFA 3FULA 3GPSA 1TCRB 2QPFA 2NLJA 3EJTA 3RVUC 3UH8A 2EO7A 4PGZA 4PBVC 1PKQB 2DIEA 4WWNA 5E6SB 4I5BA 3QQDA 3IMVA 5F7LB 3L2NA 2FSEA 4KRMB 3OKDA 1KTLB 4Z95L 1UD3A 4JPIB 2K70A 4YN3A 1A7RL 2BC4A 1P7HL 1WUNT 4FP8L 4QTHB 5EBMB 4N5UA 1N7MH 2LE9A 5B4MD 2W81C 4R90L 4WNQB 1UH4A 3IJSA 1ZLUH 2X89A 2V7HB 4OLZL 5EC1B 2ZSWB 1BLIA 3PXHA 5C09B 3SBQA 2VC2H 1AGEA 2P5PA 3LIZA 4H1LB 4U1IA 4IBLT 3F01A 2HB0A 4F7TB 3QUXA 3MACL 4DZBA 4XMXA 3MRRB 2WKOA 3SE4C 3Q6GL 1AS7A 4XX5A 3OKKB 3FRUB 4RNRB 5IBUB 1VADB 1I9RH 1L9OA 4HU2A 3MLTB 1UD6A 4APXA 3S8GB 3UADA 1IC4H 1F3JA 4P5TA 5DJCB 1MZZA 3C8HA 5EN2A 1G9EA 3VI4F 1VGEH 1MW2A 1KN2H 2OX5B 2R23A 4LLDB 5IW1A 1D5ZA 3QEHA 4FQLH 1FVEA 4ONGH 4Q56A 1MCIA 4MA1C 1XGRA 5EF1A 1XO8A 5KVFL 2PN5A 1H0DB 3N91A 1Q1PA 3K71A 1JXFA 2BNQD 43C9A 2Q20A 4ZUUA 4NQCE 2RFXB 1M1XA 3E9UA 3FCBA 1HTYA 1UT9A 3AMLA 2ADYA 5I1IH 1BM3H 1YQVH 1V7NL 4JKNA 1K4CB 4D0DB 5DYOB 5CGYC 3LS5H 1T83A 4FHJA 2V5MA 3LKPB 2MH4A 5C0RL 4XNAA 2FWSA 3N40P 2ARJQ 4YUEH 1KIRB 4HISA 1LP9F 4NXKA 1CBVH 3P30L 4P46B 1J0IA 4HCRA 1IC7H 4KY2A 2O5ZL 1SY6A 5TDNB 4XWOD 5TH2A 3U1SH 5JIHA 4CMHB 4XT1C 5DEFA 5LDSA 3GKWH 5KVEL 2NXYC 5DS8B 3VGAC 3CN1A 2MPAH 1RIHH 3BKYL 2WB1A 4F3FB 2WYTA 1CXKA 5JPMC 4N2KA 4QYOB 3I6SA 3D30A 4ZXBB 5LO7A 2IALA 2ZOKA 4U05A 3BZEA 2ADGA 1O7DE 4WDIB 1CD9B 1ZS8A 3QFJD 3BAIA 2A1WL 2R9HC 4BH8A 2A5UA 1UZGA 5L8JB 5ETUB 2RJMA 4TLUA 1NJ9B 1OO2A 1CK0H 3I85A 5DHMC 1PLGL 4NDMA 2E75C 1H8OA 5EOCL 4KZDL 3HE7A 2VABB 1I3RA 1MCBA 3EBGA 4HYTB 4ZYKB 2DTSA 1E4KA 5JIMA 1QOKA 4JLRA 1RURH 3BN9C 3D25B 1EZVX 3QI9C 1INDH 3GGWA 2DQHH 3FQWA 1M1SA 4FFYL 5FUCE 1GMEA 3B4NA 2K9UA 2OMNA 1TEFA 3VXTA 3DXAB 3BIKB 3RY6A 3BAXA 3TO4A 4BINA 2MQ0A 4X5LA 2RQ8A 1G7MB 3LIZL 1QR4A 5EUOB 1HHIA 3EJUA 3IJEB 5I30H 2A9NH 2UWEF 3NJHA 2AABL 5C92A 1H3GA 1B2WL 4OVVA 2X87A 2LVCA 3MV01 2AJYL 3QZWB 4IRJA 3HG3A 3LHPL 3FCSA 4LEXL 5CLXA 1WFOA 3CG8A 3LPWA 2J8OA 5MI0B 2A6JA 2WUBH 5J3HC 5TK2A 4P05A 2AZUA 1HDMB 3UZQB 1X5AA 1Z9PA 2W1NA 2JB6A 2YQ2A 1EWHA 3FFDB 2X2IA 2MIZA 3GEWB 4GJTB 2R8SH 5BS0B 4WW2F 1A47A 3IEAA 4Q2ZB 1HZLA 4OI7A 5EO9B 4A7QA 1ACYH 2XWRA 5FO9A 5I17A 3GJFA 2JJSC 4S0TD 2WV3A 4R7NB 3TNNB 5J7CC 1T6VN 1O7SA 4LSSH 4YVUA 1YZZA 2XT1B 5EU5A 1F4WL 3WUWB 2O5XL 4NNPH 1HAWA 1NDGB 4HWBL 2B4CL 4Z6AT 4NWUH 4JQVA 3FSWA 2HX7A 1W8OA 2IPKB 4HMCA 1YEJH 4JJHA 1M2VB 2J1YA 3PL6B 4WGKA 5IBLC 4F7CB 1QACA 2OZNA 3U6XA 1BD2E 4YDKH 3BDBA 4D7BA 2X2JA 3B2PA 3EYVB 4IK7A 3T0EB 4F92B 4MAYD 3DHUA 5KYYA 3R0MA 4JY6A 4N90E 4YLBA 1B4RA 2P24A 3RNKB 2Y5TA 3JYBA 1H3PH 3FUIA 1UB5B 1A6TA 2NY3C 1YLBB 2OXGA 4ODVH 3IKKA 3DV6A 2A9BA 4JANA 3SDYH 4MMXC 3L5HA 2YGNA 3INUL 1U8NA 2A3TA 2SODB 2D9QB 1OPGL 2BM3A 2VB5A 4YBLB 4ADGA 3QCVH 4UIKL 4V1DB 1XB6A 3GTTA 3ERXA 4JANB 3PJNA 4XPHL 4ESKA 3WTWA 1T2QH 4KKRA 1XGPB 3OAUH 4FQIH 4MQ7B 5LGHH 1Q1JL 3MCKB 1A6WH 2CPUA 3MRFB 1ZHBB 5CGYD 1IGCH 4IS6A 3E1ZA 1J48A 2CBTA 1IO4C 2BDNL 1PZ5B 4Z77A 3DMMB 4EI5B 4HIEA 1MAML 4HUUB 1BZ9A 5ESAB 2Y07H 1HHKB 1H3WM 4N0FA 5FW8A 1QLRB 3OKNB 2N56A 4TL4A 5KBKA 1BM3L 4IMLA 1WV7T 4MB5A 4BELD 5AD0A 2MCAA 2JJUA 3H6JA 5IR1A 4FG4A 2JJVA 4JZOA 1C16B 4LPTA 1BG9A 4M3KB 4EN3A 4BQBA 1HIML 1QLRA 1F41A 2BCMA 3OKNA 5ECGA 3C6EA 3WGUB 3D69A 1E65A 4TSAH 2XWTB 4F91B 1WFMA 5JHLA 1G1KA 3O6FD 3QXTA 2W9EL 3WTUA 1CXFA 4XCCH 1U3HD 1HHGA 3ABGA 4BRJA 1X5KA 4MBOA 1EJOL 4YLCA 1PU0A 2C9SA 3ENEA 3BAYA 2NXZB 2GYSA 2WWKO 1I4FB 5J13B 1U3HC 2X6CA 1S5IH 4XE0A 1TU2A 1LDPH 2YZ8A 4QRUA 1NGQL 4PW4A 3G6JF 1N18A 5INCB 4AENB 3GI9H 2CRIA 3A67L 2HCZX 4LBAA 4OCRL 2YZ1A 4N8UA 3VXSB 3EYOB 4H4NA 1ZLWH 1ZSHA 5F9JA 2Q9OA 2Z91A 2BIOA 2YWYA 3I6LD 4G8GB 4QRQB 3AXIA 3VMOA 1JNNH 1D7BA 1EEYA 3VI3E 5BZDA 2BSED 3P3UA 3HUJF 1A9EA 3MNVB 4IRZL 1JOIA 1ZIAA 1EZSA 4PIRF 3OF6A 3QDGA 4BXVA 1COBA 5KVMC 5HI3C 2X44D 3BWZA 5JNYB 1KC5L 2P5ED 3K4DA 3OZLA 2BY2A 4Y5YC 3D18B 4AIOA 3Q5OA 2L7JA 4MD4B 3WL9B 2PNDA 2B4CC 4MJ5A 4G6KH 5C0AE 2JJTC 1QI3A 3OLGA 4MCNA 2DM7A 4IHBA 4NNPL 3HTLX 3AMKA 3K0YA 2J6EH 1ED3A 4R8WL 5EU3B 4GB9A 1WZLA 3KS0J 3KYOB 1TQBC 5DJ0B 5T1DL 2A6IB 4UM8B 3CLEL 3MGTA 3JWOL 2KUTA 3OQRA 5TE4H 4P2RE 2YMOA 1QSVA 4ZW6A 2OA9A 1TOXA 3S37X 1ZV9A 5E00B 3SBWC 1AXTL 2EDDA 3WFDL 5JW3H 2H32A 1EJ6A 4LGSB 3ASOB 5GGTL 4JFPB 3AAZA 3KWXA 1IU1A 1HSBB 3PGFL 4MVBC 1TXKA 3FB8A 3DRQB 3B2MA 4HVBA 5HGBB 4HUCA 1HOCA 1VHPA 3QPQD 4LU5L 4PM1A 1CFNB 3QP3A 4N8VB 3T6QC 1RL1A 1E4KC 4K94C 4YFLI 3VXUA 4M6AA 3MMEB 3EYQD 4GW4B 5LNDA 3THMH 4AQEA 2XZQL 1Q9WB 1BZ8A 5IIEA 2OCCB 5BW7A 1R3IL 3E6FA 3P1VA 3RAJL 4BQ6A 1NCIA 4D9QE 3OPZL 2WXJA 4JFYB 5H2BA 4JRXB 5CJXA 4I4WA 1ILUA 3QQ3B 4A38A 1DVFD 3GMRB 4XNXL 1X7QB 3V0AC 1UM5H 5ALCH 5MEND 2KPNA 2ZWSA 4OFYD 3LN5A 4WU7A 4BQCA 1A0QL 3I2CL 4TRPH 2Q3ZA 3A4DA 1T22B 3AG1B 4BWWA 3WY4A 1GGCL 2OV0A 4DP0X 2EH8L 2IFGA 1GRWA 3D08A 5C09E 1EHLL 4G42B 4ANVA 4OW6A 1P4LA 5D9SA 5MHSD 3HZYA 4XN9A 4PJ9B 2AK1L 4YDMA 3TA3A 2CO1A 1DQVA 2IALB 5BUGA 2X6MA 2X1QA 5BNXD 3KGRA 3VWJC 3KPQB 4LKCB 1AZCA 1YQ2A 1PLBA 3IFPA 4ODWA 5DK3A 4ZW3A 3BPLB 1J5HA 1JDCA 3OB8A 5ETUA 2DQDL 2AEPL 5DD6A 3Q2LA 1HT6A 1EAPA 2AI0H 3QS3A 3T4AC 1ZHLA 3BPOB 5FO8A 1XCXA 2FGZA 1Y18A 1IL1B 4CN1A 1NIDA 3KJ4B 5L6YL 1ROCA 1GYCA 3PGFH 5I1DA 1XEUA 5JPNB 3HR6A 1GTFA 3BH8B 1YC8A 4J23A 1V7NH 1F4HA 1RUPL 1QFOA 2XLLA 3KLHC 4NC1C 4OM0H 2OMTB 1CYGA 4R97C 4ZZFA 5TPWH 4M1GL 1OGAB 3FTYA 1VEMA 4NKDA 1XCWA 1KG0A 1RSYA 1ZA3B 4H8VA 4JFZL 5I0XA 4N6RA 3UIZA 2YEZB 2ZD0A 5JPNA 4GRLA 2Z93A 2DJMA 2N3JA 1AHKA 4G7VH 3OMIB 2VOTA 2QJDA 2JKWA 1SLWA 3DX6B 4P2OA 1AQMA 1KPRA 1PPIA 2FHBA 3ZIMA 5A3ID 1JZ2A 2WBJA 1DQMH 1KNOB 2AJZB 2BLFA 4UM9A 5EUOE 1SM3H 4YDJB 2H3KA 4XC3H 3Q1EA 4POZD 1IEBB 2I27N 3MTRA 4Q8BA 1HKFA 3K5SA 1TMQA 5TQ0H 5C86A 2QADC 1KTDB 4O9HH 3VM5A 3ZTNH 2BOLA 1JGDB 2Y7QB 4GLRH 1HZHL 2XV6B 4OGQC 3QHFL 3SD5A 3VWKD 3ML8A 4ZT1A 1CDJA 3TBTB 1JZ8A 4ZFZB 3FUKA 4UBDD 4F2FA 2CR6A 2B20A 3QGVA 2ENSA 4JHUA 5HYJD 4AEIL 2I07B 3T77B 3ZDXF 1GCFA 1R5VB 3UTSA 2WBKA 5D7KE 3RBSA 5C08B 3ULVC 2WIIA 4HEPG 3LEYL 4S1RH 3OSKA 3ZMEA 1BIIB 3UTOA 1DANU 2QQKH 1I9IH 3EFFA 5LN4A 5F0JB 1T6BX 5EC2A 2NCMA 3US9A 2L7QA 1OGTA 4EDXA 3CHSA 4JFFD 1WBXB 1LWHA 3FCUB 4PSRA 5FCUL 1EX0A 5FM5O 4B3EA 2HVBA 3IU4L 3T3MB 3WHXB 3BGMB 2CGZA 2QBWA 4JAMB 3WXWH 1N64H 1E4XL 2H32H 2NNCA 4XHJC 3KCPB 4JHAH 4B50A 4Y9GA 2NCEA 2H2SC 1JE6A 3K8KA 5IW6A 3AQDA 4U3SA 3P9WB 3VNYA 4BZ2A 4PJAB 1PNCA 1THAA 3WHXA 3U7WH 1INEL 1AC6A 1J0HA 5EZJB 5BO1L 4HF5L 5ICZA 1KT2A 1ES0B 4IBSA 3MZTA 2ITDB 2WWOA 4LF3B 4F7TA 1LK3H 4CBZA 3QC5X 4XBMA 1TZIA 1T1WB 2XXFA 5FHBH 3LSOA 5G4OA 2A73B 2X70A 1VADA 3GZPA 1UQSB 1YEDB 3WD5L 2WNXA 3WE1A 3CFEB 4OV5A 5CU5A 4GAJH 4DN4H 4PJBF 5B1KA 3G08A 4Y2DA 1DFBL 2ARJA 5TE7L 4TUKH 5DRZB 1RUKL 1BD2B 2OZ4A 3FDWA 1AHWB 1YPZA 4NJ9L 5IROC 1L7TH 2W9DL 2PP8A 2DTMH 3BH9B 2X2YA 3QUZC 3CNKA 4L0PB 2O61B 1WZ1L 2E76C 3P3YA 3VX1A 3SDDB 2DYPA 5I5MA 3DI2B 5EIVA 1HS6A 2W95A 5L2KE 4QUOA 3SOBL 1A66A 2D4DA 1WBYA 1KGJA 5F7NC 1G43A 5HYSB 4I0CC 4HZ1A 1R3HB 4N0CC 1E5BA 1NLDH 3V0GA 2EVFA 3R7RA 2O61A 4UB0H 1FDLH 3UO8B 3IJ7A 4JPIA 4W6XB 2F8XC 1M6OA 3RA7H 5E5MB 4G5AA 3MI6A 4JFXB 1MIEH 1YJDH 3TURA 3HCVB 1EEYB 5BZDB 4DKFL 3VRLE 4V1DE 1CLYL 3GMLA 3RA7L 1O5PA 5AWNH 4NHCL 5KZCD 3VXRD 1IFGA 3PGCA 3L3DA 4OZFG 1AQ8A 1SBSH 3V4VA 3LQZB 2VSMB 4HZAA 3LQAH 5KSBF 1BF5A 2GJ6D 4OI9A 1PZ3A 4NQEE 1SEQL 2FBOJ 3F6LA 2PXYB 5J3HD 2HN7A 3VFWB 4PRIB 4YUEL 5DT1L 3GO1H 2NY6C 3SKNA 4D9RE 4NZJA 3KBFA 1JVLA 4F7MA 3OJDB 3LIUA 1BQHB 3UFIA 4OF5A 1J9QA 3CFJB 4KJQD 1OALA 1DSFH 3O2VH 3C8KB 3PWNB 4DESA 3HR5B 2AKRA 4H25B 3HRZB 4HJ1A 1F4YL 4YIQA 4JJ5A 3PGDA 4K9EC 2EDWA 4NZTL 3V4PA 4IEFB 3VSQA 3NCYS 5G4MA 4DNLA 4ZUSA 5DJZB 5ISZE 2Z35A 2AGJL 5E2VL 3WLWC 3FT2B 5MEPB 3RB5A 1XTMA 2VDPH 4P4RA 3MA7B 5JOPD 2V37A 3PWPE 2VZOA 3FT3B 2Y25A 4N3TA 3ZSSA 3VFSB 3UG5A 1PG7L 2FUTA 1FAIH 3MACH 4F58H 2WZ0A 3TIDA 5DHVB 4P23D 4MAYC 4XPGH 5L7XH 4QRTB 5IHUL 5KYXB 5IESH 1ITCA 4FAAB 2LLNA 5DFAA 2F19H 1R24B 2HPOA 3FSZA 5K1VA 4PJ6A 2YD4A 4ALAL 4DUWA 4Z0XB 2ZSVB 5A6IA 4AE0A 2F18A 3C12A 3G5WA 5GS1A 1VKXA 5FYLD 3OXSB 4Z3FA 1WFTA 4HJ0C 4TQEH 4GAYB 5HVHB 3QI9D 2DWXA 3CVIH 1BF2A 4M5SA 4XODA 4LLQA 3A4FA 3CFBA 3ZN6A 3Q8EA 1N59B 3MYJB 4X99B 2IC2A 3PQYA 4ZMOA 1BWMA 3RNQA 3PDGA 4PJAF 2KHAA 3O6KH 4NENA 4QYOA 5JXAH 3BZEB 1PZSA 1S7QB 5BUAA 4RAVB 5FCSH 3CSBA 4IBTA 2TSAA 1I75A 2R4SH 2WLKA 3CXDH 3DOHA 3REVA 3GSQA 4P59L 5H4YA 4WO4A 2J6EL 3MYJA 4X99A 2ZKYA 3SIKA 4P57B 1JVKA 2OP4H 1T1XA 1NAKH 1V7MH 4UT6L 2BNRE 5FXCH 4E9SA 1WS8A 2AFNA 3QDAA 2Y23A 2FIRT 1TPXB 3T65A 4DKTA 4EZKA 3HB3C 3T4YB 4HHGA 1PSKL 3H3PH 4Z0BH 3IDGA 4MJIE 3P11H 1U9KA 3V5DA 4BFOA 1OGPA 4LCIH 5JUEH 4HK3N 3CTTA 4Y19E 2G75A 4BDVA 1FV1B 1U95B 4HLJA 4YGAB 3WAKA 4D8PA 4O58H 2BSTA 1KGCD 1XCQA 2OXGB 5DZOA 3C6SB 4LL9A 4OCXH 3MNZB 1IKOP 1CLVA 3OZ9L 4F20A 3DYOA 4LRNL 1HOEA 2WLMA 1N2RB 3NT0A 3QRLA 4AUJA 3BP4B 3ZZSA 4K9EH 5DQ9B 1E6JL 3P9MA 1H9DA 3S36X 2TAAA 4UTCA 1HNYA 5F71A 5CD3A 2NY1D 4PLJC 3RVVC 2Y24A 3G6AB 2VJ0A 3QXUA 4N2FA 5F0PB 1J1PH 2YBRB 1EK3A 1V3JA 4GRWF 5JW5A 4HHWA 4NBXB 4PRPA 4R7VA 1MCRA 3DMMA 3U30C 3A5VA 3MV8A 4RGNC 3TH3T 3GSNA 5C3TA 2C9AA 2AEQL 2YXWA 3C60A 3INOA 4IOIA 3RPBA 2X7LA 4AJ0A 3AM8A 4MYWB 5HHNA 1KMGA 4JRXE 3JWDH 4OSUH 4IMLB 2Q8AL 3RJOA 1J8HA 1XB3A 3O3BA 5I5JA 1EO5A 1DUZA 3ECWA 3CH1A 3OTTA 4WQOA 2GUOA 3CLEH 4K5MA 2XQYG 1OGAE 1NCWL 3PDDA 1AKJD 1JFQL 1AGFB 4BHUA 5DEJA 3FFCA 2APSA 3JV4B 4L4VA 4ZAKB 5JHMA 1RKRA 2LHAA 4R96B 3D3VE 2R1YA 2XWTA 3TPKA 2XFXB 2Z31B 3L3GA 5AWNL 1WQVT 3WJLA 4IGBC 1TCRA 4RZCB 4MCZA 3D48R 2OR8A 4WO4D 1OSZA 4N6QA 1OTTD 5LN8A 4CU6A 2CO6A 3S35X 3L7EB 5DZNA 3LXBA 3VO0A 5JUEL 1F4AA 5AG9A 4Y9CA 4A7GA 1FH2A 3WEAA 4NC2B 4J6RH 4D8OA 2QQKL 5BV7L 3TEZA 2VQ1A 1XMWA 4B6ZA 1OHQA 1QA9B 3EOTH 1WVZA 3ILQC 4BFFA 4IIQA 1NAKL 1S7TA 1V7ML 2HT2C 2OMWA 4MJJA 3RX8A 2KDGA 4KTYA 2YAEA 5KVGE 1PJWA 2V9QA 1KB9K 1NCCH 1QKZH 4UMSA 1IBZA 3L4XA 1FYTD 2J44A 1WAAF 2Y5TB 5B3JF 3VFVA 4R5TA 3ZE2F 2XWDA 5C0DB 3S3CB 2DMHA 3GUTB 3FSAA 4P9ML 4UUJB 4HKJA 2H1PH 4PJDB 5DJ6A 3SZKC 2Y2YA 1YPZE 3DPDA 1T0MA 4H44C 1JUFA 5EO1B 2O93L 2YGOA 4TVSa 1DVXA 4B9CA 5E2UL 1YNKH 1IM9A 1IGTB 3GS4A 1UJ3C 2KDYA 1YEJL 1P4IL 4K71B 5JDSB 3BPCA 1E3ZA 3FJTA 3OG6B 4XCEB 3ZKND 3B5TA 3CHRA 3CXHK 3T3ME 5CO1A 3TXAA 1MHHA 2EZ0C 5FDWB 1X9LA 1CBJA 4XX1G 4NGHL 4RDBA 2DKMA 1AI1H 3NFPB 1SXZA 1JF6A 1NICA 4UM9D 4F7EB 1OAQH 4ISVA 4L8SB 3OR6A 3QUKA 3KXFE 5TE6H 1KB5B 3BEWA 5AKTA 1C08B 4TULH 5DRZA 4NAMA 4A2EA 5IB4B 1M05A 3NJMA 3MLWL 4JBSA 3W9DA 4R8WH 1MFNA 2HRPH 3KE0A 5ABAA 5L6YH 4B97A 4IMKC 1G87A 2QL1A 3U7YH 2D7QA 2NNAA 5HDBB 3ZR6A 4DK5A 3B7SA 4RRPA 1E9QA 2EKSB 2OYKA 4EN3B 1SNRA 4IU2A 3BHBA 4BZ2H 1I9JL 1G7JA 4OD3L 3LS4L 3EBIA 4LHUG 4RGMB 3JQOB 1A1MA 1NIBA 3IETB 3IVKB 3HC3H 5TFSL 1O75A 5CKGA 2R0LH 1USQA 3PWLB 3GBML 5F1IB 1XIWA 2JK5B 3HZ3A 3OG4B 5EBWA 3VQMA 3IF1A 3CFKB 4XPBH 4JFYA 3MPCA 4E2OA 4X6DF 4DPCX 3L1EA 2QGDA 3K6NA 4WU7B 5JOPE 1TTUA 1BMZA 4GOSA 4HV8A 1OTUD 1FJ1B 5T3ZD 1LNUA 4FGMA 5I73C 2OCFD 4IIQC 1X5ZA 1DDTA 2WZ6A 2DOCA 1P4LB 4KXBA 2VLKD 4GQPH 4M43L 3SSGA 2OTWA 5CXPA 1E28A 3LKRB 2O6FA 4ANUA 1EVUA 4GMSL 3V79C 2HLAB 1N8OE 1LNUB 2VAJA 1LEGB 1MJUH 5DUPH 3RLSA 1JYNA 5I0WA 2UZYB 2HT3C 2N7AA 4LMQI 4H20L 3AS1A 1BX2B 2CM6A 3TO2A 4LKXB 4NQEB 1IGFH 2A0LD 2HJLB 2WBXA 3QUXB 1KPUB 1JYVA 2NPLX 5KJRL 1RZJH 2VQTA 1ML0A 1SUHA 3F58L 5GIRB 1JNHB 1KJ2L 1NC2B 1IC5L 3A47A 3GHEL 5BRZB 2NYKA 1LDSA 5HVWA 5KYWA 5A2LH 5GPRA 1QX1A 3MRMA 3F64A 2W94A 3SJVD 5I2IB 3UXFA 4DP5X 1H9VA 1VF5C 2WGNB 1MLCA 5BQ7B 4U0QB 2ZAGA 3K2UL 5C0AA 3V2AR 2GIXA 3QEHB 3X2QB 3PWUB 1VFBB 5A43C 2XN1A 1OTUC 3OKYA 2ERJC 3P0VH 4X7CC 4EUPA 1FE8L 3DVIA 4JFPA 1INEH 4G6KL 1CGXA 3QNXB 3S4SB 5IJVA 2XV0A 4CVWA 3N50A 1NFDE 2BHYA 3HS9A 2OL3A 2GBVA 2YAMA 3QG7L 2J21A 4PJ7B 3QR1A 4OQTH 1A1NB 1ZHNB 2LW3A 5F7DB 3T6XA 1CTOA 2XXMB 4XNZC 3PU7A 2AK4B 4ACPA 1D6EA 4PJ5E 3FPXA 1HL8A 3V0IA 4B9IA 3FRPB 4KPHH 3GSXA 5CD5C 2QPEB 2ATPA 4P4KC 3QDJB 4WUUA 2D03L 1L5GA 3OC5A 1URIA 1BCIA 1PDKB 5FC9A 4F1SA 4K3GA 5T3XH 5BMFL 1VIWA 4ZTEA 4EI0A 2NXYB 3TS8A 2CHDA 5EORL 5ANHA 1KLUB 4OVUA 4AZ8B 5GJSH 4EIBA 4WHYG 3T65B 3JWDC 3DURA 4GUCA 4AEFA 3L4VA 4Z76B 4L48A 1WF5A 5T1LB 5LAXA 1QSFA 3W0WA 1N2RA 5JW4N 1OLLA 2UXGA 3EGDA 2B1AL 3U4KA 5ANMA 2EDTA 1YNTF 4G8IA 4Q6KA 3L1OH 1A6UH 2ZXCA 4Q52A 2NR6D 3ZKMD 2AJVL 3DIFB 3QJZA 3C6SA 4TNVK 1A14H 5EIIA 2W5PA 4F57H 3FCTA 1LM8V 1QPXA 2DQCL 2ZP8A 1YQVL 2H26B 4LHJB 4DJMA 1EAPB 2UVFA 3DJTA 3HUJA 2DLFH 3F7VA 3FUMA 5GGQH 1U8KB 4WGVB 1B2WH 5ILTL 4JN2A 4A2GA 3STLA 4Z23A 5A6MA 3KDMB 4UQEA 4J3XA 4CDGC 3PAZA 3PAUA 1AVAA 3BKJH 2X4OB 3EUUA 4YC2C 2YPLB 1CICB 4ODTL 1UG9A 4LESA 1MI5B 1E2VA 2NY4C 1MFVA 1NBVH 4GXUN 4M62H 5FGCB 1W72L 3W2DH 3OWRA 4YPGA 1AGCA 4HBCH 1C5CH 3ELQA 1F45A 3BUBA 3K46A 2IF7A 3DTXB 4WFGE 1AGBA 2E6JA 4KUZL 4PJGF 2WO3B 3GFUA 1BBJB 4HS6A 1JAEA 4H20H 3MNWB 3K81A 3EDEA 1E5UI 1T80A 4L1SA 2HG0A 3MJ7B 2I60L 5EIIG 3RPKA 4UNUA 3A6OA 2OMBA 5HDRA 1YEEL 2APWA 3FQRB 3HE7C 3MLVL 2Y6SD 1T83C 4K5PA 5CJQL 4LVOB 3VWJB 4NKQB 4KXZI 1R5WB 3LZPA 1E8WA 3V7AG 3WNJA 4AIZA 2Z7WA 4JL2A 1CG9A 3MRGA 4LCCC 5AW2B 4WV1B 1PS3A 3GSRB 4XZUA 3EF4A 2R1WB 5HVFB 2JWYA 3BGFB 2Q6WA 4LLYA 5HGHB 2NUPA 3LH9A 1S9YB 4K9JA 3GPEA 4XBPB 2WAQA 2FGWL 2AAAA 3LPFA 3PJLA 1JF5A 5F72S 2NY3B 4P2QD 3LEXA 3GSVB 2OQJB 5I6XC 5EFIB 4GUOA 4WHTB 3N85L 4U1GB 4QPEA 1UA7A 1DJYA 1ROWA 2JLPA 2OKMA 4UILL 2LV4A 1Y6MR 4YFDB 2R8SL 4HCRH 1U4EA 2P8MA 2J25A 3BZDA 2ZSWA 2AHIA 2V8MA 1QW9A 4GO6B 4ZODA 3IFNH 2Y07L 2DYSB 3SDAD 3QULB 3SQBA 4ERSH 2C8NA 3Q3GA 2G4EA 4FNPA 5E6UB 1R19A 4NFBA 4QF1B 1A21A 3SEPA 3CPLA 3CDCA 3A6BH 1JXJA 3GMPB 2NYZA 3KLDA 2V2TA 1BD2A 1ZANL 4MNGE 2NTFA 3G5ZB 3WFHA 3RDTB 3DMMC 3RL1B 5LBVA 1IBBA 4RCAA 1NCUA 3EUDA 4MQXC 4U6TA 4KRLB 1ES0A 3WMQA 5D2NA 4GBXC 4TMPA 5F7AA 3KLSA 2PPFA 4D9LH 4E42B 1LO5A 1BM7A 2EXTA 4B9JA 2VR5A 3GWJA 1LE9B 3P2BA 4XP1H 1VLXA 2OFQA 5HYQA 1JPFB 2FJGA 2Z9TA 3FO2A 2K3TA 1J1XL 5H2BB 3IETA 1N6QH 2W0KA 1NC4A 2JQMA 4P23B 3U36B 4RMBA 4R90H 4DVRH 5EOTB 5BZZA 4LIQH 4DETA 1AR2A 1WT5C 2IWKA 1OCOB 4K7PY 5B7EA 3ARGD 2VLKE 3QFDB 2HT4D 3IMTA 5B1JC 1MF2H 3G9AB 5DYOA 3UX9B 4YXLH 2YXMA 2H6PA 4H26A 3MJ6A 2BSEA 1MWOA 5IEKB 3WJJC 1MCPH 5AVUB 4K7PH 2WW8A 4KX9A 4Y4HB 1F02I 4J4PC 3ZDYF 1L0YA 5E6IB 1U8JA 1U8PA 4E9VA 1K4DB 2PWGA 2VDQB 3SN6N 9CGTA 5HXMA 3GSNH 1MCCA 4FXLA 3VXNA 1HHHB 5KSVB 1TVHB 2XG5A 1IQDA 1OF2B 1OF0A 1BHGA 2YK1L 4IJ3C 2AITA 1I3GL 3KLLA 4C4UA 3BC9A 3ZX1A 5JXAL 4MDRA 5DUBB 1IBGL 3S34L 4Y1AB 2HLAA 2NDFA 2AXFB 3S7GA 4BGDA 4JQIH 2WTRB 1JFHA 5JHLH 5I1IL 3DYMA 3TO2B 1UCBH 1ZANH 1OB1B 2DRUA 1MFDH 4RWYL 5A2JH 5AG8A 4L8BB 5D7IF 3A4EA 1XCQB 2E86A 4K55A 5L0QC 1TJHH 4PWGA 4U1KA 2ICEC 3N42B 1RULL 5D6CB 2B39A 1BFTA 3CFJA 4R7XA 5E5RB 2X6BA 3GBNH 2CKBH 3FQWB 4YK4C 1KWGA 4YHOL 3CC5A 5CN2A 3RVUD 5I2IA 4XX1E 3FU7A 3VXRE 3HG1B 4FL4C 5LGKA 3N44F 3ZO9A 2P43B 5CCKH 3HB3D 4PI0A 1VB9A 2VR6A 2QQLH 3MYZA 4EUPG 3WS3A 5BXFB 4Y7MA 1T3FB 2YBRA 3QJFA 1TDQA 3AQZA 1XSOA 2UZPA 3T0XA 3CVHH 4XNQB 3L9RB 4U6XA 1DZBA 1U58B 4B53A 5GS0L 5SX4I 3IK2A 1ANUA 3Q5TA 5JORA 1Y1DA 3LNFA 3ZT7A 2WXMA 4PN6A 1JZGA 1R24A 3ARFC 2A4ZA 1VFBA 2GI7A 2VN3A 3O2VL 4LEOA 3PLYA 2ESVD 1EHKB 3T2PA 4BIKA 4NERA 1RLWA 3ABZA 4XR8C 1OCCB 4XRCB 5DC9B 1ZLSL 1QVOB 4EBQH 3RZCD 5FWRA 2GUOB 1MW1A 1A3QA 2Q5BA 4JRYA 2HYMA 1A7QL 3CZLA 2K0RA 4X8GA 5IMOA 4UOJA 2NY2B 2OZ4H 1LXMA 3FOMB 4F24A 5IOPA 3QUHA 1EHAA 3B7YA 1A6PA 4N28A 1WITA 4G7YH 4PV9A 5GXBB 4K7FA 1Y0LB 2ZT9C 1FRGL 1P5VA 3QA3A 4PB9L 4PW9A 4X4XB 4OZHB 5EIQA 2BNUB 5SWZA 3V5HB 1HU8A 3CSFA 3QEUA 4XP9H 1N9PA 3RL2A 2HJKA 2QFPA 2CMRL 1AZRA 1RZ7L 4OGZA 1A2YB 2PO6B 3IDMA 3RIAF 5D9SB 1XVSA 5IQ7L 4PJ5B 1BVZA 2NQDA 4GAGH 5C07B 3WO3B 5DI8B 3QEGH 4LCVA 1QLFB 2EYRA 4BGLA 4DP4X 5KEZA 1NUDA 1EDHA 1ECZA 2XNAA 4PJIE 5HY9A 3H9SD 5C0DA 4HUVA 4UTAL 2FAUA 3DX8A 2VQ4A 4PLNC 3LKNB 3DA0A 4G8IB 4ILDA 5FLVA 4CJ1A 4MA1B 1P6FA 1T1ZB 3IPBA 1I8IB 1KBPA 3ZKNC 5GSVB 3PFQA 2EC9T 4OGAC 3T2NH 3F5WB 2ROYA 4DEPB 2ZE0A 1MCNA 5DD1H 5DRXB 5DO8A 4FQXB 4RESB 2DQTL 5KN5B 1QLEL 2E9IA 3NVQA 3QDMA 4JZNA 4Z7UB 1C5DA 2KLRA 3GMQA 2ZCZA 3QHZL 1XEDA 4FQCH 5TQ2L 1CVRA 3I50H 3T8MA 5CBAA 4L4TD 4P07A 5AZ2L 1ZT7A 3BVVA 3D0LB 4Y4HC 2CBMA 5J06A 2JCCF 2UY6A 2QQLL 1GGBH 4F7EA 2XFXA 4XPGL 4PMEA 5C0BE 3ZZLA 1JV2B 3LN4B 2I9TB 5D96B 4OD2B 4W4NA 2VXVH 4M7ZB 5DFVC 4ES8A 5EHFA 2BWQA 3EOBB 4UM9B 3VX0A 3W9DB 3MRPB 4YSCA 1QFWM 4H5SA 4S1QL 4EKXA 1XGUA 5K1JA 1J8HB 2QSQA 3MLUH 3V6BR 2CDEA 4YHIB 2QKIA 4Y4KB 2F08A 2YPLE 4HAGA 5CIPA 1KTDA 1TPXC 3NIGB 3CHOA 2PPEA 3VFPA 1WZKA 1MI5E 4UNVA 1K6QH 3MKGA 2HT3D 1BBJA 3JT0A 3IE4A 1R5WA 3OXRB 2VLRD 3MFFB 5AW6B 3P9LB 2VMFA 3L4CA 4HP5A 4S1RL 4TKWA 1Q4NX 4PJIA 2ZXWB 3QC6X 2HUHA 4EN3D 2VW4A 2NW2A 3F7KA 4G80A 3UG4A 4X9GA 2VGLM 1I9EA 3QZPA 3J8F7 4ODUA 4F15B 4I3GA 2VJ8A 3RGVD 2CO6B 1H6EA 4FABH 5EUKA 4OZFH 2ZF9A 1FCCA 4G11A 1T0MB 2R7EB 3L5IA 4JFWA 3MRIB 3QXAB 5BV7H 3AU1B 3VGDA 4APQC 2VAAB 3L3KA 2NSXA 5CZXD 1KLGB 1BYNA 1KXHA 5LG1A 1P5UB 5JDSA 1VFAA 2FWOA 5FB8A 2VDOL 3VE0B 2FX7H 5GISL 1PW3A 3JWOC 3QIBA 1EIBA 4WNQA 1GGYA 3QFGA 3GXFA 1CL7H 1RQ5A 2YUZA 4G6FD 5FWQA 1A6VL 1JS4A 4M00A 2VM3A 2DWDA 3DDGA 1LYQA 3HPLB 1NCDL 3EDDA 2CG9X 3J2PA 4QHKI 3O4OC 4TQIA 2UZIH 5FUCC 5HDQH 5BVJA 4I2XA 1JYWA 3BDYH 4CVZA 1A25A 2WBJC 1HCYA 2ZOOA 5DR5H 1AG6A 4S11A 3TV3H 1GGBL 2YARA 4YHNB 2YXVA 5GS0D 1M7DB 3B83A 3IPEA 3LKSB 2YJLA 3HPJB 4IGBA 4KTDL 1QNZL 4JPWH 4NN6C 1KGYE 43C9B 4EJ1C 3T0DA 2BVQB 2XN0A 3DUUA 1RK1A 2LU4A 4PJFB 2DLEA 5IEHA 3KPSD 2EACA 2V9TA 3DGGA 4HK0B 3T3PE 3MLXH 5MEQB 2Z8SA 3OQ3B 1PYWA 1S5HB 4IU3A 3FQXB 5DJAA 5CLYA 1UKSA 4OH2A 1LO5B 1OTSD 1DVUA 3IT8D 4L3FA 4AJVA 4AENA 2X6VA 2XKNB 2CRZA 4RWYH 4UYQA 1WZAA 5SX5K 4HKBB 2X2HA 1OAZH 1GOFA 1BFVH 3DGGB 1MJ7L 3O9WC 4QXGL 3MLPA 4Y5XB 4POUB 2WXNA 4D0BA 3BP5B 2EE9A 5IIEB 4J1UB 4DT2A 3D0AA 2AV7B 5BOPA 1T7VA 3BOVA 2QGCA 2OMUB 2JQZA 3HG4A 4XVOA 2ED6A 3EG9B 1TNMA 3TCLA 1TVHA 4H26B 2VLLB 1UFGA 2PLTA 4J8RA 2GVYA 2IH8A 4EF3A 4HFUL 5AOKA 4TLKA 1P7QD 3EJZD 1KJ2A 4D94A 2EUWA 2VR7A 2IQAB 1I85C 1EEZA 3VM7A 1VENA 4ZD3L 3W57A 5DJDB 5IHZB 1X5IA 4PVMA 4JFFA 4G59C 3EG9A 4HS8L 1P4UA 4OAWB 4XP4H 5GSRA 5KG9B 3TVMD 4PJXE 3QVAA 1FO0L 3WIHA 4KXDA 5ERWA 3ZQXA 2FH6A 2EDFA 1KTBA 2BNRB 3ARWA 3Q8FA 2QTEA 1NEUA 4XN4A 5IHZA 1VFMA 1VGKA 2GAZA 1J9TA 1KXVC 3MUUA 3C6LD 3MJ8B 4R0LA 1HI6B 3HAEB 4M7JL 1N3NB 2NXYD 3QIBC 35C8H 2H0FA 3AY4C 3CC5B 1OAXL 1J1XH 3TESA 2VQUA 2YN3A 3NAAL 4FQCL 2F7IA 5MI0C 3P4OB 5ANME 2YGQA 4TUKL 2XQBL 2EXSA 2XACC 2BRQA 2YMTA 5I1GH 2A6JB 1GHFL 4Y1AE 4F7PB 1PCSA 5T1LD 3PHOB 4L9LA 4V2CB 3OGCB 1YNKL 4NLAA 5FFOA 3G5YA 1J11A 2Y6SC 3TN0C 5J89A 2F61A 1E30A 4N2BA 1E3XA 2ZJSH 3RU8L 3MA7A 1WFUA 2EE3A 1NM4A 2IBZX 2J1ZA 5IHUH 3L2MA 4UQAA 5FHAL 3QT2A 3E2HB 3EGXA 4WKZB 3QIUB 4EN3C 1UB6A 1ZLVK 2O6EA 5DD5L 5EBLB 4KHXH 3OR7A 3RY4A 5GRVL 2X10A 1CD1B 3AXHA 4YH6A 3M1BA 2DQIH 2EIJB 2FBJH 4GXUM 1BF8A 1X7QA 4HJTA 2VXQH 4J3SA 1FFNA 2J8UE 3S88H 1WC7B 1KC5H 1X9UA 4TTDC 4RBPH 1S7VB 5DFTA 4HFUH 5F9DC 4PUBL 1CDGA 4TYUA 4EE2A 1GZPB 2FT7A 1BJ1J 4FG0A 4I9WD 4EEEA 4PJXA 4CN6A 4LSRL 1RUML 4ZTPL 1PG7X 5F3FA 1KB5L 2E3VA 4JGMA 4OR1A 5GJTH 4OCSH 3FQTA 2CIKB 2W9LA 4K3JL 1U41A 2FJSA 3R7QA 4CVXB 4DPBX 4BK5A 2JKLA 1GAFL 3RUGA 4N2DA 4M6MH 4PV9B 1ZSDB 1T1YA 3KPSA 1NCWH 3KWTA 4KDWA 5HYIA 3MXWH 2WN3A 3U1QA 1D5MB 5AVRB 5JDJA 3S5YA 3ISWA 2HJKB 1QBBA 2Z8RA 2VDMH 4ZPVB 3T77A 2A9MH 1DQQB 3B2DC 2WKGA 1EXUB 2WCSA 3H56A 4JM2F 1AS8A 5T1JA 5KTEL 2RD0A 4I89A 5GS0H 1C1EL 1HCZA 4R83A 1FL5B 2VL5A 4LAQH 1B9KA 1R4XA 3NCJL 4I18A 3RRQA 3ABKB 1QQDA 3CVHL 4IDJL 3EO0A 4Z9KB 4POZC 4PU2A 1GYVA 1FZJA 5HGDB 4MQ7A 4HQQL 4A6YL 4Z7AA 3OPZH 4NUJB 1X6LA 4Y7OC 1IT9H 3HC4H 4I3RL 3NA4A 1N10A 2F53A 2EEBA 5C0CA 3F83A 2QQNL 1CICA 4LIQE 4ZMYA 3U7AA 5T5NG 1Z66A 3F7YA 5G2NA 1MQKL 1IEAA 2V5SA 3I6LE 5HI4D 5J12C 3S37H 3IJYA 3KPMB 5CBAB 3X11A 4BZ1A 5CEXB 3ULVL 4PBXA 4P9HC 2R83A 2WIMA 4MB1A 4LAJH 2I32A 2WYIA 2JH2A 4PJEF 4Y2LA 3SQBB 4JDTH 1LEIA 4NEHB 5KN5A 2KYIA 3MLSL 1M53A 4NCC2 2BSBA 2C5DC 1FFQA 1R34A 2ZG3A 2X6UA 3ARFD 1ZGLM 2BNQB 3U0PB 3HFMH 2APFA 5LGHL 2RA1A 4YGVA 5LJYH 1U8HB 2CMRH 2VLJE 1G7LB 3RFRA 5C0GA 1FL6B 3RIFK 4QRUB 5F89B 5D1ZA 3U0TB 4NQQA 5I8EB 3U46A 4W9IC 5HGGS 5T1DH 2YFOA 5DVNA 4HUNB 4QTIH 5HYQB 1JN6A 2AI0L 4JY4A 3NSXA 4ODSH 1BXVA 3HI5H 3MJWA 2Z1PA 2V17L 3ARDB 4IOFC 1UATA 1MCWM 2GJPA 2NX5E 4GXFA 2YUVA 1GPOL 4I13B 4P46D 4WV1A 4E5XB 1UCTA 1KN4H 1SPDA 3C5ZB 2APBA 1LK2A 4DTGL 2WXHA 3SPGA 4ODUB 5INCA 2CA3A 3BVDB 5EORH 5FCUH 1AMXA 4UZGA 5ESQB 3RTLA 3SGDH 1FJ1A 2VJXA 2JCCB 4JS7A 2VDLB 4ZX5A 3MRHB 5TTRA 3UGXA 5IOKA 4ZPTB 3KYNA 1PTZA 4P5MB 2J5LB 1E8ZA 3WY1A 1HQRB 1OCWH 1U30A 1GIGH 1ZS2A 2P28B 3QFJB 4FXKB 1FWXA 5CJXC 1UT2A 5AFAA 5AW8B 3WBDA 4MD5B 3O3EA 1QSEB 2L7UA 5D1QD 2GI0A 3ZDZE 3SYCA 4XP5H 3K7UA 3GSOB 1OQXA 2VMDA 5G4NA 2PTTA 4P5TC 1YEHL 2ZYSA 2P26A 3I50L 4W9JC 5E6ID 3GM8A 1YYLL 4RQQA 3GUTA 4XMUA 4NQCA 2GBUA 5ACZB 4XNMB 1A7OL 2J7LA 4DEUA 1VFAB 3ZTNL 4HIJB 3BPNC 4M3JA 3G6DL 5JW4M 3WDJA 1XH1A 3GB7B 4MTMA 3ZHKA 4FQ1L 1XGPA 4X6DE 4BZ1L 2H1XA 4KTEL 4BZYA 4TUJA 5H35A 1HSBA 4MXQC 1FG9C 1S7WB 2WK2A 3K2UH 4FNRA 1CC3A 4Z77B 4ODTH 1EUTA 2ODHA 2VCOA 1I8LA 1MG3C 4JVUA 5FDWA 1AOHA 5HHXH 5ADPH 1WYJA 4K5LA 4QY8B 4AYEC 2EO1A 2P4AB 2P5WA 3UAEA 1KYDA 2BY1A 5AB2A 1IBGH 1TTFA 5J1AA 3HJ0A 1TG8A 3FT4B 1CR9L 1NGXA 4P3DA 1K2DB 3N85H 1EDQA 3ZJAA 3SDXE 2E8ZA 1U2HA 4J8QA 4WK4B 3SGKA 4MQTB 1DEDA 1UASA 1BZQK 1KCUL 1QYGH 3QJXA 5AOJA 5BCAA 2B7DT 5SX4H 4P2YA 4KJWD 5FFGA 1QHQA 2ALWA 4MBRA 3CJJA 5J6SA 4KK5C 4GUPB 3FU8A 2DQGL 3FF7A 4GAYA 3PS6A 5FPIA 3DPBA 5E9DA 5I71C 3AUWB 3PQYB 2JJWA 5DURD 2X2UA 3HZYB 1QHPA 3IXTB 1ZDQA 5F1NB 4B9KC 4R7DB 1YHPA 5L9DL 4UAHA 1BVKA 4WIQA 4HOXA 2RBLA 5F1IA 1KCSL 5ESVA 3CDGA 4BCXA 2KLSA 4HGWA 1MREL 1NIEA 2ZUQB 3BMVA 2I60H 4AYFB 1N0XL 4Q7DA 5C0FA 5MENA 1UOLA 4LP5A 1UJ3A 2AK4E 1DQJA 3OKOA 4EOWH 1FBIL 1HILB 4JK0D 4FFZA 1IM3A 1JZFA 4ABVA 2X1OA 1D7DA 4FS0A 3BVNA 4Y1SA 1CLZL 5AW7B 1XGQB 5I66A 5C8JA 5K59E 2ZICA 3UTQA 4OF6A 5IK3A 2Q8BL 4QXTB 4L0ZA 4AITA 4O02H 7PCYA 4IRSD 4AJWA 1EERB 2H6OA 4C56E 1I3RB 2RH0A 3OHMB 4N0CD 4ZYKA 5EDSA 5I23A 7CGTA 5IBUG 1C8PA 4XXDB 3VFNB 2G4GA 2PO6D 4HLZG 1QRND 3L3HA 4JFSA 5ENWA 4EUPH 4QXGH 3B2UD 3TNMB 1W16A 2YOCA 1OAZL 3D3VA 4XP6L 1I1CA 1NCGA 1AMYA 3IDYC 2IV8A 4H1LG 2XFGB 4DSYA 2BH0A 4MWFB 5IQ9A 3V7AE 4CBPA 2OBGA 4FOMA 3FUHA 1OKEA 3FU0A 3V9EA 2Q8AH 4ABUA 3BSZA 3Q48A 2NRDA 5ENWB 1LWJA 5E9DE 1KXVA 1K4CA 4BUHA 2YEZA 4D0DA 5A3IC 5JW3L 5E99H 3CIAA 5KS9E 3Q8CA 4I77L 1M56B 3RNQB 1K5WA 1NAMH 3EH4B 4HG4K 3VFUA 3NPSB 1NUNB 1NL0L 3WIHL 2YD7A 3OL2A 4FX5A 3PP4L 4AL8H 2CU9A 2WXFA 4LRIA 1CDHA 1T3FA 4OZIE 2DDQH 3TV3L 1AD9B 1XMEB 1RY7B 2EO9A 3EO1B 3FTWA 4ZQKB 3QIWC 4I0PB 3TN0A 4G7SB 5C0BA 5KSAB 3H7BB 1CGWA 3H6AA 2O72A 1BQRA 2XQ0A 4MXVF 4PB0L 4M61A 5CSGA 5FA4B 3UTZA 2JI2A 1A7RH 3QUMA 5HJDA 2JTDA 2ZCLH 1INDL 1QD0A 3L7FB 5F7WC 5SWSE 2ZUTA 3UC2A 4KO6A 3MCG1 3M45A 3QRBA 3MV8D 1WUZA 4PJXB 1DQTA 3U2IA 4BDVB 1AIZA 3B9VA 3PAYA 1PLAA 4JMXA 1R0AL 5C08A 3GIZL 3OXRA 4AVHA 5D96C 1CK0L 2Q86A 2HRLA 3EYUH 5AVVB 2A7BA 3LJ3A 5EFIA 1F90L 1DLFH 2NY0C 3TBVA 3WKMH 4EI5D 1JK8B 4FA7B 2ENJA 5ANMB 4G80B 2VLRB 1QMUA 5IT2L 4IGBD 2N59A 4G1EA 4JW3A 5D1XA 4YK4B 4P3CL 3W9EA 1KYFA 1SZNA 3BFOA 5T5NF 2X9WA 2ZWZA 3BIAX 4Z7NF 4XAWH 4WGWB 1S7RA 4AQZA 1UACL 4KKPA 3IJHB 3ASWA 3O6KL 4ZS6D 5EO0A 4MQSB 4W9ZA 2YO3A 1AO7E 3IJYB 3KPMA 3L3JB 5GRJH 3STLB 2X7LB 1NIFA 3OSVA 3AWFA 2Z4QA 4L8CB 2ITDA 3U82B 2GJRA 1KENH 1UUNA 2BSRA 1SVBA 4WCYH 1MRCL 3ETSA 4KMQA 4WWKD 4N2AA 5B3SB 2Q3XA 3MRJB 1AZVA 2BNQA 4B96A 3RWFB 1B0GA 4W70A 3ZYZA 4DPAX 2OULB 4BM7A 1YYMH 1MAMH 3QDMB 1XXDC 3BKCH 4KMTL 3I3EA 1IGJB 1JJUA 1NOLA 3MU3A 3S2AA 2JLLA 2ZWNA 3CSYA 4P49A 1ZT7B 1A6VH 4M8VA 3TPUA 4GI8A 2GJJA 4QMEA 5E2VH 1ZY9A 5IEKA 3AS2A 3IFOA 4M7KL 4P06A 5CCGE 5KWYC 5I8KH 1UGKA 2GFBA 1RUQH 4U1NB 2P5EE 4JREB 4XWGL 2JCCA 4AGQA 2ITFA 4IRSA 3ZHFA 3QG6A 3NBNA 1JRHI 2R7EA 4IDLA 2X4PB 2PKDA 5GZNC 3VRIA 3EFOB 5IT2H 1V27A 2CCVA 5C0CE 4ZSOA 1QATA 3VWJA 1CD8A 1PKQA 4FQ2L 3VD2A 4PTTB 4Z7OB 2VXSL 1FLTX 1UXSA 1KIQA 1RZKC 4UANA 3GSOA 3PV6A 1VERA 1FFOA 4OF8A 4PGDB 2NX5B 5LB1A 2GHWB 4JQXA 1ONQB 4LCCB 2ZOTA 3JWNE 4WW2C 4J6IA 2D0HA 4IBVA 1MFBH 4YZWA 2QPSA 2QVMA 4CAGA 2ZPKH 1ORSB 1YECH 3OMZA 1U92A 4MNQB 4JAMA 2XIBA 2Q7YA 5KAQF 4S1QH 4FQXC 3CXDL 1R9FA 3DETC 3RVTD 2XRAL 1GSKA 3GD1C 1FH5H 1JNLH 4IKIA 4PRAA 3BPLC 5TF1L 5IFHH 4PPTA 5ID1B 3RHWK 1XZ0A 3NZ8B 4OGXL 3ECUA 2IAMB 3G5VA 1HEJC 2FWUA 3MJ8A 4ONOA 4KZEL 2VDQH 4G3YH 2E9GA 1N6QL 1JV5A 1KGWA 2VN5A 3HA0A 3CVIL 4L8DA 5FF6A 4XN8A 3IU3B 4P2AA 2FDBP 5PAZA 1I82A 3TFKC 1NL0H 2BWDA 2XN9D 3QULA 2EDBA 2RIKA 4OCYL 3WIHH 3ZO0A 3BDYL 2AVGA 3REWB 4AMKL 1KJVB 3HC2A 3FHAA 3Q06A 1J5CA 4YVNA 3FH5A 4PJAE 5KTEH 5I6NA 3V4PH 2A73A 2X70B 4Q6IC 4KQ4L 5BRZA 4XP4L 4M7JH 4L8DB 2CO7B 5FF6B 2HAZA 4U1MB 4ZOEA 4PJ7F 3U36A 4JM2D 2FK9A 2ZXBA 2PPCA 3D9AH 4AQ8C 3L95A 4LSDA 4ZAKA 2BP5M 4QXWA 3TZVB 1LP9B 3MRQA 3HBPA 5I1CH 5EB9A 5J1AB 4P9MH 4DP9X 3VA2C 1E6JH 1H15B 3D4ZA 2Y36H 2BXYA 1BQ5A 2G5BB 4YHOH 3IS1X 2YQ3A 2GTZB 1L7IL 3O8XB 4PRPD 1KDJA 4B5EA 1KFGA 3O4LD 2AGJH 1FNGB 1UM6L 1SFHA 4KJQC 1QSFE 1AY1L 1PFCA 2NSQA 3L5XH 4P57A 5L2KA 3OD3A 4GY4A 1U3JA 4OY9A 2BNUA 5SWZB 4BKTC 2H0EA 4N20A 4Z3EA 3VWKB 4QTFA 3US0A 2EILB 1RJYB 5D7JC 1ZS8B 3CGTA 1OM3L 4PHZA 2IAAC 1OT4A 4YSQA 1E4XH 3TH4T 1OOAA 2E0PA 4QWWC 1OM3H 3MRKA 4AZUA 1UA6H 4MQXD 1WICA 3KG5A 4NPKA 3CMGA 3IWVA 4KY1H 1E28B 3LKRA 3MSPA 4N5EC 1OOWA 4UT6H 2VDKB 2DPKA 5CJBA 3KLKA 4AVJA 2V9RA 1A7PL 5IJDC 4IHOA 3F62A 1SBSL