2KLSA

Apo-form of the second ca2+ binding domain of ncx1.4
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
157
structure length
157
Chain Sequence
b'HAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKGGFTITEEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKSTVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sodium/calcium exchanger 1
publication title Ca2+ regulation in the Na+/Ca2+ exchanger features a dual electrostatic switch mechanism.
pubmed doi rcsb
source organism Canis familiaris
molecule tags Metal binding protein
total genus 23
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2009-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2klsA00
2QVKA 2QVMA 3E9TA 2KLTA 3FQ4A 2FWUA 3RB5A 3RB7A 2FWSA 3GINA 2DPKA 3E9UA 3EADA 2LT9A 3H6AA 2KLSA 3US9A 3FSOA
chains in the Genus database with same CATH superfamily
1WE5A 5MEOB 7FABL 3TOPA 2OW6A 4M5ZH 1A6VL 1Y07A 1J9SA 1G0XA 2AZAA 2BVPB 2OXGA 3UO1H 4YHLL 3ORJA 2DD8H 4NCC1 43CAB 1SNRA 1D2PA 1KV3A 1OT4A 4PV9A 3ASOB 2EYTA 1R0AH 3ZO0A 2EECA 5EIVA 4FFVC 4S11A 4X6BB 2W0FB 5MENA 2AJVL 3CN2A 1NCAH 4JKWA 4ELME 2PKDA 2OR8A 3WY1A 1VFBB 5D2NC 5ISZD 1EAQA 2OFQA 2CBMA 1CC3A 3EF7A 4B3EA 3BKJH 5JQ6L 5LN4A 3NJFA 1H6EA 3F2LA 3SYOA 4FG2A 5DA0B 3NDZE 4JG0H 4MJIA 4RFEB 2ZKWA 1QWNA 3L9BA 5D7HA 3DO3A 3SSGA 3PDGA 4GRLA 3PHAA 3U6XA 1KCWA 1D5RA 3ML9A 4J2QA 5DVOA 5FYLH 1EO8L 2WXJA 1INEH 3UIZA 5I75B 1E8XA 5LGJB 2FWSA 1QRNB 2J8UB 1HFUA 4QTHB 4OJCA 3UGXA 3S9DB 3LKPB 1CICB 2ZCZA 1NJ9B 3P11L 4X6FA 1Z32X 1HILB 4XNBA 1I1AA 2FQGA 3D08A 4HHWA 1O75A 4NI6A 1RUQL 4O2EB 2WLLA 4UB0H 4YL4A 3VXME 3T1FA 5EEUA 1ZKAA 2YGVA 2A6KA 2J4WL 5C0AE 1AIFB 4KJPD 3T65B 5J06A 3QORB 1D5ZA 4WUKH 1DBKH 3U6XS 3S8GB 2EDRA 2F54E 5EORL 1NOFA 4Y5XB 5FO7A 1AY1H 2FWOB 4G71B 1OCWL 1G6RB 4QXGL 1NCNA 4MDJB 3VRLE 2QFRA 1LDPL 2BK8A 3GKWL 4RA3A 2H26A 3MBXL 3NAAL 2WANA 4KKBD 4KXDA 4DH2A 2AK4B 5JHAA 1P6FA 1KCRH 3UZQA 2F19L 3KBHE 4K3GA 4U3SA 4Z7QB 3MRFB 5LQBL 2EYRB 4Z3FA 4NUPA 4ZMWA 2IV9A 2CGRL 1D6EA 2OULB 1PX8A 5F7LB 1WBYB 3OHXC 1FI8C 2A83A 1HEZB 1V7NH 4K5LA 5DHDA 4YH6A 3QBTB 3VFOB 1B0IA 2VXSH 3BQUC 3JV6B 3UTTB 3US0A 3TXAA 5MP6H 5M94B 2BHUA 4DP0X 4J28A 4UT9A 1LE5A 2BSCA 4GO8A 3PRZA 3U7YH 3WY2A 1U0QA 4MDIA 4XNYL 4HK0A 1U8MA 2CIKB 3D4CA 3O3BA 2HJKB 1YC8A 4LARH 5CJ5A 4DOHE 1NINA 2CRYA 4IRSA 1XGUB 2ZNXA 3SCMB 2OL3L 3ESNA 2GIYA 3TIDB 4N0YH 2ARJB 4K55A 5FC9A 2OL3A 2R9HD 1DTUA 5I2IA 1TQVA 4QHUB 1RZIA 1YHPA 3NIFE 1J1PH 4XN5A 3AWEA 2UXVA 2L7EA 4OCWH 1LEIA 4JJ5A 4PJ9B 4HPHA 4NQQA 2EDXA 5PAZA 1JCVA 3EDJA 1WEJL 4FXKA 1RZFL 1TQTA 1XIWC 4PV8A 1I8IB 3BD5A 3F00A 2AABL 3ZDWA 2XZZA 2Y1YA 2X38A 3CZEA 2FO4B 3KYKH 3VFNA 4NIKB 1WAAA 4URTB 1IZKA 3D9AH 4U0RB 5CD5C 2Y23A 5C08B 2FT6A 3BYTA 3QZMA 5DRNB 5I26A 4PWIA 3VXUA 5F6HI 1WHPA 1PLGL 1CLCA 1JHLH 3T71A 2WLIB 2BSTB 1EDQA 4LHUA 4OF7A 2LTQC 1X5MA 3C8HA 1MCOL 4M7JH 1GGUA 5D7EA 2WBJD 3ZXAC 5HDQH 1J0KA 2Y5EA 4KH9A 1SXSA 4FQLL 5CLWA 4V2CB 4O2FB 3CH1B 2EACA 3JWOL 5E2WH 1T0MB 1FVCA 3KL0A 3V79C 2BVEA 5FECB 3CFCL 3WTVA 2P7TB 3LCYA 1LK2B 1A9VA 2Z35B 4L4TA 1GCYA 1T6VN 1PZSA 1RCYA 3UTSB 4OSUH 1MCHA 2EDLA 3HG2A 4R2GB 4TF4A 3SE8H 3AS3A 1YLBB 3INUH 4PJ7E 3RWGA 3SKJH 4XP5L 2L7UA 1VPOL 3QDMD 4KVPA 2GI7A 4NRYB 4ZDHA 4MQ7A 3WFEL 1JZFA 3GRBA 1AO7A 3TEXA 1PZ5B 2AQPA 2E56A 5CP7A 3HR6A 5IK3B 3AXHA 1TUPA 2YGPA 1SDDA 2H0PA 1NCCH 4XHJC 4P2YA 3QUXD 4M93C 4OI9A 1SJHA 3BT0A 2QFPA 5A6LA 4M48H 1LWJA 1XFPA 3HS0C 1SRDA 4PJGF 2DYPA 4DKFL 4BZYA 4ANXA 4ACPA 1HE8A 5K39B 2OZNA 5D1QD 5C07D 3KXFD 2WCSA 3LNFA 4JANA 1CU4H 5B38A 4KQ0A 4NHCL 4G42A 2Q2EB 3ZTJG 2NX5A 2NXZD 1P9MC 4JFPB 3WNJA 3QXTA 4NHUB 5DURB 5E8NB 3CMOL 5EU6E 3ZHKA 1OCZB 1C5CH 3IDIA 3R1GL 3IDUA 4MNQD 3W9EB 1MDAA 4NJAH 3FO1B 3GB7A 2A73A 2DIJA 2WXFA 2XZCH 2XKSA 1DLHA 2V2TA 4MMYA 5HI4C 5IKCB 2OMWB 2IEPA 1SMAA 1ZAGA 1VB9A 3GZQA 3SPGA 3B5TA 2KPNA 1BZDA 2E8YA 3MBEC 2CO7B 1BVZA 3L4CA 2PPFA 3G9VA 4DN3L 1GYCA 3FTGB 4QRSB 3FN0L 4GS7C 1DN0A 4FLOA 2XFGB 5J9PB 2IAMD 3B9DA 1CF8L 3U48A 1P84K 2XN2A 3D18A 4EN3B 1R3IL 4Y5VB 3TEWA 4JZOA 2DLHA 4RISL 5GSVA 4QRQB 5IUCA 3MUY1 5DMIL 5K69A 3T8VA 4BDVA 3L5HA 1ZGLB 3PP4L 3EDEA 4IU3A 4TSBL 1R4XA 5BOPA 4S1SL 2ZKMX 2Q86A 3SE9H 4R0LC 1ZIAA 2WQXA 3NCCB 4OD3L 4P49A 4QY8A 1QBLL 3VAEA 1MUJA 3WO3B 3GDCA 1CT8A 4AITA 3D2UD 2FH6A 1HT6A 5AVYB 3JWDL 3S34H 2JIXA 2WINB 5D1XE 1NCHA 1Q9KB 4PY8J 4UILH 5ECJE 5LBGA 1N64L 3OKDB 1F41A 3PPEA 3SDAD 4CSZA 2X0UA 5C9JB 2R0ZL 4QTIL 2EIZB 4H5SA 1J11A 2NY3B 2E7MA 2R4SL 4Y4FB 2Y25A 4R7NB 5C0DA 3VVVA 2HT4C 3OM3B 1MFEL 1XTLA 2H3KA 3C6SA 1AD9B 1OP5K 4BEIA 1FJ1A 3V6BR 1S7RA 3H9SD 2NXYC 4HOZA 3RWEA 5C2BH 5D96C 3IGUA 2EDMA 2CPCA 2BRRL 4XZUA 5HHNB 2MCMA 5A2CA 2CO2A 5F9JA 3MZGB 4J3UA 1A14H 4ERSL 3BP7A 2XTJE 3AU1A 4HKXB 4YSEA 4L5FH 5L88H 2GTWA 2TSAA 3C5JA 2DOCA 3AM8C 4MWFB 4LSSH 2J1KA 1EXGA 1Z9NA 2CBOA 1JWSB 4P2QE 4PJIB 5IVOA 2Z4QB 3TP4A 4D8PB 3HKFA 3L3HA 4YSCA 4UAOB 5BV7C 1EJOH 1GS7A 1U3ZA 1KPUA 3MLXH 2O61A 1QKZH 1OPGH 4XGZA 4HUWB 5D1ZA 4Q9CA 4RSVA 2WC7A 1KYDA 4Y5YB 4PJ5B 3O11B 5K33A 1S3KH 3RZCB 3AAZA 1X4ZA 1ORQB 4UV4H 5DYOB 1NZRA 1TJXA 2FSEA 5JPNA 4ONHB 1ADQL 3J27A 4M29A 1ZXKA 4ICWA 1ADQA 4D0DA 3IJ9A 1LEGB 2E9BA 4BA8A 2HLFD 3L9RB 3QIUB 2WSDA 4EEEA 3VTTA 4P46D 2UZXB 1E5YA 3OL2A 4H1LH 4HIXH 3T0EB 3EHBB 4K94H 5ID0B 4ZNEE 2W65A 3B1UA 3BVNB 4A6YL 3GT6A 4GMTL 1HCVA 4O58H 4KZDL 1UFGA 5E5UB 5JYLA 3NCYS 1DLFL 3VDAA 4JQIA 1T7XA 5DD0H 1ESOA 3R0NA 3PWNA 4RQQA 2XT1B 4FXTA 5K9JH 3U4EB 1HJCA 2XFXB 3LKNB 4Z0XA 3UERA 1JNLL 4J3OF 4PP2A 2ZZUT 4HSAC 2LV4A 3G5XA 1YPZB 4JREB 4P2CG 3K2UL 2XETA 4G7VH 1A7BA 4ADGA 5KSBF 4N0UA 2F08A 4XBEH 3RFZB 5AVXB 3DIFA 3TJPA 3CN3A 1OGTB 4Y19A 1A6UH 1PG7H 1UWXH 1A9EA 3CD4A 4H25A 3P30H 3STLB 4JGNA 4ZX6A 4N2MA 3Q2WA 1SOKA 2YZ1A 2JXMA 4RWHA 4YSOA 2VITB 3CQFA 3P3TA 3N6YA 1PEWA 4I77H 1P84J 1P5UC 2KLSA 4X8CA 3U36B 4GG8B 3DMMC 3BAEH 1GIGH 4UT6L 5DJ0B 4YX2H 5I66A 1YEEH 2R56L 4I18B 1N3NA 2ZXAA 1A2YB 1NUFA 2ZXBA 3NCJH 4IDJH 1OP3K 5L7XL 3HAEB 1CXIA 2V5SA 4KTEH 2EDKA 1UB6B 2NZ1A 2VISB 4U1LA 3S2AA 1DANT 2JE8A 1IGCH 1PSKL 3L4UA 1F3DH 4P4RA 2I32A 3FB7B 2K70A 4BK8A 5I1GL 4C55A 3LDBC 2VN4A 4WVRA 3RKPA 3HB3B 1G1KA 1HL4A 1Q72L 3O3EB 3VXMD 2J8UF 4YE4L 2LLGA 4FYSA 3F58L 5C3LD 3EGDB 3ESOA 4XXWA 2D4DA 1GKEA 1JPSH 1YN7A 5ENWB 5D2NE 4CILA 1MLCA 4FQ1L 3EH3B 4QXUH 3HKZA 3BAJA 1VZIA 2JKXA 3B7TA 4JKPH 2ZX8A 4QXVA 5HI3D 5IF0A 1UA3A 3UP6A 4GKSA 4JO3H 2EC9U 4NZFA 4A7SA 3MJ7B 2Y07H 5ESAA 1FHGA 4ZO6A 1A7QL 1P0SE 1XGQB 3LXCA 3QUZC 5CEZL 1IIKA 4R7XA 2B5IC 3HI1A 5FGBC 3ABMB 2KZ1B 1K4CB 4JM4L 1VGKB 1NGQH 3DGGB 5IW1B 4YDVB 1B4LA 5D1ZI 9PCYA 4Z7QF 1A1OA 1EEYB 2PP8A 3N85H 3NJVA 3PIQB 4PTUB 3EAKA 1W9XA 1JK9A 3OTTA 3VFPA 4IMKA 3A22A 1NPUA 5J12B 5IB2B 4Y4HC 2H8PB 2BIOA 4PEEA 2FX7H 5EZIL 3VQLA 3IRPX 3AT9A 1VSCA 3LH2H 1C7SA 3Q8CA 2KZWA 2Q8BH 4NZDA 1NEZG 1JHKH 2ZOUA 5E94A 1JNNH 4JO4L 4ZD3L 4I3RL 3T09A 5BOZG 5C6PB 4NC0B 4UNVA 1ZHBA 2OMVB 3KPQB 1FFTB 5AAWA 2MCG1 2EKSB 1RZKC 5KVFL 3DXAA 3PGCA 2PXYB 5ITFB 1KY6A 3BKYL 4J5VA 1W72H 2X3BA 1IKNC 2XZQH 1ZXQA 3V7AE 1ACXA 1WHOA 2ITEA 3RURA 5CGYC 4KNUA 1NDMB 1RFDL 4MQXD 5ISZB 1J8HE 2K8QA 1XEUA 3OF6D 1UJ3A 1OD9A 2YWYA 4R97C 4DUXA 4OQTA 3D06A 4LHJB 3SYPA 1M7UA 4FI6A 5G55A 5HGBB 1R5IB 3D3VD 4FTVE 4ENED 5I6LA 4UM8B 3FQXA 3WL9A 2Y6SD 3NDYE 1PZ2A 4OGYL 4PREA 4Z8FL 2OAAA 3ZTCC 5ANMA 2C7UB 2GJRA 4LLMA 1R46A 5IBLD 3VU1A 1BLIA 2O5YH 5HVHB 3MV7D 3KBEA 3T0XA 3EO0B 1JGDA 5TPWH 3WS6C 5ILTH 5F7MC 2MOVA 4NN6C 1ZA6A 3ECVA 5AVVB 3RWCA 5IEHA 4HK3N 35C8H 1YMMD 1AH1A 1JD7A 3QHZL 4PPTA 4QLWA 5HPOA 1E50A 1N70A 1NOAA 3GMNA 3N43B 2HP4A 3BUYA 4BRVA 5KYUB 2GC7C 4F92B 1NAML 2R2EA 1X7TA 5CMAA 3LYRA 1NAMA 2XNAA 3LN9A 5DUBA 4GXVH 4S2SB 2W8CA 3CC5A 2VKWA 3F05A 4NIYE 1N10A 3RVXD 2CE6A 1BXXA 3FJTA 5ALCH 1HHJA 2VLKB 3QNZB 4JFYA 3FB8B 1WICA 4OGAD 3QI9C 3WN5A 2I5YH 2NY6D 1NCWH 3HI5H 2D8KA 5F93C 4EI5B 3QJFB 1JGUL 1YQVH 3IFLH 4GEIA 1RUML 4YDJA 2VC2L 1BDYA 3LNEA 4PJAE 4PJ6A 5JMRA 3OMNB 4K8RH 3WAKA 4TLUA 4NKIH 2O93L 1NEUA 2GTQA 4HUUA 4IRJA 3GMOA 2WXHA 2XBTA 1LO4L 1WD9A 2MHAB 3DVNA 4OZHB 3ES6A 4OJFH 3O3DA 2MCPL 1FVDB 5I0WA 4QLRA 2J56A 2KKQA 4R96B 4BSVB 3M6DA 3LY6A 3QEQA 3QQ9D 2AK1H 2BOBB 3HC4L 3ARZA 5KS9A 5GJTL 3ARDA 1E7VA 3VFRB 5ID1A 1MKFA 4U2YA 4HZAA 2ZWYA 4LSQL 5C7ZA 3ULVL 4HBCL 4MCYA 3BPCB 3Q2NA 2AQQA 1SXBA 1BVNP 1M6OB 5D6DA 2Y3AA 4X7TB 2EINB 4PYGA 2PYEE 3MVSA 1F4XL 1QBBA 15C8H 1XXDC 2R0WL 1TYJA 3GZPA 5D70H 5GJSH 1FC2D 3NCWA 2ZQKA 4Q0XH 4ELDA 3PHQB 1Q90A 3OR7B 4GAYA 1TQUA 3X14B 5EZLB 4XXDA 1MRCH 1F6LL 3BRFA 3LRGA 2Z3FA 1MCEA 3OV6A 3H9YA 2FEDD 3DSFL 3QFJE 4NOFA 2WXRA 1OTSD 2ZYHA 4FL4C 3GIVB 4PGDB 4B7IA 3HZMB 4NFBA 5TQ0L 5HVGB 1QFOA 2WBJB 5IB3A 3TA3B 2NDGA 3HZKA 4LSVL 3L3IB 3L3GA 4AMXA 4BHUI 2HG5A 3W0WE 4FZ8L 1WWWX 2P42B 4KJYB 4IOFC 2DDQL 3VD2A 2B0SH 2VRQA 5DQJA 3ZR6A 3GINA 1D9KD 1BIIB 5J6GA 5EBWB 3SPJA 1ETA1 2E9GA 2WN3A 4ORGA 2H1PL 4EDXB 4LDOB 4Z95L 4XCFL 2D03H 4GUCA 5IQLA 5E00B 4C54A 4LOUD 5FPIA 1IVTA 1E65A 2ZCKH 2Y7SA 3F3HA 4JM2C 3VRJA 4PJ8A 5D4HA 2V3DA 3QDMB 4I9XA 3IGAB 4A2FA 2VO8A 2CLVA 3QR0A 4N2AA 5FOBA 3AG3B 3C5ZD 1E28B 1M05B 5D7KE 2PCFA 1KLGA 2ADJA 5DD1L 1J88A 1FE8H 3PGDA 4WI9A 5E03A 3QUXB 4OM1L 4DFHA 2OZ4L 5MHSE 4K73A 2QT6A 5TE7H 2OZ4A 4L0ZA 4W9IC 4PRHA 4KRMB 3MLYH 4QIRA 4LSPL 2DBLH 4WWKD 4JFFE 4QYOB 3PS6A 3MJ8B 2P52A 2Y2TA 2R0LL 2X4SA 3HE6D 4NI3A 4QHLA 5DMKB 2BERA 3ILDA 4RIRA 2Q8AL 1AKJB 1MIEH 5J11B 4XBMA 5L2KE 3VGAB 5DMYA 4LRIA 3JWNC 1JRHI 3HUJE 3MA7B 2F8XC 1H6UA 1Q1PA 2NXZB 3HPLA 4PJIF 3UZEA 3FTXA 5I73C 4Q9BA 3CZUB 5D4QA 4WSGA 1DBAH 1IM9B 1W0VB 2Q3ZA 2ZF9A 3G6DH 3KPPB 3MRRA 4TVPH 2GK0A 4MNQB 4NZUL 2EADA 3KHQA 4Z5RB 1IQWH 1I1FA 4LL1A 3ARFC 2R8SL 1AGFB 4N2GA 4PGEB 4DZ8A 4Q97A 3UYRL 3FSWA 3V95A 4MB3A 1AR1B 4WV1B 5EBGA 5AW6B 2YJQA 1JIBA 5EA0L 1CWVA 2JCCE 1IX2A 4ZRGA 4F8TA 5IW6A 2BLFA 3TYFB 5J13C 4M5ZL 2IAMB 3HZVA 3HG5A 4GW1A 3UO1L 1Z3RA 1GTFA 1WA0X 3MGTB 1P53A 1W80A 2DD8L 2ZPKH 5TE6H 4IS6A 3BW9A 1OANA 3CFJB 4XE5B 4Z7VB 1R0AL 3EO1A 4PRIE 1CFMA 2APTA 5J5EA 2ICWJ 4GRWB 4XC3H 4NO5B 2ZUXA 1HWWA 3OB0H 3WSQH 4WUUE 3VX0A 4TQPA 3N3EA 4MSWA 3FU7A 1NCAL 2O6FA 1M7DA 4DJMA 4FNTA 4A68A 4LKCA 3D2UB 3Q1SH 1JYNA 2HT3D 3UTPE 5DFAA 1MI5D 3BKJL 1YPZF 1JN6B 3ECBB 4FZEH 5ICZB 1MVFA 2YQ2A 3KJ6L 4HF5H 4HKBA 3WFCL 1U93B 2VUOA 1DDTA 4JG0L 4TPRL 1IGIH 1KELH 4E9WA 1NCUA 1QABA 3FAWA 4GXUN 4ABWA 5F1IA 4Y89A 1S5IH 4ONGH 3SDYH 4W70A 5FYLL 4CC4A 3IFOA 2Y22A 3MRLB 5CWSB 2I7SA 3BZEB 4AGNA 5FEBA 4F20A 1KV7A 5LXVA 4ZJ9A 3H9SB 1L9PA 3KPTA 4P2OB 4U31A 5JZ7D 5AYUH 5FKPA 5C0BE 3I3BA 3OLDA 3QDJE 3DO7B 4UB0L 3DOSA 2HLAB 3WE1A 5FYKD 5HGDA 5DWUL 4X5PA 3UL4A 2ZCHL 5B1AB 5BNXD 1KIPB 4ZTPH 3OMIB 4HCFA 4HEPA 2I24N 4MNGB 3Q13A 4AUUA 1AY1L 1WH0A 3CPUA 4IBYA 4ZAKD 3MLTB 5AEAA 3IB4A 5SWQA 3UAJA 4BZ1A 1MVYA 2W38A 3WLBB 5GGVH 1KCRL 4XI5C 3SN6N 1NBYA 5KG9B 2B1HH 3S88H 2WVUA 3B6SA 3LQAH 3QUYA 1DN2A 2AJUH 1BZOA 5T5FH 4KOBA 3BMWA 4PI2A 1C5BL 3ZTNH 5F3BB 4I89A 1UKQA 1XF3A 1V7NL 5HVFB 1M2OA 3QB7C 4LLYA 4KMTH 5F7NC 4U7MA 2C9XA 2NZIA 3LKOB 1YYLH 4G80B 5HJ3A 3Q9PA 5T33H 2VXSL 4WZ9A 2Q7YB 1ROWA 1XO8A 2XWBA 3B2PA 4XRCB 3ZQWA 3VE0B 5MP6L 3FT4A 1VACA 2N7AA 3CTTA 3OKEA 4KDTA 3TCTA 3U7YL 4N6RA 3PNWB 3J8F7 1MHHA 3FT3A 4IJTA 2PN5A 4KGJA 1K5WA 4LARL 4ZXBD 1M57B 3FTZA 4NQDA 3CVDA 1FC1A 1I1CA 1S9VA 3HR5A 3PABB 4N0YL 5IMKA 4AK1A 2C4XA 1D5BA 2N0KA 3WEXB 1MG3C 1QWHA 1ZSHA 1B88A 5T5NG 3LH8A 3F12B 3QNXA 4OCWL 4X80H 3DRTB 2Y9RT 2IBZX 3LNDA 4F27A 4JFQA 2IWFA 2CKBH 3DKHA 3BISA 4P2AA 3ULUD 3QYMA 1UXSA 3BFQG 5DFTA 2H3NA 3KJ4C 3K74B 2CDFA 4KKLC 5LGHH 1OLLA 3KYKL 2OS7A 2G60H 1A6ZB 1E42A 1QVOA 3D9AL 4JFDA 4NN5C 1KOAA 4N68A 3D0LB 3RWJB 5AWNH 4JL1A 1NC2A 3FUNA 3FSZA 4AYEC 3TH4T 3RNQB 3V10A 2RJMA 1TTRA 3ABGA 1JHLL 5DO2D 1JF5A 2HCZX 3P4OB 4UZGA 4AVIA 5IOPB 5HYJA 4NSKA 3IETB 1V27A 4PS8A 5DDHA 5L4IA 1DJWA 4M7JL 3GHEH 3M8OL 1MWAL 1SY6H 2FX9H 4RMVA 5HDQL 4L4JA 3QUMB 4NKQB 3EYUH 2D3JA 1T1ZB 3ZSTA 4IRSC 1MCRA 3S5YA 5D7LE 4LEOB 1U8OA 2ICWI 5E2WL 4OI8A 3QG6B 3RUGB 2F7OA 5EO9A 5D72H 1IKFL 2EH7H 2JTYA 1RK0B 2EDJA 3NBNA 2OV0A 3C09C 4ZMVA 4RH4A 4NQEE 4FXKC 4TUJA 4W9GC 5AOLA 4E9VA 5L8KB 1QLRA 2P24A 2UXGA 4OSUL 3SE8L 4PYHA 3KCPB 1M2VB 3INUL 3SKJL 2GITB 1HEJC 3SPCA 3VGFA 2UZYB 5DC4B 4F1SA 3QQ4A 3I9IA 4BV1A 3K8KA 3PDOA 3UZVB 2ICCA 1B4TA 4TV3A 3N43F 4Q9QL 3GSUB 3SKNB 1NCCL 3STZB 4RFOH 3ARVA 4J7RA 2C1PA 1R3KA 1I7UB 4OCRH 4QRPD 1J48A 4YE0A 4M48L 2G2RA 1MF2H 3TBTA 4XPAH 3JZYA 4I3GA 4ZFZA 1A3LH 1JS4A 1ZSDA 1X7QB 4Q6YA 1FPTH 1HDMB 3VDCA 1S9YA 2IV8A 2J72A 2ITFA 1BJ1J 1WUNT 1OZTG 1MFDH 1NEZB 2XQYG 4KNQA 2WQWA 3ALXA 1CU4L 1KCUH 1CD0A 3JWOC 1MCPH 3Q6FA 2X1QA 5IMOB 1XH0A 3BN9C 3BZ4A 1BBJB 1C5CL 2OX5A 3OKOA 4N0FB 2F1AA 4BSWA 4MLSA 3OR6A 4NJAL 3NESA 4MKMA 4WU5A 4B27A 3FFCA 5C9KA 5HY9B 1JF1A 4YGVA 1JPFA 2XZCL 4OZHF 4M00A 4W9FC 3THMH 1I9JH 4IJ3C 4YQXH 4JCMA 4L8SB 4TM9A 1WSST 4HKJA 4M6OH 1W15A 3ILQD 3U30B 5F0LB 4MXVF 4S1RH 5KVDH 1AE6H 3TO4B 4NKMB 3PY9A 4GI9A 1RJLB 2VXVL 2GHWB 1NSNH 4BKLA 4V11A 3U4AA 5GZOD 2PYED 4OZ4A 3ZDZE 3O2WL 5TDPA 1QNIA 3QCVH 3T3ME 4YDIH 1IEHA 3O6KH 4OZGA 4XO8A 4TKWA 5IB4A 3X13B 1NCIA 2DKSA 1J8SA 3D3VB 2XY2A 3C6EA 3ZE1E 4CU8A 1ND0A 3H4FA 1SLVA 2OMYA 1GZPA 3UABA 5DS8B 5F72S 4MCZA 5TDOA 4H88H 3H2PA 4N8VA 4N90E 3QFJD 4AYMC 3S34L 2PWDA 4GXUM 2JJVA 4MS8D 3X1EA 5ACLA 4UILL 3MV7B 4U6TA 3QDGE 4Y9EA 3II3A 1KTDA 3DGDA 4HJJH 2Z1KA 2FJFA 3CCHB 5I5RA 2IPUK 1YMMB 2NLJB 2KH2B 1MRDH 2BVPA 3Q44A 1AXIB 3LIZH 1IM3D 2M2DA 4GRWH 3B9KC 1E5UI 1KGJA 4Z23A 1AACA 3OJVC 5C2BL 4ZQKA 4X6BA 1AS7A 2W0FA 3IKCA 1CGWA 1YY9C 3OPUA 2WLMA 4POZD 3VD5A 4Q58C 1VFBA 3TEYA 2WBKA 3L3JB 4NO2A 1UWEL 1AANA 3KYNA 2L7QA 4L5FL 5L88L 4LSSL 3VFGH 2NY6B 2Q9OA 1MLBB 4WGWB 3HS8A 1KBVA 1CS6A 3TPUB 1EJOL 4OJDH 2G0LA 3MLXL 3DSNB 3DHJA 1OPGL 4GFXA 2DQUH 1BAFL 4WJG3 1DUZB 3O8XB 1WFJA 2HX8A 1QSVA 2PP7A 3JWDC 5LGJA 3HN3A 3FQYA 1BVKB 1QRNA 2J8UA 2X7LB 4QTHA 3IU3B 1BFSA 2RQEA 1S3KL 2UXFA 1CICA 1AI1H 1NJ9A 4UV4L 1QUNB 2EDFA 3V4LA 2OSLB 1MJ8H 1A6TB 3BEWB 1NGWB 3VFMA 5L2KD 2EIDA 4HMDA 1OSEA 5JQIB 4OZFG 3W5MA 1FSKB 3IE9A 4PW3A 5KSAD 1OCRB 3QORA 3T65A 4EI6B 2FYYA 3FMGH 4Y5XA 3TCLB 2FWOA 4P5TD 4DZBB 3HC3H 4HIXL 4UINH 1KN4H 2XIDA 4K94L 4MDJA 5KVMC 4O58L 4U3XA 2AK4A 3ZYIA 1AC6A 2ED9A 1ACYH 2GT9B 2YS4A 2EYRA 2ZX6A 1T4KA 4MVBC 1AQDB 4AKOA 1RZ8B 5F7YC 1U3HB 2WKOF 3D25A 1WBYA 2K4AA 3WHXA 1AZNA 2Y72A 4DGVL 5IHHA 1BCIA 2J2ZB 5CEXA 3MC0A 3VFOA 5E8PA 2HRGA 2YJLA 3W57A 4G7VL 3CHXA 3JV6A 3QNFA 1EK3A 3UTTA 5MEPA 1E4JA 5D1ZC 4PWEA 4PWFA 2G30A 3DK2A 4G9FD 4XBEL 4PRID 3NH7H 3S37H 5JW3L 4ABQA 1PG7L 1OAUH 2YXVA 4WUUD 3P30L 3SDDC 2CIKA 2ZUSA 3WV0A 4PRPE 3RGHA 1H19A 3PQYD 2AXJA 2HJKA 4Z7VF 1QSZA 1A6PA 5JPNC 1HKFA 3CHPA 1NGXB 1MCQA 2VDNB 4GRWF 3S3SA 4ZS6C 1D9KB 2ARJA 1U8JB 2EYSB 3CVHH 2Y2WA 1O9ZA 3BAEL 4QHUA 1GIGL 3FHQA 2YEQA 4YX2L 3L13A 5HHOD 1YEEL 4PJ9A 1QHQA 3NCJL 5KBDA 4IDJL 3KVQA 4NPJA 4FQXD 3KGTA 4KTEL 2KQMA 1I8IA 3QCUH 3VFUA 5J3HD 3OJ2C 3RVWD 3HHRB 2E0PA 3DIDA 4TQHA 3ZKMC 1I53A 2FO4A 2Q76B 3C5ZB 5C0BD 2JKRM 3QDJD 4W9HC 1JBJA 1T22A 4N2HA 5C08A 5DRNA 1YQ2A 4LNVA 3RVTD 2V7NB 1MH5B 3HPJA 1JZ4A 2WLIA 2BSTA 1JPSL 2J6WA 2YHGA 2WY3B 3IDGB 4WWKB 2OCCB 4AVHA 1UEMA 4X9GA 4C58B 4JKPL 5KVGE 3HE6B 4FKHA 4OF8A 5A2BA 2Y07L 5GGSY 3MXWH 3PHSA 5C7XH 3I6GB 5DJCA 3I02B 2K8MA 4O2FA 3CH1A 2BIMA 3B5GA 3FQ4A 1T0MA 3AS1A 2D9CA 1NGQL 5AVWB 1ZVSA 2Z35A 5E8EB 2HVBA 1JZ2A 3FSOA 4R4ND 3UTSA 3CU1A 5MEQB 4NQVA 4PUBH 4M03A 2FX7L 2VSKB 4MTMA 3FUDA 3LKQB 2BNRD 3MV8B 5BXFB 1NTDA 3O3UN 3LH2L 4NRYA 2Q8BL 4P4KD 3IM1A 3E0GA 3MLUH 1JHKL 1PZ5A 1U36A 5IMLB 1JNNL 4UDUB 5IK3A 4YMPA 4E41E 5FCSH 3AW5A 4UM9D 1FL6A 4DK5A 4U0QB 2D7PA 2DS4A 3U79A 2IGTA 5MENE 3MUZ1 2VXQH 4XXWC 4QKXB 1ZLWK 4XVJH 1ZLUH 1MJUH 4G6JH 1W72L 2ZF8A 1L0QA 3KNBB 1FO0H 5BOJA 2F7RA 5K39A 4MJIE 3NTCL 3I6KB 1BPVA 1BD2D 3CXFA 4OM0H 3T77B 3SYCA 2RFXB 1PJ9A 1MI5B 3O6FB 4UYQA 2CLZB 1BVLB 2VCOA 4NHUA 5D5MB 5E8NA 2TRHA 3QNYA 2HTLD 3SKOB 4LIQE 2XXMB 4OLXH 3GSNB 3W9EA 2FTAA 4J3SA 3TBCA 2Z7WA 1M7IB 3FO1A 5AFAA 1IBBA 4M8VA 5EU4A 2JNZA 1UADC 2DI8A 2V9RA 4IMKC 1JXFA 3CFNA 1DQJB 1UOLA 3V0WH 5IKCA 2OMWA 3K7UA 1Z3GH 2EVFA 1VZHA 2O5YL 1TFHA 2A9AA 3NJGA 3SOBH 3NFNB 3V8CA 4H13C 5TPWL 4P0DA 5ILTL 2F5BH 1PIGA 2YZ8A 4MZRA 2ICEB 5J9PA 35C8L 3DETC 1PTZA 4PJHB 5AAWC 2EUZA 3IDYB 3FT2B 2R23B 1V3JA 4K5OA 3QJTB 3R0MA 4HKZA 1L9NA 4Y5VA 4WEMB 5ESVB 4M7KH 3EGSB 3MNZB 4JHUA 4QRQA 2EKJA 1ZGLA 4GXVL 1CGSH 4JZNB 3RUGF 4D0BB 3S35H 2UX6A 4QDGA 1T7YA 1DVXA 4GG6A 3DURB 2I5YL 2WIMA 4HHGA 2WTRB 4YHMH 3FBQA 1Q9KA 1YQVL 3IFLL 3FF7A 5E2VL 1FFNB 4A37A 5C9JA 1AKPA 3DECA 4K8RL 3LRMA 2EE2A 1FFOB 4NKIL 4Y4FA 4RZCB 5DVPA 1UZGA 2H0JA 4R7NA 5L2JB 2LT9A 1QFHA 3GS7A 4NYLA 1KGXA 1AD9A 3MFFB 1LILA 4KO6A 5DK3A 4P5KB 3RIAF 5C0NC 4YFLI 3IFNH 1T5KA 3IPFA 4ZXBB 4JZJA 5HHNA 4IEFB 2AK1L 1N67A 5E2UH 4Y2OA 3WG7B 4HKXA 1VJSA 4M6NH 1CYXA 3FUFA 1JGVH 4MWFA 3IF1B 5FO9B 3LZQA 4R5TA 2RALA 4PJIA 1WAAE 1OW0A 2Z4QA 1QEWB 2IPKB 3UMNA 2WWNA 5A40E 6TAAA 1MAML 4AL8C 3VXUE 3S3PA 2CCWA 3FCBA 5D70L 15C8L 3WN5C 5GJSL 1XT5A 5C71A 4ZMNA 1KENH 3HG0A 3F65A 4Q0XL 4L4VD 4Q4EA 4YDLC 5F7FA 3UPCA 5IHUH 2H1XA 4Y5YA 1LE5B 4PJ5A 4BFGA 1EJFA 2FQEA 1IVLA 4YBQC 3LZFH 5DYOA 1MFAH 4K7PH 2WXMA 5HDWA 2F6AA 5HDRA 1FG2B 4EZJA 4ZMZA 4ONHA 2E6PA 1QEXA 1X5IA 4KY1H 2FX8H 2X09A 1K85A 3CSPA 1TTUA 4DP1X 2X6BA 2VN5A 3L9RA 2WQVA 1PFCA 3N5AA 2UZXA 1WFOA 2WXIA 1BA9A 1J1XH 3B9VA 1KGCE 3T0EA 5ID0A 4L4TE 2RR3A 2PTTB 1TEYA 3QGVA 4U3HA 3KPRD 2DWDB 2E7DA 4QRTA 4YSSA 3ARDC 4P3DB 4N90D 4ODSH 1ORSB 5DHYA 2Z91B 4E9QA 1JG9A 2Z31B 1N59B 1OD7A 1ZD6A 2EDWA 2ZONA 3PGFH 3LKNA 4WGKA 5B1KA 1A65A 3U4EA 4KV5F 4OT1H 4KX8A 3ULVC 2FHFA 1IGFH 1DSFH 1AO7E 3PWUB 4ZFGH 3G6AA 5D6DC 1TO4A 1U6AH 4BQ9A 1YPZA 3V0JA 1S9WA 2ZCKL 4N0RA 1KFAL 2OYKA 4Z7WB 4P59H 1ES0B 2AQ3A 3RFZA 1C12B 1IBHA 4MB5A 4L23A 3BPOB 2J8HA 1NGPH 2B08A 2QDWA 5B39G 1OGTA 5T1MB 3B7UX 1F8TH 2VKXA 1TDQA 3STLA 3ZU8A 1FUNA 2F18A 3EDFA 4W4OA 2JKLA 3QWOB 3ROOB 1XSKA 5LB1A 3N9GH 3ZKNC 2GI0A 3RL1B 2J88H 2VITA 1UTDA 5TE7L 1EZUA 1AFVH 3EH2A 4KK9C 3MLYL 3RFRA 2DBLL 1O6VA 2NX5E 3ZZ1A 3U36A 4GG8A 1ZRUA 1RY7B 4Z6AT 1HXMB 4OGZA 2UWEB 1MIEL 1G7JB 4I18A 1NGYB 2RIKA 4WO0A 2DJUA 4GH7B 3QPKA 4HULB 3P0VH 1UB6A 1OGAD 2GBAA 1DBAL 4TVPL 2VISA 3G6DL 2OMZB 2SODB 4X99A 1UUSA 3RIKA 4K0OA 2VR5A 1UM5H 2J57A 1ID5I 5EUKB 3FB7A 1V55B 3ARGD 4NQXB 1IQWL 1LQSR 3AY4A 3O3EA 5A7EA 1KXHA 3NZHH 1IGMH 3EGDA 3D4ZA 3MMEA 4HLZG 4KO5A 2DMBA 3SGEI 3RA7H 3NZUA 4HEME 2B1OA 3PWVB 3OKKA 3T8XB 4Z3JA 4F24A 3MR9B 1P6WA 3ARUA 1E43A 2ZPKL 5TE6L 1XGQA 2X89D 2LAGB 1L3NA 4YN3A 5BZWB 5H4ZA 5GISH 1DBBH 3QIWD 4XC3L 3TFKC 1VGKA 3B7RL 1G0DA 3H54A 3DGGA 3LXAA 4YDVA 1OTUD 3WSQL 2NNCA 5IW1A 2A2QT 1EEYA 2NUTB 3TWCH 2VMJA 4Y8DC 3EOBB 3O41B 3PIQA 4PTUA 5EF0A 1LVEA 4LRIC 1AHWC 1CFBA 2ZWKA 4LLUB 3VFTB 2DTMH 1A3QA 4TNFA 3UZEC 1NH6A 3B37A 2H8PA 3Q1SL 5CUSH 3UAAA 3DX0A 1VCAA 3LN5B 4FZEL 2RAMA 1IBDA 4HF5L 5G2NA 3EH1A 1IGIL 1KELL 5F71A 3CIQA 3CMGA 2F53D 4XNMB 1S7TB 1S5IL 4ONGL 1VEOA 4QYAA 4YUEL 4EF3A 3SDYL 2OMVA 1EQWA 3ZZQA 5F0JB 1IM3B 1AIZA 2VNCA 1FORH 1XB3A 2EKSA 2D7NA 4O51A 3CE1A 1ZK9A 4M9OA 3U9UB 1NGZB 4X9FA 4UIMB 4RGNB 4UOW0 3EYQD 3OVUB 4Y4KB 2XA8L 4LU5L 4UQEA 1NDMA 4O5LH 5ISZA 1CVRA 2ZUUA 5E4EB 4DQAA 4ZTPL 5HGHA 2JFCA 2F8IA 3QJHB 2P48B 5BRZB 3LHPH 5K5YA 5GRZA 2JB6B 4HXAH 1RHHB 4MA1C 4X42A 5HGBA 1R5IA 5GGVL 1RAMA 2XXCB 3UACA 3ZIYA 3TLRA 2B1HL 3S88L 4RGMB 4AE0A 5GS0D 3DA0A 3LQAL 4GQZA 2AJUL 4N4YB 1G9MH 2OBGA 2C7UA 4OZFB 5T5FL 3RLSA 4ABVA 4F9LA 5T5FA 4HUXB 1M71A 3TV8A 3ZTNL 3BAWA 4Q6IB 3ZT7A 4KMTL 3EO0A 3LVTA 2BRQA 2OI9C 1YYLL 2W91A 3GUFA 5DJ2B 3N1FC 5T33L 4UTBH 1QW8A 1J5IA 3PYCA 5FYKH 2NOYA 2CO1A 2YD6A 3FS9A 3I3EA 4CC4C 5KSAB 1WS7A 2B2XH 4IOSD 1E2WA 2EDBA 3P4NB 2Z93B 3NSFA 1R3JA 2Y3NA 3CX5K 5KYUA 4P5TB 5D93B 4BK5A 1UCBH 2CR6A 4FI7A 4I1PA 4S2SA 2WO2B 4LCYB 1KGWA 4OUOA 4N0UE 1YEDB 3OAWA 5EIIG 2Q87A 3UAJC 2O4EA 3LKRB 1N0LA 1G5AA 4QRRD 3SDCC 2H5UA 3QJFA 4X80L 1U8LA 4Y19E 3WIAA 1PEZA 3HFFA 4E41D 5K1VA 4AQ1B 2DWSA 4F7PA 2CKBL 5F1NB 2LLNA 4ZW8A 3ZDYE 4NO0D 3FU8A 1Y18B 3EYVB 3QUYC 4KDWA 3FQTB 4G9FB 3BH8A 5CLYA 4XMKH 5LGHL 2MHAA 5JW4N 5DS2A 2G60L 3FUIA 3NIDB 4OF5A 3NCFB 1V05A 4N6QA 5AWNL 3PQYB 5JO5B 3BWUF 1FVDA 4NXKA 2ERJC 4X0KB 4BSVA 3L95B 2RA1A 4PJDB 3GXNA 2NY7H 4BCZA 1HS6A 2BOBA 4KDTC 5F8QC 4PD4J 2NY4C 2XHNA 4HLJA 1VZGA 3DK0A 3IT8D 3GHEL 2CR3A 4AQ8A 1JI1A 1WLHA 1SY6L 4N2LA 2FX9L 2IH3A 3EYFB 5HHOB 1SY6A 5FFOA 4WFGE 2XX0A 3BAXA 2BSSB 2FBOJ 3GMRB 3LHAA 3V0IA 3BPCA 3ULUH 1I1AD 4FQXB 5D5MF 4KFMA 1U4EA 2VR4A 1M6OA 4LCWE 5FGRA 2AEQH 4X7TA 4LLQB 4IBLT 5D72L 3NCYP 1JV5A 1S4IA 3H3BC 2EH7L 4WTZG 5DJDA 3GWJA 3PHQA 2FZ3A 3K4DA 2I9TB 3CZLA 1R5WB 3FQ1A 3HHMA 3OR7A 3CFDB 5L4FA 1WQVT 2KDYA 2YGOA 2I69A 3DI2B 3X14A 2VDQH 1ASOA 3PPSA 4G1EA 3TV3H 5EZLA 4RAUB 3GSQB 4U1HB 4PJHF 3GIVA 3AXLB 4PGDA 4PMEA 3DNKA 3UXFA 1EZVX 1IC4L 2QSCH 2WBJA 5IEKB 4JNXA 3L3IA 4RFOL 4BUHA 2X1PA 5ADPL 3IJ8A 4Z7NE 4OCRL 3RVVC 4KJYA 2Y7OA 3FUKA 3CDZB 1MF2L 4OUUB 5C8JB 1E3XA 1I1YB 4XPAL 2J55A 3REVB 3QARA 1A3LL 1KCSH 4PRAB 1UFUA 1OXYA 4EDXA 3HOGA 1RPKA 5HBBA 2HH0H 4PCKA 4FEMA 5BJTA 4B60A 2WSPA 3CLWA 5I1LB 2FJHB 1KCUL 1SXZA 3FZUC 5HYSA 4JRFA 4U05A 5IBTH 4BWWA 3S3JA 2BNRB 3ATBA 3QDMA 3IGAA 1GKOA 4HMCA 1M1XB 1EEUA 4F91B 3DXAE 1E28A 1M05A 3B8SA 3BKCH 4WFFD 3VXPB 3MU3A 2X42A 5DJAB 2FJUB 2G3XA 3C9NB 4K9JA 4F1ZA 3MA9H 3GPSA 4UM9B 4TTDD 5SX4H 3GUTA 3QUXA 4ZOBA 3THML 2VABB 4CMHC 5T5NF 1HTYA 4PJFB 4F8PA 2AS5M 1CD8A 4YQXL 5H4YA 3X1GA 4L29B 3T5WA 5DUPH 2NY1C 4M6OL 2R27A 1EO7A 3CX5J 4QYOA 1GL4B 3E8UH 1MVUB 1AE6L 3L08A 3MJ8A 4LHQB 4P5MB 5KVDL 4A67A 4TVSa 4B53A 4M43H 5DHEA 5DMKA 1JXKA 3B43A 1NSNL 5C07A 1AKJA 3G6JB 1S46A 2Y5TB 1BD2B 4FLHA 3X2QB 1O5PA 5ERWA 3A23A 1LD9B 4YDIL 5ANME 5HHVH 2MQGA 2XDHA 1IM9A 1FCCA 2VQ1A 1U95B 3KPPA 4MNQA 2V9QA 4YHYC 1NMCC 2BWDA 3IJYB 3CVIH 3TASA 4Z5RA 3BO8B 2QEJA 5HYFA 3V5DA 4J3TA 5INCB 3L4ZA 2G5UA 2WKOA 4GBXD 1AGFA 4PGEA 4H88L 5I8KH 5B4MD 3KHOA 3V0AC 4WV1A 3VMPA 4HJJL 2Z8SA 3T6VA 7PAZA 2ZUVA 3T2LA 1I31A 3FCSB 4UZSA 4AJ0A 2ZYRA 2IAMA 1PU0A 3QJSB 3IVKB 4GUPB 1MRDL 3TBYA 1BV8A 1P2CB 5LAPA 1PY9A 1X7SA 3EJYC 5IFHH 5A16B 3LIZL 3D4YA 2X10A 4LPWA 5KYXB 4Z7VA 2P49B 3CFJA 3ASWA 3LIZA 3ZBMA 1Q9LA 2YMOA 4NO5A 4EXPX 2ZWNA 4DKDC 3LEXB 4N8PA 4DGIH 4J3XA 2Z0BA 4KRPB 5K93A 1E4XI 5E7FA 1BZ9B 4LCUB 1CBJA 4IGBB 3WKNA 3FW6A 1OAQH 3D2UA 3N1PC 2HTKD 4HIHB 1IRAY 1CL7H 2WBXA 5CZRA 4FRWA 5HJBA 1WBXB 3VWJD 4PRNA 2ESVB 1JN6A 3ECBA 2YAQA 2PNDA 1KCVH 4OLZH 4TLSA 5ICZA 3RIAK 4NKOA 3SDAA 2KI6A 3KPSD 3B2UD 2DQDH 4J8RA 4HC1H 1DJIA 2VRKA 3NCMA 2I9LA 3D4GA 4U6YB 2Q0ZX 3FUEA 1S7XB 2DQUL 1H3PH 2W07B 3POHA 2FYVA 3QEQE 4FD0A 1HL5A 1NIBA 5SX5K 4TULL 3MRLA 1U2HA 3B3BA 4JRLA 5CWSA 4XMWA 5E2TH 3BZEA 2VLLB 1E27A 1OTTC 5IVXB 3H9SA 3KPLB 4P2OA 1PLCA 1AI1L 5AUMB 1MJ8L 3SPVB 3M1CA 2QVTA 3DO7A 5D2LF 3IDMA 3VXNB 4G8IB 3ULVE 2CA4A 2OMTB 4O2CB 4OLEA 2HLAA 4HCGA 4S0SD 4NENA 5DVLA 4AZUA 4J3BA 2YD9A 4KK5C 5G4NA 1XH2A 4QPEA 3TO2B 5I5IA 1KIPA 2D4FA 4YK4C 2UWEF 3FMGL 4LMQE 4MNGA 1R19A 1IAKB 1S78C 3CFKB 1Y0LB 4EBQH 3HC3L 3I75B 3MLTA 4UINL 1KN4L 4UQBA 3D09A 3WLBA 1WIOA 4IOIB 1UEYA 2BVQB 4UT7H 5F70A 4JLRB 5ITBH 3CHQA 1ACYL 3STBA 3A5VA 5CKAA 4L4VB 5E9DD 3WLWC 4HYTB 4NERA 1AS8A 4TQEH 5F3BA 3SKMB 3VQ2C 4YZFF 4NCDA 1Q1JH 1WA1X 4TNWF 4G6MH 2Q7YA 4MAYC 2X2YA 1OK0A 4JG5A 2QMJA 5JR1H 3LRLA 4XRCA 1UA6L 1IAIM 3VE0A 1L6PA 5I75C 4GB9A 5I18H 3H3PL 3NH7L 3QJUB 3S37L 3VM5A 3QA3B 1QSED 1CICC 1OAUL 3PNWA 4H2AA 4MMXB 4BM7A 1WG3A 1G7QB 2BJMH 4X5LA 1ZMYA 1YUHB 5FX3A 3DV4B 1EEQA 3LNIA 3ZOAA 5IJBC 3PABA 1H0DB 1IZJA 1TZOA 2AQ2A 2P28B 3CVHL 4RRPG 4OZIB 4Y5XC 3WEXA 3F12A 5B39B 4K94C 3DRTA 3KD4A 4JVPA 2ITDB 2BOCB 4FNPA 5KYYB 3QCUL 3VI3B 4JBSA 2VE6B 1JZ8A 4M4PA 4UNIA 4Z9KB 3RWFB 3QW9A 2Z7UA 1A5FL 4UOZA 4CDGC 3JUZA 3U4BH 3FHEA 4R3SB 3D0LA 3EH5B 3IE4A 1SQMA 4YNYB 4PU2A 4WW1B 4ODXA 3CFUA 4KJWC 5A6IA 5IOPA 3GTTA 3QULA 3VXRD 3HIZA 3IETA 4NOBA 1UB5B 1YO4A 1SDYA 4F2MB 1GC1H 3L6FB 3TGXA 3ZTEA 2QHLA 2WAQA 5JHLH 3QXWA 4KKRA 3QUMA 4HX1A 4B5EA 3MXWL 5C7XL 5E6ID 1S5HA 3L54A 1CXKA 4QHPA 3GMMB 1OGAB 3QG6A 3S96A 1TMCB 4HU8A 4P8QA 2ODHA 1RK0A 3K4ZA 4R6UA 1BGXL 5LCVH 4E5XG 2IIJA 3ARGB 3UO8B 4YLCA 4KK6D 4NAJA 4UNTA 1L5GB 5DVMA 1QUPA 3JTSB 3M7FB 1M2VA 1BJMA 3NA4A 2HFTA 2HKHH 2UYLA 4YSAA 2GITA 3SQRA 2UZYA 3VFWB 1FLRH 2XOTA 1NQBA 4N5ED 3UZVA 3CFQA 5FF6B 1FNEB 4PP1C 5EULV 2HJLB 2YAEA 2DWYA 3L2MA 3GSUA 4L3EB 4F9PA 2GKIA 2VXQL 4IU2B 4DW2H 1I7UA 2VXQA 2M1KA 3O6ML 4XVJL 3RNKB 4ZUUB 3RY4A 1MJUL 4G6JL 4MA7H 4Y16C 1U8QB 1Z0NA 5LVEA 1MCBA 1X7QA 1FO0L 1HDMA 1DVUA 2X6AA 1DJYA 3VB9A 3QEGH 2FJGB 1NEZA 3ROLB 4HA1A 1MCFA 4OW6A 1ZT4B 3N1GC 5AB1A 1VFUA 4K7FA 5IMOA 5FYLE 3VWKB 4O4YH 3OWEA 3BOVA 3ETBF 3U82B 3ARTA 5EC2B 3TEZA 4MLIA 3MV11 1DVFB 3CLFH 2F53B 4EIBA 1X3DA 3QZBA 2J43A 5KYWA 3NIDF 3V0WL 2XTSA 1Z3GL 4XCNB 5EMYA 3HMWH 1TEGA 4DP9X 3CVCA 1EBPA 3GPEA 4KVNH 3SOBL 1PIFA 4L8SA 1X44A 1JMXA 4PJDF 1MCNA 2AJYH 2F5BL 4YLBA 4NKMA 1ZHNA 2WLHA 1RJLA 3SBQA 4LCWD 1JPEA 1IC1A 3FKUS 4UBDD 2YAHA 4I3SH 3IJHA 3Q8AA 4NQCB 5CS7A 3FQUB 3OF6A 5E5LA 3DYOA 4G6KH 3K1DA 4XNDA 3FUHA 3CQPA 4DIXA 1RJYB 2VDOL 1CGSL 4HUVB 4DPBX 3L9EA 3D3VA 3S35L 1HHKB 3N0PB 2AJXH 2CHZA 2YQGA 3BSZH 5JOPD 1SXCA 2BW4A 4IBTA 4FDWA 4QD2E 1XHHA 5DK2A 1HSAB 4MJ6B 2BX5A 3NABH 4WK4B 4XO4A 4KI5D 4YHML 4PWHA 1QP1A 3MCLH 3MV7A 1IU1A 1IUZA 1HXYB 2BWIA 4MD4B 3IWUA 4AGOA 5E95B 4XHQA 4K07A 4HIEB 1B3JA 4AV5A 1JZ7A 1YMMA 3PDDA 4J4PD 4FA6A 2AJZB 4K9EH 1NKRA 4PJGE 4NQDE 1KACB 2OK0H 5CZXD 4L1SA 1COBA 2DL9A 2WTOA 2C9RA 5EIIB 1HL9A 3IFNL 3LQZB 4KKPA 1XGRB 3P9LB 4KKZA 4UQDA 1CZ8H 3WKPA 3S3DB 1EEZB 5E2UL 2KS0A 3D85B 5JTWA 2DM3A 2VZVA 1GMIA 4LLVB 1WZAA 4M6NL 3BGFB 3C5SA 1JGVL 4Y5VC 1X5LA 1LHZA 3APDA 3ATAA 2E27H 4QRRB 3B56A 2WLNA 1Y6NR 4F15C 4F93B 4TSAH 3QWQB 3WEBA 5JIPA 4D9RE 5E0FA 2QSQA 2XZAH 3DSNA 3FTYA 4NWUH 2JV6A 3QDHA 1KENL 2WLJA 5HYJE 5IHUL 2WXOA 1BVKA 3DJTA 2X7LA 3IU3A 4TOYH 3OC8A 3Q6GH 1ROCA 3LZFL 4PJFF 1MFAL 4K7PL 4ZFOB 3NJLA 2OSLA 1A6TA 1NGWA 4K8RC 2D7QA 3IMVA 1NIDA 2XWDA 4RAHA 3EG9A 2A99A 2FX8L 3GTVA 5I1JH 2KUTA 3ULSA 5L9DH 6PCYA 4GLRI 3TT1L 3P0YH 3NIGE 4P23D 3G6JF 4PG9B 1KCLA 2VJXA 1RP9A 4X8GA 3TCLA 1YYCA 3CIAA 5HVWA 4DZBA 1J1XL 4X4XB 3SY0B 4X5RA 4JZJC 2QHRL 2EVGA 4DEPB 2YA2A 3V9FA 4C4UA 1QFPA 3AT0A 3TBSA 2GT9A 1WYJA 3GBMH 3QJQB 1M56B 5LLIC 3S8WA 2BNUB 4ZSOB 3PGFL 4MASA 3MV9B 3S48A 1RZ8A 4KJQC 1PZBA 4EKJA 1OW0C 1IGFL 4P2RD 1DSFL 4ZFGL 3EFDH 1CE6A 1HAWA 3NQKA 2X4PB 2J2ZA 1U6AL 4HISA 1CGTA 1HYRC 2F54B 2ZUWA 3ATFA 3W39A 5I8CB 1X5GA 2HRPH 3JBG7 4P59L 1WF5A 1YUKB 4AYID 2CM5A 1NGPL 3BP6B 5AOMA 1KF9B 3QH3A 1F8TL 4IIQB 2NT0A 3T4YB 2YPLD 4FXGB 1IB5A 1XR8B 3K6SB 5GHWH 3N9GL 3NJKA 3QVAA 4N3TA 4FFYA 2J88L 1NGXA 1AFVL 1Z5LB 3UGUA 2HUHA 3OGOE 1PD1A 3O4LD 1ZT1B 4IRJD 1D9KA 2JKSA 4BFJA 3P3UA 1EAJA 1U8JA 2EYSA 1VLXA 4I9WD 1OO2A 4LPUA 2FQFA 1OF0A 1JPGB 3T0EC 2D9QB 1W0WA 3FFCE 4J23A 2X1OA 5EO1A 4LVEA 1I8AA 2CSPA 1CFQA 1KC5H 2BZDA 4PS7A 4WDIB 4V1DD 1U3JA 5E1AB 1UM5L 2O72A 5H94B 3L3DB 3C5ZA 2Q76A 3C8KB 3MSPA 1DEEB 4Y2DD 2K6YA 2IWEA 3PF2A 5IVXF 1QO3B 4JFHE 1G43A 1AQMA 1MH5A 2JJSC 1IGML 3NZHL 3RFZC 2OCJA 4U3CA 2IWKA 3ULAB 3RA7L 4KXAA 4E9YA 4WWKA 5GGQH 4R26H 3CVBA 3CH8A 4W4OC 3P77B 1BQHG 4YIQB 8FABB 5DD3H 3HE6A 2AVGA 2X0WA 4CVXB 4PS4H 4FJ6A 5J0BA 3CQQA 3I6GA 3GZOA 1IGTB 5TE4L 1JZIA 4IMLB 1EAOA 2NRDA 2FEEL 3J7HA 5GISL 1DBBL 4ENZA 2K3TA 3C08H 4EXKA 1TZAA 3LRKA 3L5XH 3TWCL 5HD8D 4I18C 5E8EA 5I0VA 4GAAA 1PNCA 2VLJD 3N1MC 5KYNA 2DTML 5MEQA 5I5JA 3KW8A 4UI2A 5ICYA 5CUSL 2UUDK 3Q48A 3LKQA 1HH9B 4YPGB 2XV2A 3MV8A 5BXFA 3EYSH 1F11B 4N9GA 4M7LL 1KZQA 1XF5B 2D0HA 3I2CL 1Y1UA 1FZJA 3MJ9H 4ZNEA 4S1QH 4UDUA 4MXQD 3CLEH 4XB3A 3MRKB 1T3FB 2A6IB 1ZA3B 4NZ8A 3TONA 4CSSA 1BXAA 4LRNH 1B2YA 1FORL 5G4MA 2YAPA 3GSRB 4S0TD 1AQHA 4FYTA 4R8WH 4OQ1A 4YL9A 4DGYH 2MPAH 4L5FE 3VGEA 4DKEH 3BUQA 3V4PL 1E9QB 1FIGH 3UBXG 5I1DA 2KT6A 3KNBA 4PJ7B 4OZIF 5BZDB 2FE0A 4H8HA 4YS4A 4O5LL 3EZJB 1IAII 4A04A 3I6KA 4RAVB 3T77A 3W37A 2RFXA 3O6FA 1MI5A 2CLZA 3LHPL 1BVLA 5TFSH 5D5MA 3VWJB 5JHDD 4CBZA 4GKNB 4HXAL 3VI3F 4Z78A 1QRNE 2J8UE 2J6EH 2K7QA 2BP8A 3KPSB 5HYEA 3BIKA 3HG3A 4F8NA 4P3CH 1YZZA 2AJ3B 4XCEB 1CCZA 1FL3B 3CZNA 4FQPA 4G8GB 4PIBA 5J12C 1DQJA 1R5VB 3MXVH 2V6HA 4NCC2 4AYFA 3B7SA 4ZK8A 5KSUB 4PJEB 1BLNA 4OJYA 2WVVB 1OB0A 3SPHA 2X9ZA 2C9UA 4ZUSB 3NFNA 4X6CF 1EDHA 1P7KB 4UTBL 2ZKXA 5CJQL 2ICEA 5FYKL 4UTBA 2X44D 4HGKC 3L17A 4PJHA 3H6JA 3Q43A 1Q0XH 5D7IA 2AK4E 5DSCB 2B2XL 4ZNCD 1TOXA 4NNYB 1M1SA 4Z7QE 3FT2A 1MNUH 4H0HB 3W38A 4AZ8B 2NXYD 4ZAKA 4IKIA 2P9RA 4FG6D 3MNZA 4YEEA 1HCYA 1UCBL 4K2UH 1CYGA 1ACCA 1TLMA 4JZNA 5I71C 4D0BA 4W9DC 3UTQB 5GS0H 1EV2E 5I5MA 1BQRA 4BKSC 1JXDA 5HDLA 2ICES 2ZICA 1OAZH 1SLXA 3RX7A 3UTTE 3ARWA 1UYWH 5E9DB 3BHBB 4K3DH 3ECWA 3ZL4H 5C86A 3T0WA 2WTRA 1AR2A 1U8CB 4KUCD 4JPSA 1FFNA 3RTQD 1XL4A 5IB5B 1FFOA 1HCZA 2Y7NA 5F7EH 3LQAC 4RZCA 2LE9A 4F9LC 3EFFA 4XMKL 5CZKA 1I4FB 5L2JA 2MCAA 3CPLB 1QSEB 3MFFA 2FECI 1FNGB 5HVHC 4P5KA 3ET9F 4GOSA 2WGXA 1BYOA 3S7GA 3OG6B 5CLZA 1I9RH 3VXSD 3BVDB 5AVZB 2XWCA 4BWTA 2VDKB 4ZXBA 4RMWA 4RESB 2DW5A 4HJEA 4IEFA 4KJPC 2H9GB 2OMUB 1ZDSA 1RURH 4YO0B 1NUNB 1NEPA 1DJGA 3IF1A 3DOIA 5GS2D 4BK5C 4PBVC 4GNKB 5A2KH 4KKBC 1QEWA 2IPKA 4G7RB 3ULUL 3CDGA 5C08E 2HYMA 1NFAA 3OAUH 4JHZA 5H2BB 4AOFA 2AEQL 1OB1B 3EJQA 3HG4A 2DQCH 1VDGA 1X5KA 3ARSA 5EOCJ 1TTFA 3MYZA 1IC7H 2WP3T 3WJMB 2XVBA 3OZ9L 3DOHA 1S7SA 2JKIS 3QAZC 3E6HB 4GO6B 3AUVA 4N0CD 4F7CA 4WWID 5IESH 2HX7A 4B6ZA 2GJZB 2GPZA 2VDQL 3TV3L 1F2XK 1VGEH 3D0VB 1ZY9A 4PBWD 3TZVD 5GS1A 1FG2A 2QKIB 1DQMH 3LNHA 2DI7A 3WXVH 1DQIA 2QVIA 1FFPB 3ISYA 3VXRB 3CXHK 2PWHA 4NAMA 3WEAA 2A6JA 4DQOL 1XB6A 3U0WH 2QSCL 4G5AA 3P69A 5HYQB 4E5XB 1ZPUA 5KTEL 2PTTA 1RZ7H 2DWDA 1QPXA 2IH9A 5E6UB 2R9HC 3UTSE 1KJ3H 4Z77B 4P3DA 1BMWA 2F8OA 1ORSA 4ZPVB 2Z91A 1E67A 1YDPA 3FPYA 3OAYH 1KCSL 1TETH 4HJTA 3L7EB 5DLLA 3TNNB 2CJSA 4JHBA 4I2XB 1RP8A 1BXVA 2HH0L 3PWUA 1NPJA 1QA9B 1ID2A 4H4NA 3DX6B 1GOGA 1QYGH 3FU5A 1KG0B 2IF7A 5DGRA 4I5BB 5IBTL 1XGZA 4Z7WA 4XR8C 4PRDB 1ES0A 3NA9H 5LAXB 5T1MA 2FGWH 3BKCL 2CG9X 2CZNA 2ZG2A 2OSYA 5C0RH 2PABA 4Z76B 3MA9L 1G5GA 2XKUA 3ROOA 4LVNB 4XMPL 4QOKD 3BUIA 2YARA 4PR5B 4QRPA 2XQYA 1FGNH 4YHZH 4KQ3H 3ZZLA 3U4KA 1WZLA 4PCTA 2NQCA 4UT9H 5DUPL 4L9LB 3GBEA 4QUOA 2WBJC 4Q2ZB 3E8UL 4UANA 1PDKB 4WI0B 2CNYA 1YC7A 1O7SA 4M43L 5E8DH 2R4RH 1HXMA 1IAOB 1KY7A 1YNTF 3CSFA 1J9CT 3EKCA 4U1IB 1G7JA 1QFWM 1NGYA 3W5NA 5DC9B 3SGKA 4KO9A 2DIAA 2ZYIA 5F1OB 1MFCH 4C83B 2VRAA 3TBWB 4FULA 2HWZH 5HHVL 4YFDB 2VLRD 1HE7A 3QYNA 3UFIA 4MXWH 1H3TA 2OMZA 4WO4D 2DEXX 3CVIL 5EUKA 1T04B 2X4TB 1Q94B 2BVTA 4XN9A 4NQXA 3AVEA 2KL6A 3FFDB 1RIVH 3U9PH 5CIPB 2MOQA 1WCQA 1NMAL 3QXVA 3C2SA 5I8KL 5I17B 2A9NH 2Z64C 2QQLL 2MOGA 4IQHA 4NRXB 4HP5A 5AKVA 2O5NA 1TQSA 3MRGB 3QUXC 4K71B 1AC0A 4ALAH 1RK1B 3MR9A 4XP9L 5IFHL 2IDFA 5GZOA 2PYEA 2QGDA 2WM0A 4PIRF 4I8DA 3LTVA 5DK0B 2C5DC 1XGPA 4GG6E 2DYSB 1XBRA 2AEWA 4FNUA 4HWZA 1ZVHA 2NUTA 5D1QC 5J11C 2QDVA 3O41A 4TTGA 5D2NB 3VGAC 1NFKA 3BLPX 3VFTA 4LLUA 4Y9CA 2NXZC 1OAQL 4KZ0A 3L4XA 3RKDC 1CL7L 1BAGA 5JXAH 3LN5A 2NQDA 3EFOB 3MUUA 2BVUA 2CGYA 4LFHD 4MRBA 4OLZL 6FABH 5IHLB 3LD8B 5HI5D 5JW5B 2P43B 4AIOA 2K4WA 2ZXEB 1E9PA 3G08B 4RBPK 2DQDL 2Z1PA 3U25A 4XNMA 4HC1L 4B9IA 1S7TA 4M5SA 4HC1A 2QLVB 3OLGA 4G8FB 4JW3A 5E2TL 2HT2D 1IM3A 4WV1C 3CXHJ 3GJFK 4OJEH 3UH8A 3C60D 2C3VB 1AGDB 5HGAB 3WEOA 2W5PA 4OFIA 5I16B 3WTYA 4TNEA 2IAMC 4ODTL 2K9UA 4PJIE 4UIMA 4BE5A 4XNAA 4LSTH 1UVQB 1G7LA 5GRVL 1NMBH 5FB8B 4OBSA 4FQIH 3GSOB 2YD4A 1NFIB 4TRPH 3QJHA 4PJBB 2DMGA 4EBQL 2X4NB 2JB6A 5F3HB 4EZMA 1RHHA 1BFOB 2WYIA 4PJ5E 1NL0H 5GGUB 4UT7L 2DQFB 5ITBL 4XCYB 4TUOB 2FJSA 4AGLA 4OZFA 1JWUB 2ARWA 4B9PA 5SX4I 3TPKA 2WKLA 3BDXA 3M1BB 1TZGH 1SN0A 1EAPA 4HUXA 4R4BB 4X7DC 4TQEL 4Q6IA 2BWQA 1EFXB 3ALWA 5A7BA 2EXWD 3NIFF 3SDAC 1BM7A 1Q1JL 1A3ZA 3IU4H 2GY5A 4U2ZA 4G6ML 5L2KA 3IAGC 2BNQD 1XCWA 4YXLH 3T0EE 5JR1L 5KVEH 1UD5A 4RNRB 1FN4B 1P4BH 1BOYA 4X4KA 2AKRB 1ZGLP 5I18L 1HNYA 3SE4A 5KSAA 4POYA 4J3OD 4P23B 3AMLA 3OSKA 4XN1A 3P4NA 2Z93A 3ARBD 4UTAH 5J57B 4MD5A 4P5TA 1II4E 1KYAA 5C3TA 3KPOB 1OWRM 1WRFA 2BJML 3EZ8A 3MRDB 1L9SA 5EZJB 3V52H 1QNZH 4QKTA 2E7LA 5GZND 1YPZE 4RX4D 1FAKT 2WNXA 3L4WA 3DBSA 2ENSA 2DQIH 3MDJA 5ESQB 4KU1A 2BDNH 1GPOH 4CW1B 4P2RB 3RX9A 3VNYA 4KKNA 3U46B 1OAKH 3NJJA 3WUWG 4KVCL 1JK8B 4JVWA 1AG0A 2VJ0A 1Y18A 2B9BA 2GW5A 3EYVA 4POUB 3FQTA 5DJYB 3CAFA 1MG2C 4G9FA 3UAEA 4PRIA 3BZFB 3JTBA 3VD7A 2L4OA 1N5YH 5C1MB 1T6WA 3HBQA 5AOKA 2QPFA 4WUUA 4ISVB 3U4BL 1U21A 4HFUH 5KZCD 3MRNB 5JLZB 2H2SD 3PQYA 5JO5A 2GAZA 3L81A 2A9MH 3F7QA 4X0KA 1SHWA 5BO0D 2GBTA 1OY3B 3O4LB 1XWVA 5K9KB 2LTQB 2HLFC 4MQTB 4LKXB 1KFGA 4PJ7F 4X50A 1GC1L 3PHOA 1JNHA 4F3FB 4P46C 3BVUA 4Z18A 3EYFA 5HHOA 5JHLA 1W91A 3HMXH 1UWYA 3QP3A 2J21A 4OIBA 2BSSA 3GMRA 4YBHA 1UUNA 1MDTA 4FQXA 5DEJA 4JFWA 5DZAA 2SEBB 5F1SA 2HKFH 2XIBA 3KWWB 3DJ9A 4YLQT 3MNWB 3V5HB 1DBMH 4XC1H 1WTGT 3QORD 2VMCA 4V1DB 1FIEA 1YRKA 4XNZB 3ME0B 2I9TA 5LCVA 2G75B 2WLZA 4Y2DB 1R5WA 4PJEF 1BQHB 3B3IA 4DAGL 4P3WA 3CFDA 4ODHL 1KJMA 1BJ8A 3PAYA 5JHMA 2HKHL 5C09D 1FNFA 1HSBB 3HBZA 5EU3A 2QQQA 2AV7B 1YEKH 3SE4C 1FLRL 2YSSA 3MTRA 5KSAC 1NICA 4U1HA 5C92A 1PL3A 1S8DB 3AXLA 3RWDB 1OSPH 4Y9FA 5IEKA 4DVBA 4U4BA 4FQCH 2EIBA 3F7KA 3P9WB 4G43B 1D7FA 3O81A 1A6AA 4DW2L 5DQ9B 1ZLSH 2Y1VA 2G4GA 5A6MA 3CHRA 2RCSH 3WFDH 1RIHH 3CDZA 4OUUA 5C8JA 1I1YA 2WZAA 3HS0B 4MA7L 2QBWA 3REVA 1VADB 1RUKH 3NG5A 4PRAA 3P40A 4ES9A 2UY6A 2EDDA 5F21B 3QEGL 2XN0A 3NJIA 4NUJB 1FV1B 2VLJB 4AY0A 4CN4A 3F7YB 2FJHA 3JVGA 4JQIH 3SCMD 2C7FA 4QRAA 3NGBC 2BNRA 3QZPA 2R1WB 1M1XA 3RIFK 1JF6A 5DLMH 3TTYA 2HVJB 3CLFL 4LSUL 3VXPA 2ZKYA 5DJAA 5AVTB 3LXUX 4QR7A 3JWNG 3C9NA 4R7VA 3TH2T 2PTVA 3UBXB 4UM9A 3ARFD 4AX3A 1INDH 4W9CC 2PP9A 3VD9A 1B90A 3VSVA 3GIZH 5T1DH 5GGVY 2VABA 3HMWL 3EO9H 5E08H 4PJFA 4LEEA 5DHMC 3BWZA 5B7FA 3CFBB 5ISZE 5L0QB 4QT5B 1ZJAA 2C1OB 4XCCH 4C4KT 5HI3C 1F3JB 2AJYL 3VI4B 1MVUA 2Y69B 4P5MA 2OM5A 4F9PC 1IE4A 4XMZA 5BW7A 1CGUA 2B9AA 1WZKA 3G6JA 4I3SL 1E5AA 3UYPB 1UXWB 5C0GB 2ENJA 2Y5TA 1BD2A 4MNHB 3R7QA 3U6RB 4G6KL 1G7PA 1LD9A 5JHDB 3QR1A 4OBRA 2OMXB 2KC0A 1U95A 4QXWA 3HA0A 4MMZB 3TTSA 3IJYA 5FK9B 3UCQA 4LF3A 3BO8A 2X40A 1JWMB 3IS1X 2AJXL 4FI8A 1ZTXH 3BSZL 4OLVH 3HBGA 1R3LA 2ZXCA 3BSZA 5BVJB 3ARQA 3IXAA 1IGJB 2NUPB 3NABL 1SOSA 2PCPA 3A0OA 1SZNA 1L9RA 3J07A 3MCLL 1KBPA 2ZOKB 1PYWA 1NCDH 1P6AB 5C0FB 1IL1A 1OKEA 1S7UA 3FCSA 3GXMA 2ISDA 3VXQB 3IVKA 4WK0B 1P2CA 1WO2A 4K9EL 4R2GD 5BUGA 2OK0L 4I4WA 4L8SC 3T0DA 3BFOA 4AXWB 2IDUA 2NXYB 2CRIA 2VLKE 4RDQG 1DQQA 1S7QB 2NNFA 2F74A 2WBWB 2CIIB 5D96B 3LEXA 1IBGH 1KN2H 3GSXB 4OV6F 4MQXC 8CGTA 3CXDH 3RPIB 4LCUA 1HEHC 2A1WL 4KHTH 1R24B 2WMPA 1I85C 3MO1B 4HIHA 1MZYA 5AAMA 3POCA 4IKKA 1WBXA 3Q05A 1GHFH 2EH8L 4KK8D 3OXRB 1DSYA 2B39A 1OP5H 4TSAL 4ENEC 5BV7B 3RTQB 2Y6SC 4GT0A 1Z9LA 4UQ3A 3EJSA 1ADWA 2XZAL 4NWUL 4DESA 4U6YA 5TH2B 2FUTA 2W07A 5IBLC 4DP2X 4AMKH 4MXVE 4BINA 3W11D 3VXTB 2EVHA 2VLLA 3TBBA 1LQBC 5DURD 5IVXA 4TOYL 3RRQA 3LPOA 3Q6GL 4G9DB 1ILUA 2PO6D 4FJYA 3ENEA 5CJBA 5T1JA 3SPVA 2ICWB 5CR1A 3VXNA 4MX7A 4C56B 4O2CA 4BCXA 2GG1A 5I1JL 5CINH 4PBXA 3UPAA 5L9DL 2Z6FA 4HS8H 5F7WC 3P0YL 1J0HA 1SHXA 1KB5B 1XSJA 3GXFA 3HFMH 1OGPA 1IAKA 4UU9A 3D05A 3CFKA 1Y0LA 3US9A 3I75A 4X6DA 4U33A 4J3WA 4HZLB 1KJ2H 4B7LA 5IVZA 4IOIA 5F6IC 4PJCB 3BGMB 2BVQA 4JMXA 4WI2A 3RVXC 4JLRA 1KBKA 5AW7B 4U1JB 3VSTA 3GBML 4OGAC 1A9BB 1SLWA 1IGYB 4L8BB 2NY6C 4MHHG 1JAEA 3GMLB 4L4VA 4EN3D 3DJZA 5L8JB 4FE9A 3SKMA 3EFDL 4YWGL 1Z1WA 2EICA 3GXTA 4KROD 3CSTA 1K5NA 2YO3A 2XXFA 1QFWI 5IQ9B 3EUDA 2IH1A 4FA8A 2IJ0C 2HRPL 2BXYA 2X2JA 4CSPA 3QA3A 3IGFA 1DP0A 4MMXA 1KGUA 4IBWA 5ACZB 2PCYA 2DRUA 5GHWL 2WXLA 5DZ9A 1G7QA 3IEAA 3QQ9C 3DV4A 3KPRA 1O7VA 1FSKC 2NY3D 4HCRH 4Y4FD 2FBRA 1SEBB 4S0HA 1OSZB 3WAJA 4OZIA 3DMMB 1MW3A 3TIEB 4DN4L 1N4XL 2I60H 4JN2A 5IMMB 3QDME 1BAWA 1XQ4A 4EO5A 5B39A 3BE1H 5KN5B 1TF4A 5HHPB 2VT0A 4KI5F 2BOCA 5KYYA 3MOQA 4Z1PA 1ASQA 1P4LA 3LSOB 3VI3A 3WDIA 4QJ4B 3RU8H 3SD2A 1KC5L 4G6FB 3RWFA 2QTVA 4CVWA 1RMFH 4RDBA 1HH6B 5FR3A 4LDCA 1KBGH 3DHUA 3NYKA 4JY6A 3UOAB 3TT3H 2YPVH 4JY5L 3V6ZB 2D0FA 4R3SA 5FDYA 1JRHH 4Y7OC 3BP5B 1PD6A 4QOKB 2X2IA 4WW1A 1CDIA 2H32B 3TFBA 3BESR 4XP1H 4OCYH 5BS0D 2FEDC 2NTFB 3WS3A 1OTSC 1OP3H 1THAA 5GGQL 4R26L 4NC1C 2YRPA 4F2MA 1T66D 1XGTB 5DD3L 5HSFA 4MNQE 4N2BA 4ANWA 2PUQT 3MYJB 3RZCD 5EZPA 3AROA 4H8VA 4PS4L 4PJBF 5ABDE 1BX2B 2DYRB 2X28A 1ZCRA 2X9YA 4U6HB 2GYSA 2W60A 5EV7A 1D9KC 4HWNA 3GMMA 1OGAA 5F3FA 2VLRB 3C08L 4HCIA 2YMXH 4WO4B 1QWUA 3QIUD 3KYAA 3L5XL 3ARGA 1BQ5A 5TK4A 1G87A 2J1WA 5KBMA 4NUQA 3EHBD 4LHUG 2COVD 3H9HA 1L5GA 1QI4A 2HFFB 4LOUC 2FR4B 2Y1AA 3K6OA 4PMFA 3ZE0B 2VR6A 1V54B 3EYSL 3C5ZC 4Z7VE 3DX3A 3N44B 2AXFB 2VMEA 2G2PA 3V4VB 5E56A 4GRWE 5FF6A 1FNEA 1ZS2A 4M7ZC 4OCSL 4S1QL 2HJLA 3MJ9A 3CLEL 1E5CA 3DV6B 2XG4A 1TT6A 5CEYB 4IU2A 2X89A 1A8ZA 3S36H 1NWOA 2DQEH 5CHNB 4WWKC 4YHNA 3RNKA 4R8WL 4OV5B 4DGYL 5GPRA 2MPAL 2PLTA 4NWTL 2KQNA 4DKEL 1U8QA 4AQAB 2HFGH 1FIGL 1PMYA 4M5TA 3FCGA 3JYCA 2A74A 1EXHA 3COOA 3ROLA 4K3JH 2IC2A 1FA4A 3QEUB 2DLEA 1GVIA 3VRIB 5CGMA 5TFSL 2UXTA 1TXKA 1CFSB 1XB8A 1RERA 1BF8A 3H9SE 2J6EL 1R33A 1NUGA 1IBYA 2F53A 4GSDH 4P3CL 2GB2A 3SB3A 3BSHA 3ZX1A 1LJMA 4BFOA 3MXVL 4PG2A 2VR9A 4XCNA 3VG0H 3CDYA 3DARA 3FQ2A 2R83A 3GMPA 5H35B 2P4AB 2BSED 2F0CA 3C60B 32C2B 3HBPA 2JQZA 1WFUA 4MNGE 5TF1H 2WXNA 4NN6B 5DJ8B 2MKWA 3AZUA 3HB3D 1Q0XL 4J8QA 3I6LD 1JUFB 1LDSA 2X9XA 3BWUC 3QJOA 3A67H 3FQUA 1MNUL 3ZT6A 1Q0YH 5F7DB 3FT1A 4HJ0D 2XLLA 2OJEB 4YHOL 4NJ9H 1PZ3A 3KLAA 4M8QB 1A4JB 1RJYA 1MELA 3B4NA 2V2XB 4NP9A 1TVHB 3PFUA 4K2UL 2AQNA 3QJRB 4HT1L 4HUVA 3SEPA 4C4KO 4HAFA 1MCLA 3M7OA 5ABAA 2PYFB 5B7MA 1K3IA 4YSQA 3L4VA 5JUEH 2HUEA 2HT3C 1OAZL 4I48B 3QI9B 1UYWL 4MJ6A 1ODUA 3PXHA 4K3DL 5D7JD 1T1WA 5HJDA 4BFIB 1WC7B 3GC3A 4BH7A 4MD4A 4EKXA 3B2MA 2H1LM 4ODWA 5F7EL 4HUCA 2JJWA 5EN2A 5D4IA 2FWLB 1G9MC 2AJZA 4BH8B 5AG8A 3SYQA 2Z7YA 4IOSA 1F4HA 5IUSA 1X4XA 4GP8B 3CSGA 3ZE1B 3ZIMA 5JZ7C 3KLSA 2DV6A 5EIIA 1BZ7B 5KSBB 1I9RL 3LOWA 3LQZA 4RRPM 1XGRA 2ADFH 3P9LA 2A9DA 3UYOD 1XX9C 3WUWB 4P9MH 3OKMB 2QSVA 3IDYC 1ZHKA 2DLIA 2OJ1A 4Z3HA 2DQTL 1E4WH 4LLVA 2EE3A 3AADB 2XA3A 2QPUA 4ZAKC 2DL2A 3EBAA 4N25A 2MIZA 2PXYD 4QRRA 3ZE2B 4XNUH 4BZ2H 1PX3A 5CJOH 3TBVB 1BQLH 4FP8H 5DUJA 4E41A 4WF7A 1ETB1 4ZQTA 7PCYA 5JXED 2VIRB 2YSTA 3OAUL 4NO0A 2CJUH 2ZT9C 2DQCL 5HGGS 4KTGA 1SJEB 1VERA 2Q7NA 3UJJH 2JVUA 1IC7L 1NBZB 5EU5B 1T2XA 3ETSA 5KJRH 4L37A 3MLZH 3QEHB 5DZVA 2ADGB 3VFVA 3WGVB 1U8PB 1WK0A 5KZCB 1IEBB 1GW0A 3FN3A 4ZFOA 5IESL 1VGEL 2NDFA 4DTGH 1CBVH 1DQML 3WXVL 4XAWH 2FO8A 1K4DB 5ETUB 3VI4F 2XBZA 2PETA 1QATA 4LIQL 3WHE0 1KB5H 1OM9A 2GJ6B 5GS2H 1U8IA 1FZMB 4WTZA 3V6FB 4ZODA 4DEWA 4ZXBC 3A6OA 3SY0A 2V33A 4TYUA 3HN8A 3HCVB 4JFOB 3K2MC 1RZ7L 3FFOA 1KJ3L 3VX1A 3WMSA 2ZKHH 1TETL 3ALPA 2BNUA 4ZSOA 4PN6A 4BZ1H 2P1YA 5JNYB 2XV3A 3Q8BA 1ZV2A 3GSWB 4P07A 1CURA 2X4PA 1WFTA 3ULUC 5DHVB 1QYGL 4JM2B 5C09B 5I8CA 2GTZB 2X12A 1IAMA 2VLKD 3NA9L 4WENB 2YXWA 2FGWL 3BP6A 3ZL2A 2ODIA 4C57C 4KZCA 1WBZB 5GSRB 5C0RL 4WNSA 1XV8A 2UZIH 4EI5D 4FXGA 4PGBB 1XR8A 1UD6A 3K6SA 3X1BA 1F97A 5GS1C 2EUVA 1XCXA 5DO2C 3GYRA 1DVSA 4H2CA 1OQXA 3ILPA 3QQ3B 2VM4A 1F3RB 1ZT1A 4UT9L 5DR5H 1KTLA 2Q3AA 1CG9A 1MQKH 1SFHA 4AEHH 2Z92A 4CADA 5GIRA 4JKNA 1OP4A 2RACA 3Q2VA 1SPDA 3IFPB 3NACH 5E8DL 1JPGA 2R4RL 3CZGA 3QSKB 4QGTA 4YHKH 5FYKU 1PY4A 1VESA 3LPGA 4XMLH 2BPBA 2YD8A 1RJZB 5I73B 1Y6KR 1MFCL 1SQ2N 4G8EA 3U83A 2E75C 3FQNA 4KUCF 4NT6B 1I3VA 4TNVF 3PV6B 4PLOB 4MXWL 5E1AA 2H4EA 3C8KA 2WQ8A 1FRGH 3IMWA 3T6QC 2FT8A 1RIVL 3APCA 5I8EA 5C0CD 3VGHA 3ARFB 3BPNB 3U9PL 1KSRA 1N5AB 2B8OT 1DQTA 3QIBD 2H32H 3PWPD 4O02B 3U7WH 2KLRA 4ZTOH 5DC0A 4E9XA 1ZV5A 2A9NL 4P5RA 3KPMA 3BT2H 3GQFA 3BPOC 4PVNA 1JZ6A 3ZQXA 3RYMA 2QELA 3KCWA 3P77A 1AP2B 4YIQA 5I28A 1U8HB 1J7VR 1GGIH 2IG2H 2K78A 8FABA 5IROD 5SWZD 2EZ0D 4CVXA 4UIKH 3FB6B 3D3VE 3MCG1 1MFVA 1E8YA 2WWKT 3IAQA 1AAJA 1HHHA 1XBDA 4IMLA 1T1YB 4KV5E 3A6CH 3C75A 3QWNA 2EVJA 1AGEA 4PJCF 1GW6A 1TEFA 5HPMA 1YECH 1N6VA 4JPWH 1KPRB 3MV7E 3TA3D 2FH8A 2CLRB 1WAPA 3SGKC 2LGNA 2B15A 4GBXA 1QW9A 3DPBA 3VO0A 1WCBB 4OCXH 1YMME 1EANA 5CEZD 4F37F 3ZL1A 1O0VA 1RV6X 4L0PB 2X2HA 3N41B 4NLHA 5JXAL 4L05A 1F11A 5ALBH 6FABL 4ZOCA 2GIMA 1MCSA 4FTDA 1S9XB 4ZOAA 4B9KC 1G0YR 3LN4B 5BQDA 4AV0A 3DTUB 3MRKA 2R7EB 3DUSB 1T3FA 5C0JB 3RVUD 1B6UA 1N6QH 4XNQB 3IMSA 5CLTA 2K9FB 3GSRA 3ILQC 1J5OH 1EWHA 1KNOA 5GGSB 2JMRA 4FC3E 3X1NA 3CFMA 1USQA 4LSTL 1DYZA 4HAGA 5BZDA 4FQIL 4K7PY 5GZOC 1BG9A 2J20A 2WK2A 4BFFA 2VAJA 3FO9B 2W0KA 4RAVA 3QQNA 5JIQA 2NZ9D 4TRPL 1CDBA 1S6NA 2BC4B 3I9AA 3VWJA 2PPAA 1BZEA 5DI8B 5MENB 4B9ZA 1CYWA 1WZMA 4GKNA 3L3OA 3TN0D 1KYUA 1NL0L 3KPSA 1YEFH 3CG8A 1GOFA 2QL1A 3K3QA 3O2VH 4XCEA 3TJHD 1AKJD 4G8GA 1ZVYA 3V2AR 2QKSA 2X70A 3UTOA 2VZ3A 3DTXB 4PJEA 1TZGL 4MS8C 2RHEA 3NCEB 1TCRB 3X3GH 5E9AA 4N2KA 2WVVA 1IM9D 5AW1B 4MJIB 1P7QD 4WIQA 2OTPA 4ZUSA 4M1DH 2PO6B 4IHOB 5KEZA 4F7MA 3HVNA 4LESA 2YLHA 4ANVA 5KVEL 1P4BL 25C8H 3M88A 4KTDH 5CP3H 3O9WC 4A1RA 1BJ1H 1CLVA 3LPFA 4ZUVB 3SJVD 4NNYA 2GBUA 4ZMXA 3M46A 1AR1D 4UTAL 3H4HA 4AZ8A 1F1AA 4UTAA 1DJZA 4XN7A 3V0EA 1CIUA 1J0ZA 4POZC 3T1FB 4JFTA 1QNZL 3V52L 2LU4A 3SOTA 1D5ZB 1SDAB 2XN9D 4I85A 1BOGB 2W94A 1WIPA 1OCCB 1QSFD 2DQIL 5FO7B 2BFVH 2IGFL 3BAIA 3G04B 2BDNL 3QPQD 1FBIH 1GPOL 1QTPA 3BHBA 2WXKA 4HEMA 5E9DA 3ZE0F 1WAEA 1OAKL 4KROB 4NC1E 3ETTA 1KBBA 5B21A 1N0XH 4TQIA 2GJJA 5EEVA 2JJUA 1HHIB 3KJ4B 3N44F