2KLSA

Apo-form of the second ca2+ binding domain of ncx1.4
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
157
structure length
157
Chain Sequence
HAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKGGFTITEEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKSTVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sodium/calcium exchanger 1
publication title Ca2+ regulation in the Na+/Ca2+ exchanger features a dual electrostatic switch mechanism.
pubmed doi rcsb
source organism Canis familiaris
molecule tags Metal binding protein
total genus 23
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2009-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2klsA00
3RB7A 2KLSA 3GINA 2KLTA 3FSOA 3E9TA 2QVKA 3EADA 3H6AA 2QVMA 3FQ4A 3RB5A 2FWSA 2FWUA 3E9UA 3US9A 2DPKA 2LT9A
chains in the Genus database with same CATH superfamily
2UYLB 5KVDL 3UTZA 3VYNA 1U3HD 2CHDA 4G8GB 3VFRB 3WFDL 4N2IA 3QS2A 3CK0L 4LNRA 3RBGA 5L2KA 3CC1A 1HFUA 4PRDA 2CRIA 4QRUA 1IGIH 3ENEA 3I9IA 3FT3B 1AS8A 5T33H 5DO2D 2HTLD 2AEOA 2EH8H 5EU7C 4F2ME 4WHTB 1S9YB 1IQWL 4G59C 3OGCB 1KELH 1CU4H 3MRJB 2Q86B 3QORC 3ZKXB 3BKJL 2JTYA 1KJ2B 5I6XB 4P9ML 4WKXA 3L54A 3MA9H 2E9WA 5HYIA 3P69A 2BHFA 1J0IA 5J57B 1RMFL 4P46D 1KPUA 1REIA 1CYGA 1J8KA 1MJ7H 2J5LB 3GBEA 5E0QA 1JPTH 3EDFA 2CCLA 4GQ9H 1JRHL 3M7FB 1OT1A 3QIWD 5GGSB 1RVFH 2VZUA 2ZOLB 5I24A 4OZ4A 3L1OH 1NICA 1OQXA 1J8HA 3TO4D 2GJZB 3KPRD 3RRQA 4DQOH 1HZHL 3PABA 5J6HA 1EFXD 4F8QA 3G9VA 4JDZA 4KGJA 3GSRA 3NN8A 1I1FB 1VZHA 2WZ6A 4QHLB 3I6SA 4JGJA 5MERB 4AIOA 3NDYE 4NC1E 3QXAA 3FRPG 1A7RH 1UM4H 3AADB 3CFIC 1Q0XL 1SJVA 2Z4QA 1FFNA 4J3BA 2FIRT 2W9DH 2OA9A 2CDFA 2WQAA 2D0GA 2ZKXA 1EVUA 1BIIB 1AG0A 1OTTC 2ZPKH 4PV8A 4PSPA 4UINH 4XWGL 1QR1A 3QIUB 1BHGA 1B0RA 1Z5LA 2XWDA 3B6SA 3I9AA 2KI6A 3FB8B 1ZV9A 4XNUL 4KBPA 3A67H 1M4KA 2DYPA 4MJID 4M5YH 3APDA 3DYMA 4NOBA 1C5BL 3T2OA 1L0PA 4L3EE 2OL3A 3PJLA 3CHPA 1LL1A 4GO8A 4OZGA 4MMZC 4F5CA 3DUUB 4MAYA 3ZIYA 4X6CE 1HI6B 5CGTA 2X9WA 1JOIA 2EIKB 5DF0A 1PLCA 1Z66A 5E00A 4OF7A 4XVJL 3A6CL 3DVFA 4EZLA 4KMQA 1QTYT 4MASA 3AM8A 3DROA 3MREA 2MNJB 4BINA 4YSTA 1QVOB 2VQTA 2WIIA 2VQ4A 1VIWA 4Y4FC 4P59L 3TTSA 5FUCE 4R8WL 3WAKA 1M1SA 4H0IA 3VXSA 1BVKB 1JNLL 4BZ1A 4YSPA 4Y4HA 1ICTA 4JO1H 1EQWA 5E08H 5BS0E 2YZ1A 4MA8H 3D85B 1GTFA 1ZE3H 4JY6A 4Q9RH 4JANA 3K2MC 4UOW0 1LWHA 4F80A 2C3HA 5DO8A 2RIKA 2TSAA 3HS9A 3FF7A 5HJ3A 4FNLH 1ZHLB 3HUJE 1KB3A 3EJRA 1UWXK 3O4LE 4GQZA 1HHGB 4Z7UE 3UJTL 2JI2A 3IAGC 1AIZA 1DSYA 3TT1H 2H3KA 1ZRUA 3WE1A 4D2NA 3UYRL 4FTVD 2IQ9L 3QUXC 3GMLB 2RGSA 3CGTA 4U33A 2OSLA 3OPUA 2GBTA 1NGWA 3EJUA 1KYDA 1ET5A 1W9XA 4CU7A 3TP4A 5E2VH 3BDXA 3VSVA 3WO4B 3VFWA 4WUUA 1AG6A 5DT1L 5TQ0L 2K8QA 2E6QA 5DJAB 2EIJB 1YSOA 3Q44A 2MOGA 3KYNB 1OCRB 1WHPA 3LDBC 1J0ZA 2AITA 1TJGL 4PJIE 5I8KL 3KW8A 1N8ZA 4RAUB 1OCWL 1KJVA 2OMBA 5AW2B 4GUPA 3GUTB 3WUWB 1UXWA 2YGQA 3O3BB 4IRZL 5I76A 4M1DH 5DJ8B 2X6CA 3CN2A 5FHAL 3U2SA 5CS7A 1R3JA 5E8EA 4ABUA 2VGLM 5T1MA 4LSTL 2ZUYA 3HC4L 4EPSA 4JQIH 1M2VA 1HEZB 5SX4H 2EDQA 5F1IB 3NFSL 4KTEL 3VG9C 4BV1A 2G2PA 1AXSA 3BZFA 1Z3RA 4LLYB 4CGUB 3CNKA 2D4FA 4NM8H 4X5XB 4UQAA 3ZL4H 3TEYA 2NYYC 4JFUA 1E8XA 3ULUD 1BVLA 1JFHA 1LMKA 2X6VA 5DA4A 1SMDA 1KTCA 2JK5A 5KYUA 5E1IA 4MJ6B 1EHNA 3UMNA 1XIWA 3HVNA 5CIPB 2YR3A 3HZ3A 1T21B 4NAQA 2A7BA 3IFPA 5CUSH 4F57L 4RIRA 1KBVA 5FAAA 3J7HA 3DX4A 4NZTL 3U2JA 4FFYH 4HGMA 4HWEH 3ARWA 1FH5H 1KY6A 2MPVA 2GSIA 3R1GL 5DD3H 2J6EH 1G9MH 4AOFA 2F5AL 5CKAA 4EEEA 1C5CH 2XN0A 3WJLA 1I82A 4PRIA 2JKSA 3WKQA 4DT2A 4QLRA 1DQIA 1BSIA 1FIGL 4GIPD 4V1DA 1SYVA 4LLQA 4UOQA 3GMPB 4YZFF 4LMQE 1IC5H 3UYPA 5IVOA 2Z93B 3PWPB 3VD7A 2HFTA 4E9SA 1BEYL 3BEWA 4O02H 5EC1A 3HNSL 3QQ4B 1IGML 3ZGHA 4E9RA 1NBYB 2IGFL 3B83A 5EZJA 1HCZA 1A4JA 3L81A 4PU2A 4O2CB 3KH3A 3ULUL 2AQSA 2BERA 2FYVA 4D0DA 1PZUB 1FO0L 2ITCA 1BJ1J 3HI6H 3QFGA 4K7FB 3IXAA 3FSVA 4M4RB 1FE8H 1HDMB 4LBEB 3LH9A 3KD4A 4W9ZA 5A2JH 5DEFB 2J1XA 4DEUA 4X6EB 5IB3B 1NC4A 1CICD 3K6SA 4GRWH 2L7EA 3QUZA 2IDUA 4HPYH 5ID1B 1QEWA 2FTAA 4NQEB 4HAFA 3R06A 2QZ5A 1CD1B 3V0EA 5A2IH 1TT6A 3D51A 4E36A 3E6HB 1ZTMA 1WBXB 3CHXA 1PDKB 4X7SL 3H7BB 5E94B 1FGVH 1EEQA 2YN3A 3HCVA 3PGDA 4X7CC 4Z8FL 2YFOA 5HDBE 4N8PA 5BW7A 1MREL 1FVEA 1NGZA 3UGUA 1MJ8H 3ZT5A 1DCEA 3SDYL 5JZ7C 4AITA 2GHWB 2V33A 1VEMA 3PXHA 1U8KB 3IRCA 4LCWA 1XGPB 4JPQA 3V79C 3OB0K 3VACA 2EQDA 3Q1SH 1RU9L 4NCDA 1HL4A 1X7SA 3BX7C 5IP4A 4OT1H 4PJ7E 1KGXA 5JIHA 1B0WA 1DBKL 4UTBH 2EUVA 4I88A 5DK0B 1N70A 4UU9A 2QEJA 2WXGA 4N6QA 1O5PA 2K0RA 4WHCA 4HJSA 3KLSA 1H3TA 1FP5A 2EXYD 1FLRH 4FS0A 1MHPL 2IPUK 4XCNA 3QFJA 4Y8AA 3JWDC 3BUDA 4RGNB 5K9OB 2VN4A 3KPSA 4KY2A 3WU1A 4D3CH 3OHXB 3ZHDA 3LS5L 3OKOB 3LSOB 2VDOL 5FXCH 1QI3A 5F7KC 4NZ8A 4CW1B 4RNRB 4U6XA 3VWKC 3L4YA 1OSPL 1T3FB 3MYZA 1ES0B 4FFZH 3O3EA 4QXTB 1MRFL 4WWKB 4LLUA 5AG8A 4Q6KA 3GXFA 2HT3C 3FK3A 4LLDA 1TZIA 2P7TA 3O6MH 5EU5A 3T6XA 2PXYB 4YSCA 2D31A 5D7LA 4KRPB 1NUGA 3NESA 3FFOA 1RJCA 1KB5B 2FNWA 3QB7C 3V52L 1UADC 4WTZA 5HHQA 1FZJB 2RB8A 3S5ZA 2VO5A 1OXYA 4ZXBB 3UPRA 1JGDB 2IO5A 4O51B 2DQCL 3X14A 1WWCA 4JL2A 4G8FB 4G1MB 4JFYB 5C8JA 4RSYA 1WTLA 6PAZA 5DS8A 1TQCB 4KVCL 4PJEB 2EVGA 1JN6B 4NYLB 1TZHA 4HKZB 3MOBH 3EBIA 1PFOA 2OMYB 1HHHA 5D6DC 5FW6A 3QE5A 5GGRB 3D0AA 5FYJE 1FWXA 5CEYB 4HIEB 3SPVB 5MENB 2F7QA 4LCYB 3ZYOA 3NSXA 5DRWB 5I1KH 3E6FB 3WIHL 2ZSWB 1T0NA 3D39A 4JE4B 4O00A 1CC3A 5FYJU 4ODHL 2YAPA 5FA4B 3D07A 2GIMA 2VSMB 4G6MH 1AR1D 3GSUA 3SQOL 4R0LC 4Z7OE 1QWNA 2I60L 3F84A 4NKQB 4UQIM 3K1KC 3ARBD 4HGKC 5DXWA 4XI5C 1MXGA 2G2NA 4K94L 1BIHA 3VI4A 4PJEF 5EEZA 2E27L 4O9HL 4F2FA 2KYIA 3Q3GA 1GAFH 5FPIA 1O9ZA 1PX4A 2WXIA 2VDPL 3L3OC 1WFTA 3ASWA 4HULB 1OPGL 3QHTC 5TE6H 5DJ2B 4ATWA 3SDXE 3NAAL 4LQFL 3TZVD 4OFKA 3DSFH 2A77H 2QR0B 4IIQA 1OK0A 3VD4A 1RHHA 4H0GA 5F1KC 4R3SA 5KYWA 3DMMB 3L1GA 1I7ZB 3FUMA 4HUWA 5DUML 4PLNC 1OB1A 2CA3A 1BJ8A 3UP1A 5I9QB 2NXYC 1G1OA 3CPLB 2C3GA 3ESVF 3VDCA 4LASH 2ZF9A 4JGUA 3MV7A 5KG9B 3VFNB 1XD1A 2FECI 3B8SA 5IHHA 2ZXEB 2GY7B 3RWIA 2GITB 4X4KA 2YAOA 2CIKB 5I0DA 4C4UA 1ZTXH 3FQYA 3WDJA 2ENSA 4PUBH 4OQTH 4E2OA 3OD3A 2CA4A 3CXDH 2E4TA 1WFJA 4NC1C 2J8UA 4P07A 5HGHA 3OJMB 5L4JA 5TJWK 2NUTA 1LNUB 3P30H 4NQCE 3EDEA 3HMXA 5IQMA 5DJZA 1MKFA 3HG2A 3TBCA 4MWFA 1HHJA 5KSBA 3N0AA 2ICWB 1K8DB 5FOBA 1U92A 1LP9B 1JTTA 4QXGH 1OSZB 5G5DA 2UZIL 4Z7WB 1MFDH 3CSTA 1MHCB 1GYCA 4MMYB 3WUWG 4HJJH 1KY7A 3OR7A 1SXNA 3TBYA 2VNCA 1DYZA 1E5UI 1RK0A 1OL0A 3AWFA 1U3JA 3EIFA 3MRKA 3LS4H 3MUHL 3QHFL 1LK3L 5H37G 3BVVA 2X1QA 4P9HL 4K7PX 2IQAA 4FQXB 4NXKA 1MIMH 2WYHA 4QT5B 4XVUC 5INCA 2OYLA 1CO1A 2YA2A 4JGMA 4Y5VA 4ELMB 2LHAA 1N59B 2DQDH 3BH8B 4AM0Q 4AG4H 4P3DA 3Q6GL 5BO1H 4I77L 1LP9F 3BKML 1E4KA 1HKFA 3PWLA 5TF0A 1CFVH 2Q2LA 3S36L 2FE0A 4DKDC 2X6UA 3W0WE 1QSEB 4Z7WF 4ZW3A 3O6KH 2Z1PA 5JLZB 1S7QA 3K8LA 3ZTEA 3ES6A 1H6FA 5IW1B 4DP9X 2X40A 2WLKA 5ADPH 4ZUVA 2XETA 4NKOA 1AZRA 2H2PD 5I1IH 3T3PB 2Z92A 3ZY7A 2OYMA 3VB8A 4OCSH 4OLVH 4ELMF 1DLFL 1JGLL 2RH0A 3BVXA 3QDJE 4GRWB 4J2QA 3WFZA 3SYAA 5KOMC 5ABDE 1MRCH 4D9LL 2ICEC 2XFGB 3B9KD 5HHPB 4BFNA 2XXGA 4M62L 1XHHA 4U1JB 2NR6D 5AALA 5F88B 2QPFA 2XTJC 4FHJA 5EO9B 2VLJB 1AACA 1QBLH 4PTTB 3ZDZE 2FO8A 4U1KA 2YEZA 4LFHG 2EVFA 1MWOA 1T83A 1OOWA 1I1YB 2X4TA 1ZWIA 2D03L 4H13C 2NX5A 4WNQB 5ICYA 5EZPA 3T3PF 1ADQH 5A2LH 2K7QA 1I3GH 1A5FL 1X5LA 2V9UA 1KPVA 2BSEA 1FL3B 2A9BA 2B1HH 3TIDB 4Y4KA 4ZJ9A 2H0EA 4GRWF 1PAZA 8FABB 4UQDA 2PYEA 5DU7A 4JM2C 1VJSA 3LEXA 3QIBC 1XT5A 1JFQH 1LWJA 5CO1A 1RUPL 2AVFA 2WBJD 3MV11 4QO1B 4L48A 4LL1A 1U2CA 2YKKA 3F7QA 4JFFA 4IEFB 5JPMB 2UWEE 1T22A 1EVTC 4P57B 4CSSA 5LKNA 1WIOA 1MLBA 2VR9A 3HB3D 1ZLDA 4Q52A 4WFFE 2ZF8A 4ZUUA 1C9SA 2WLNA 2DWDA 4GAJH 3CWGA 4PHXA 2WKOF 3PDOB 1NLBL 3RVXC 4ZBJA 4IOSD 3RVTD 4O58L 2ADGB 4ZG1A 2O72A 2VXUL 1ET8A 1WAAA 2NY3D 2HPTA 1T7YA 2VDML 4RBPH 4I0PD 5CZVL 1SUHA 4W6WB 1QPPA 3B7YA 2I9TA 2QV2A 3P9MA 2KUTA 4KUZL 4OW6A 4A6YH 5D2NA 2B8OT 3L7FA 5EO1A 2G3ZA 1MDTA 4YSOA 3QXVA 1GCYA 1ORSB 4AC4A 1F4WL 2X4OA 4KI5F 3DK2A 1MPAL 1F11A 5J1SC 2R4RL 1LM8V 4JZOA 4OR1A 3CQQA 5D4HA 3QK0A 4HKBB 1IKOP 4KTDH 4K4KA 4XNQB 3OXRB 1NKGA 5ESVA 2PCYA 1M2OA 2QHRL 3CFNA 3DHPA 1EO5A 4TNWK 3RZCC 2QDVA 5E1AB 4AMKH 4PWIA 3U7YH 3VM7A 1MF2L 4FA8A 4A2LA 4MJJA 1CN4A 1A6ZA 2XIDA 3EZJB 2WWKT 1UVQB 2YQBA 2B16A 3Q1EA 4WI2A 4QTFA 3DXAD 1NAKL 3S0PA 2DPKA 2O6DA 4RISL 3O4OB 4NPYB 3D5OF 1R33A 4NNYB 2GFBA 1X5ZA 5E0FA 4KVNL 2VC2H 3HOGA 4OTXL 1SBSH 2XNAB 3T6ZA 4GMTH 1I75A 3DOSB 4HJ0D 1XL4A 3C5ZB 5EPMB 4DZ8B 4Q6IB 2ZOTA 3DIFB 1OM3H 3HE7A 2CHWA 2NY2C 4A7GA 1OHQA 1JNHB 3LQZB 5SV3A 3FB7A 2DH2A 1BAFL 4GMSL 5E8DL 2G0LA 2CH8A 4AH2B 3KYMB 5BQ7A 1DLHA 3PPSA 3QEUA 1U8LB 3MGOA 3HA0A 4RRPA 5CLZA 4IOFD 2YJLA 3A4EA 4R2GD 5DJXA 4XNYH 2DQIH 1G4RA 1Q9KB 4AQ1B 3D18B 3UYOD 1NEZB 1QABA 2V9RA 4I3RH 1CS6A 2DQEL 1FN4B 3AB0C 4KI1A 4QRTA 4HBCL 4YR6A 2AK1H 4RZCA 3U1QA 4WLCA 4NWUH 4L4TD 1K4DB 4L0YA 4XTRC 1IL1B 3MRBB 4LARL 2KZBA 3MRMB 5BRZD 5LUMA 2OLDA 5JNYB 3FRPA 4WU5B 2Y7SA 1AOZA 5B8CB 5HPOA 1A9BA 1V27A 1QA9B 5MEPB 5CCKL 5F7YC 3IJ8A 3QQXA 4JJHA 3EYQC 1XZWA 4YUEL 2WY3B 2V7NB 3ATEA 3KJ4C 4PRNB 5D1QD 3MNDA 4UDUA 4DF9A 2C8NA 2ICWJ 1A4KA 4GIOA 2OMWB 4JW3A 4FJZA 3QPXL 3W82A 1OE3A 3LKOB 5B4MC 4RFNC 5C0RL 4UQ2A 1OY3B 5T3XH 1KXTA 4QTIL 1YQVH 2CRMA 5DC0A 2WZPD 3HRPA 4JRLA 5GGVY 4DZBB 2ZWYA 1DL7H 4HT1L 3L3IB 1BM3H 3SB3A 4FFWC 4FQ1H 5I17A 2HFGH 5GZNC 1DUZA 2EILB 2NT1A 4YHLH 4HA1A 1S7WA 3WO3B 3UZEC 2LTQC 2GSMB 4AXWA 4ZFZA 3WXWL 5ES4B 3WKMH 3FBKA 3TCLB 1IEBB 2XV3A 2K3TA 2XXFA 3HMWL 1NKRA 1P7BA 4JFEE 3ULSB 5PAZA 2EYSA 2A4CA 2D7PA 4I18A 1BF5A 3M1BB 1WZKA 3LPOA 4GG6A 3VFMA 1ASQA 1P7QB 2M8XA 2BDNH 3UTTE 2MQ0A 4PGJA 4HEPG 4PG9B 2XN9B 3MBWA 3WLBB 2YA1A 2RJMA 4OKVA 3ESPA 4ENEC 3L9EA 5AW1B 4GKLA 3EYVA 1ACCA 2BNRB 2DS4A 3OKDB 4ZTPL 1K5WA 3VD2A 3MRRA 1A0QL 1T6BX 3QJFB 4LO9A 2C26A 2N0KA 4NJAH 4XOAA 3WEMA 2QMKA 2C9QA 4PJ6A 5I73B 1CVRA 5EORL 1WICA 1G6RH 4YHML 4C58B 3MGTA 4EF3A 1AR2A 1YNTA 2NLJB 5DI8B 2BSCA 4JRXB 2FECL 3MRHA 1MQ8A 4N25A 5DJCB 1BD2B 2DKUA 3GF8A 2H6OA 4NO3B 1QTSA 3L3HB 5HYJD 2AV1B 3KGRA 4E41E 3P0VL 2YC1A 4HEME 3G5ZB 1U93A 3EGDA 2NY4B 3MFGB 2ZOUA 4FXGA 2LLNA 2XZQL 5I1EL 3K80A 4NAMA 1DUYB 2QSCL 3WHE1 5AG9A 3CMOL 5KSAD 3KBEA 3X11A 4PD4K 2NNAB 3QZNA 3HI5H 4UQ3A 4MZ3A 4ZX5A 2OSXA 1DQTA 1TG8A 2NNXA 4X9IA 1MCPL 1YYLL 1UURA 4HCRA 4NNXA 4RFOL 5EUKB 2NTFA 5J7CC 3FQTB 7CGTA 3MLZL 1F4AA 5GIRB 4A68A 4JO2H 5KSVB 3RGVD 1NANH 4TTDD 4TSAL 4JEGB 5I1DA 2XV2A 5L2KE 1KG0A 4Y8DC 4PGBA 3BSZL 3U6XA 2ALAA 1ZT7A 1N8OE 3OPZH 5F96H 4YHPB 2VIRB 1R3HB 1I53A 4Z3HA 1FCGA 4X8JB 4J8RB 1NCBH 3FCUB 5LNDA 1FORH 1X9RA 3D52A 4M93C 2EKSA 3L5XH 1QP1A 5J1TC 1INDH 2VQ1A 4AW4A 1N9PA 1KJ3L 3BLKA 5IQ9A 3KDMA 2VLRA 2GTQA 1KWKA 2AEQH 3OKLB 1F8TH 1UD3A 5FYJL 2GABA 1GS6X 1ONQA 5KBNC 3UZVA 2M1KA 3GMOA 4C4KT 4YFDB 3FQUA 5F7EH 3SDAC 3AUWB 4BWUA 3PP3H 2PNDA 4B27A 4LDEB 2BHZA 4R97B 5TF1H 4B60A 4P4RB 1ZT4B 3ZUNC 3FTZA 1J8HE 2DM2A 2A74A 3I3EA 2YAHA 1CD9B 3GHPA 2X4RB 4IGBC 4JY5H 3VE0A 2OXHB 3OV6A 2A9DA 2IPUG 3CIAA 3CXHK 4LCUB 4YHNB 2F58L 1EXUB 2HLAB 4PRPB 2FHCA 1R46A 2BZ7A 3OZ9H 3EG9B 3SJVA 4A6YB 3OR6B 1DBML 2WWOA 3K74B 1N4XL 3P3UA 2ZYHA 3D9AH 4Z3JA 4CADA 2E9BA 4XAWH 3CDZB 5D7KE 3NIDB 4A2FA 1VAHA 1JDAA 4LVHB 4UQCA 3P77A 5K39A 3CZNA 1QBAA 4IU3B 2FQEA 3M07A 1OANA 1U8HB 1FNAA 5KS9B 1HXYB 1SJHA 8PAZA 1M3IA 4AT6B 5MHSD 3W2DH 2ZG3A 3N40P 4WFED 5DD0L 5ITFA 4R90L 1E6OL 3FO2A 3R7QA 1AJ7L 4OZGE 1QEXA 5EWIH 2MCAA 5F0MB 1J10A 4AENB 5D72L 4ZS6C 4TQEL 5GJTL 1J5OH 3VXMD 2H5UA 3AT8A 2JKNA 4PN6A 2DIJA 3QXDB 2NNFA 1ZLWH 3NPSB 2QQLH 5F8RC 4NZFA 3V4PL 5F3BB 4ZO8A 5E5MA 3LQAH 1A6VH 2C4FU 3P2TA 5CZRA 1Z5YD 1S7VA 4GSXA 3RDTA 1KIRA 1GPOL 1IGFH 2O5ZH 5HGGS 3UIYA 5J12B 1FJ1B 4TNWF 1RZ8B 1ZLEA 3VGAB 2ZXAA 5KS9F 3D3VA 2FLMA 4JFHE 5GS0L 1PG7L 3VXSE 5KVEE 4DPRA 2UYLA 2WJ5A 2OZ4A 4G8GA 3VFRA 1GGYA 1NMCC 1P4BH 2LAGB 3DV6A 5FDWB 1IKNC 4H26B 1U3HB 4K55A 3MTRA 1BV8A 2O5YL 4GUOA 2I32A 2WV3A 4MB5A 5C92A 3FT3A 4OSUH 2ZCKL 1L0QA 4PJAB 3VXPB 1KGYE 4J3SA 5JOPD 3BP6B 1FSKB 4WHTA 1S9YA 4YQXL 1HAWA 3QUYD 5JW5A 1JNNL 3H1ZA 3OGCA 2XN2A 4FLQA 5I1CH 5L7XH 3MRJA 2Q86A 1EHLL 1GIGL 4FXKC 1KJ2A 3WE6B 5FM5O 4XVOA 4M48L 2SODB 2P4AB 4GSUA 4LIQH 2V8LA 4D0CB 5K1JA 5JDSB 4P05A 1Y0LA 1CXHA 4P46B 5DGRA 2ZOLA 2XA8H 1EMTH 5GGSA 1FPTL 1YEHH 3VFUB 2Y72A 4X9BA 4WHDA 3H3PH 2GJZA 3EYUL 4WEEA 1NEZG 5E2UL 3WKYA 3EFDL 3QIWB 1MCQA 2P5ED 4TLUA 4DCQB 1W0YT 3IJ9A 5D1ZB 5ALCH 4DOHB 5L4IA 4PJAF 3MV01 3TO4B 3KPRB 1I1FA 1D9KD 4QHLA 5EZOL 4WUUE 2AK4B 4RGMB 3ARED 5TH2B 5MERA 1EFXB 2N1KA 2GT9B 3H6AA 3VXOB 4ODWB 4N6RB 4XC3L 5DJ6B 1FUNA 1F86A 1OF0A 1CFQB 1QKZH 4LSRH 1BIIA 5T3ZH 3VWJC 3V8CA 2C9RA 2E47A 3QIUA 3B2XA 1P84J 3UO8B 3OMAB 3PY9A 5LAPA 3T3ME 3FB8A 5BOPA 3HFML 3TV3L 3PNRB 4ZMAT 1E67A 1L6ZA 1P53A 4RMUA 2MOQA 3WIAA 4BQCA 2Q3XA 5L8LB 4MJIB 3V0GA 4WFFD 5HHNB 3DUUA 4JAMB 1HI6A 1JD9A 2CJTA 3I2CH 3P9LB 4G6JL 2WN2A 4HUKB 2HKFH 1CGSL 4XOEA 4L18A 2B77A 4IQHA 2QGBA 2Z7ZA 3QH3B 4BCXA 3L4VA 4EAEA 1J5HA 3QZWG 4R4FH 1DQMH 4JR9L 1QVOA 2BY1A 4GXUN 4XN5A 4KJPD 4DGIH 2BOCB 2JB6B 3KYKH 1A1NB 1G6RB 4JPSA 3ARDD 5DS2A 4IBUA 1B2YA 1K3ZA 4MCMA 1OAZH 2W81C 1IC0A 1MHEB 1KBGL 1KYUA 3PL6D 3PS6A 4PLJC 2FATH 3HW7A 3D85A 1O5DT 4TULL 2APFA 5B38B 4OFIA 1AFVL 2ARJQ 4PRIE 1TUPA 1SN5A 3WTWA 4NNPH 4NRZB 3ECQA 1R5VB 1VGEH 3STLB 1AHMA 1EEZB 1RPQA 4V1DE 4JFXB 3PREA 2CBOA 1ZVSA 1DVZA 1MN4A 4E0RA 3Q2LA 3TH4T 1NFDB 4HALA 1ZHLA 5EMYA 5F9WB 1LEIB 5F0PB 2WCPA 1A7QH 1IU1A 1HHGA 1T2QL 4X9GA 1ZY9A 1MCDA 2X3AA 3IDUA 3SBRA 2AMGA 3II2A 4KJQC 1W6WA 4OB5H 5KVGL 2J20A 4OZFH 4X50A 4LBAA 4OGAD 4C54A 5JHDA 2KDYA 3GMLA 2NXZD 4FTVB 2ZUQC 5C08B 2R4SH 1X4XA 3IU4L 1KXHA 1CDYA 1YPZE 2YEVB 1S78C 4UTAA 1TVBB 5JORB 4JRFA 1BREA 3TBTB 4TLSA 4GAYB 4YSRA 3C2SA 4U7SA 2H47C 3SYQA 4UQ9A 1BAGA 4J39A 2TAAA 4M6OH 4JDTH 1ZPUA 1YRKA 1NFDF 5MEQB 1A3QA 4IRSD 1XGYL 3ERXA 4GLRH 1FL6B 3HC2A 5E6ID 3KYNA 3MPCA 4APQD 1OCZB 5J11B 4RAUA 1AMXA 3EHBB 1E9PB 4NZRH 4FG6D 4LCWE 2XFXB 3GUTA 2MIZA 3WUWA 2XKUA 3O3BA 3DK0A 1TZGL 5DJ8A 2FH8A 1YNKH 4KNQA 2B2XH 3X3FH 4XXCA 5H37A 3RY4A 1MCOH 4M29A 5CEZH 1E4JA 2OCJA 3AY4C 5IGXH 1HEZA 5F1IA 1HH6B 4GUQA 4M61B 2IOOA 4MDJA 3VU1A 1GS7A 5AAWA 4LLYA 2J56A 4X5XA 3A3YB 2QSQA 4AYBA 1SNRA 1DDTA 5J13B 3QFJE 4FI8A 1JTPA 1M3JA 4LCCC 4RFEB 4KNUA 1ESOA 1CFSA 3QBTB 3L4CA 3ZDXB 3LB6D 3BRFA 3TT3H 3CFDB 3B2MA 4FADA 2YQ2A 4MJ6A 3L5WB 5CIPA 4OLXL 4JFDA 1DFXA 4IBQA 1HINL 4LCCA 4XMXA 5LNEA 1VFOA 2HRLA 1IGYB 1T6WA 5TQ2L 2AJYH 5FS5A 4E5XB 5I6MA 4JRYD 1BLNB 3G6DH 2GTWB 5HHME 2UV3A 5GRJL 3GZQA 2IPKB 3FJTA 2P80A 1AQKH 1HAUA 2LU3A 4G5ZL 3QPQC 4OV6F 3VO0A 3C08H 4EBQL 5D7LE 3NQIA 1UACH 4G80B 4YPGB 4NGHL 3GMPA 4KKCC 4NHCH 3BW9B 3ASOB 3EO0B 2XACC 2Z93A 3HR6A 3AXLB 2X70B 3UAFA 3ZDXF 3NABL 3QQ4A 1V55B 4N90E 3RFZC 2A0LC 2GC4C 2OR9L 2P9RA 3TO2B 2IAMC 4O2CA 3HE6D 2H1LM 2I7SA 4NQVB 2BS71 5PCYA 3FUNA 4NX0A 4K7FA 2YAFA 3UTPD 4KK8C 2UZYB 1HSBB 4M4RA 5TDPB 1HDMA 3GSNH 4JZJC 2HT2D 5DEFA 1TMCB 2JJTC 2ZCHL 4X6EA 4BJLA 5IB3A 3N1GC 4NENB 3WEAA 1Y7VA 3TJPA 5D7SH 5EBGA 5ID1A 3D39E 5IK3B 5D55A 5C0AD 3KW7A 3RPIB 4NQEA 1CICB 3L3GB 2WD0A 1CD1A 1NGPL 4KHXL 2AV7B 4P5SA 1XGQB 3E6HA 4H1LH 2EIMB 3VXUD 1PDKA 3ISYA 3H7BA 4L5FE 5E94A 5DMIL 3T2LA 2J21A 2IOIA 2FUQA 3DTUB 25C8L 3CXFA 3EJPA 3VI4E 5L9DL 1XGRB 4NT6B 3U9UB 5HSFA 2VDOB 4DKAA 4OGZA 2BVOB 4HUUB 1QI5A 4FQCL 1SPDA 1U8KA 4O2FB 1XGPA 3SSGA 1X5GA 1JYVA 1S5IH 4M5ZH 5AYUL 3NCJL 1MJUH 3F7RA 3KL3A 4PWJA 5J6GB 5GS1B 5T1JA 3QW9A 1AQMA 3RVVC 4YHIB 3SDDC 4JFSA 1JP5A 2PR4H 3O9WC 1ZT1B 1U8NB 5DK0A 3IMTA 4BGDA 4DH2A 1FHNA 2TSBA 3P73B 3JUZA 2YMXH 4LVOB 4N8CL 2DM3A 5FUZH 3ARFD 3VGBA 2W07B 5K9OA 1Z9LA 1P5UC 1WD8A 3MV7E 3OHXA 1GMEA 6FABH 2H9GB 3LSOA 1PYWA 1HVXA 1Q9LB 1NEPA 4CW1A 5AW3B 2VW7A 3IJYB 4RNRA 4F15C 5F8QC 1TJHH 2D73A 1F3DJ 1T3FA 4GS7C 4LESA 4N9GB 4I1PA 1ES0A 4QXTA 3R18A 4UV7L 4WWKA 3ULVH 2AS5M 3KEDA 5J6SA 2GJPA 2EAEA 3P54A 4JVPA 5HDLA 2RQ8A 1OVZA 2NSQA 4PJ9C 2J8UE 4HUCA 5CZKA 1A9EB 3BWAB 2LFGA 1M7IB 2PXYA 3VQ2C 3T4AC 2C4FT 3HKFA 4YDNA 1KB5A 1WK0A 2DOCA 3BE1L 2K78A 1FNFA 4HPHA 4ZXBA 1X5IA 4YDJB 3QORD 5KSBE 1JGDA 4WWPA 3OAUL 2ZYRA 4O51A 5E70A 2Z8RA 43C9A 1NAMB 4G8FA 2AP2A 4G1MA 3RZWA 4NFBA 3KYOB 3QZOA 3TF4A 4YE4H 5CHNB 4PJEA 1JN6A 2YOAA 3APNA 4KRLB 4NYLA 4HKZA 1YQ2A 2WXPA 4M8QB 1CTNA 2D9CA 2OMYA 4PY7B 2B3RA 3QCVL 1WH0A 5GGRA 2WXMA 4IJ3B 3KVPA 4J5VA 5CEYA 4HIEA 2YBGA 3SPVA 1G7PB 2VAAB 1UD5A 1ZE3C 2W59A 2EEXA 5MENA 2NW3B 4LCYA 3FTWA 4MZIA 4KTYA 5DRWA 4ZZFA 3E6FA 5C09D 4XHJC 4PCYA 1UOWA 4DKEH 4A39A 3I6LE 3DVNB 3MLYL 4LEXH 2KQNA 2RCSL 3RB7A 2Q6WB 3HRZB 4AV0A 5M7QA 2VW6A 1JZIA 2IFFH 4R5TA 5BUPA 1GZHA 1UJ3C 1AR1B 35C8H 2VXVH 4FOMA 3CSYB 2P1YA 1OTTD 1KYFA 4K9JA 3ZZQA 3W81A 2JJVA 4LU5L 3ARBB 4M8VA 2Y9RT 3V6OC 4TSBH 4YDVB 2RHEA 2DRUA 5D71L 1GGBH 5E6RB 4HOXA 1G7LB 3TNNB 4U1SB 4YLCA 1JUFB 2DMBA 4WU7B 4J3OH 5DJ2A 5B38G 4ICXA 4OZFB 3ZLQC 3FQ1A 4Z5RB 1WFIA 4OCNC 1WFMA 1CE1H 4IRJC 1ROWA 4WW1B 4PMEA 2QR0A 3TZVB 3JWOL 3BPNC 1DQQB 5E4AA 3CFKB 3PGFH 1NBQA 3DMMA 2IF7A 1I7ZA 1BM7A 1CBJA 3IDNB 3V0VB 4U6HB 1P5VB 3CPLA 1B0GB 5IR1B 4QF1B 4Y2OB 3QEHA 4YVNA 5F6IB 2X09A 1Y6NR 5KG9A 3VFNA 2ZX9A 4H8VA 4Y4FD 3UAJC 2ZJSH 3AVEA 4LHQB 5JXEC 2GITA 5AW4B 1LEGB 4QD2E 3WXVH 2CIKA 4F7MB 2DIEA 1O6VA 2AJVH 2YIHA 3K91A 4QUOA 1TQBB 2NX5E 4K23H 3V55A 1BCIA 3LRMA 2OL3L 2V7HB 1BFVH 2AZUA 1XBRA 3MMEB 4ONFL 4XPTH 5DA0B 2DN7A 4MAZA 2Q87A 3SE3C 1Q1JH 3JT0A 3HBZA 3ZK0A 1CVSC 1N26A 1LNUA 2X7LB 2PYEE 4EZMA 3T4YB 4RMVA 5CN2A 1ZLUH 4OI8A 4HEPA 1UHVA 4QOKA 5FKAB 2Q8BH 4A2GA 2VLKE 2O4EA 4HIPA 3SE3A 2ZKWA 2ICWA 1K8DA 2ODIA 4JFFE 1Q0YH 3HC3L 1LP9A 2NZIA 3DHMA 3GK8H 2AXFB 4LRIA 1WHOA 1OSZA 4Z7WA 3EUDA 4RCAA 4BZ1L 1MHCA 4MMYA 3QUXD 5IHUH 1XF3B 3GLZA 2OZNA 1E8ZA 5KBLA 5CSZB 1R3IL 2NY5H 1G9MC 2AI0L 2EINB 2G5RA 4XP6L 4EKJA 3SKMB 1MCIA 4YEFA 4PV1C 1WAAE 3NA9H 4GXUM 3ZUCA 3HHRB 4BUHA 4FFYA 4H88L 3QRBA 1GXEA 4FQXA 1E3XA 4QT5A 4L8SB 3ZDWA 2J6EA 5DHDA 4ELMA 1N59A 3BH8A 5F7MC 3T0WA 4DWHA 4H8WH 4WKZB 1OAXH 1O9VA 2FGWH 5D2NE 3FT4B 2IG2H 2YLKA 3VD5A 1FNEB 2E76C 4L8CB 4YX2L 4ZODA 1ZLVH 1BYNA 4M02A 3TJEL 4AQ8C 1KCSL 5B3JF 1N0XH 2JIXD 3CLEL 1D7DA 2J7LA 1ZLVK 5HI4C 3TYGL 5JLZA 3SE8H 1KEGH 5CLTA 3ZYJA 4AM0B 5IW1A 4E5XG 4A2HA 1GJWA 3TV8A 2AGJH 2G3NA 4XB7A 3MRIB 1M9SA 2K4AA 4Z78B 4YZWA 4MNGB 4W4OC 4X4MA 2A38A 1UT9A 4XE0A 4F7PB 5BOZG 4XP9L 3D08A 4M6NL 3ALPA 2X6MA 1K9TA 3O3UN 2NYYD 1T03L 1KN2H 2WUBL 3I6GB 5HHPA 3LXBA 1F58L 4PS8A 4U1JA 4IBWA 3HNVL 4FG4A 5EOTB 4H1LB 5A40E 5F88A 4LXFA 3B9KB 2OR8A 4ZPVB 5EO9A 2VLJA 4DP8X 5AFAA 3GKZA 4PTTA 5FW7A 1NIFA 1EX0A 2VDRL 4K5OA 1TCRB 2UVEA 2HZHA 3ZTJH 4U0RC 2V2TB 2COVD 4PTUB 5K1NA 3MRCB 4IJTA 1GOGA 1MFVA 2WKOA 1VA9A 4WNQA 5GSVB 1NCAL 4MLIA 4N0FB 5K9QG 1QBML 1CPUA 1FL3A 1KB9K 4GO9A 1BFOB 5MP6H 3TIDA 4DP6X 4PJ8C 3DTDA 3I75B 3SE4A 2C9XA 1MXDA 4HQQH 4UTBA 4HIQA 2JH2A 3U9WA 2FLRT 2BP5M 3EFFB 4QCIB 1VHPA 4GO6B 3PWUB 4JREB 4QO1A 4BZ2H 2HG0A 1N12A 5F9OL 1KXQE 4KDTC 2HH0H 3MSPA 3QCTL 5FCSH 1G7IB 4DKFL 3QHZL 5L6YL 4TMPA 4P23C 5JPMA 4IEFA 4P57A 2P3YA 3QUZD 3MRPB 4C56B 4ZX6A 1KGCD 3SE9L 2AAAA 4RDBA 4U1NA 4KKPA 1KTDA 2XG5B 3IDMB 3PDOA 4WVRA 3HB3B 3QDAA 4OGXL 3IFLL 4P5TC 2ADGA 1IM9B 1XL6A 3II3A 3RLSA 3RYMA 3THMH 1MQKL 4FFZA 3SD2A 2RACA 4EXKA 1CYWA 3G5XB 4TQ8A 1DP0A 2X6AA 5B7MA 1IC4H 3B1UA 3UAAA 1HJBC 2NY3B 5I75C 1JXJA 1BECA 2WO3B 4I0PB 4CC4A 3U9PH 4LCWD 3M17B 1I85A 5HI3C 4HIJB 2EO7A 4F9PC 1ORSA 5I18H 5LN4A 3DV4B 1SRDA 2NUPB 5JZ7D 4HIIB 4OCRH 4UNIA 3QUMB 4GXFA 5J3HC 4KQ4H 4NBZB 3LD8B 4HKBA 4KQ3H 1BXXA 1E28B 3EH3B 4XNQA 1I9IH 1KBBA 3V9CA 3OXRA 4PAZA 4OLWL 4D0BB 4ODSH 1JZ3A 3EFOB 4WQOA 5MEOB 5E1AA 1RZFL 4GG6E 1LJMA 3KM2A 3KPSD 4KZDL 2Z7UA 3RX7A 3X17A 4NUGL 4KY1L 5F9DC 1UVQA 1F00I 2QVIA 3TEWA 4YOKA 3ZYZA 5D1XB 4WFHE 1HOEA 2LLGA 5IOPB 1GMIA 3DXAB 4NNYA 1F41A 1U41A 4HIHB 1JHLL 4LLWA 4XZ4A 1EERB 2BP0B 2X89D 3TPKA 4N87A 1IX2A 2DBLL 2H45A 2XNAA 3E2HB 4R84A 1Q72L 4AYFB 4F7CB 3DOSA 4H8PA 5FGCE 2OYPA 1AYRA 2I7OA 3C5ZA 5CMAB 5EPMA 4Q6IA 4YBLB 3VWKD 4LCIL 4DZ8A 3BH9B 3V0WL 1KCUL 3LQZA 5ACZB 2GTZB 5JOFB 1E9OB 4EIBA 1CI3M 1TTCA 3RTLA 1TJIH 1BQSA 1ZK9A 2XWXA 3GM8A 4AH2A 3KYMA 3TA3C 4A2EA 1U8LA 2KZ1B 3IMBA 2BRRL 3JYCA 4NKIH 4Y16C 3WTYA 4AQ1A 1Q9KA 2EDKA 3B4NA 3JXAA 3D18A 2EICA 3O6LH 1JZ5A 1NEZA 5E5LA 1RKRA 4R2GB 1O0VA 2UXFA 4HHWA 5JW3H 3WMPA 4DIXA 4U1GC 4KH2A 1FN4A 4YK4B 1LWRA 5LGJB 5D7EA 2N7SA 1WV7T 5B21A 4YLQT 4PW9A 1IL1A 3MRBA 1S9KC 3MRMA 5JNYA 4WU5A 3UTSD 5B8CA 2YQGA 5JQHC 3DI3B 1QA9A 4L4TB 1NBCA 5EULV 3WIFB 3GXIA 5MEPA 3NOIA 3SO3B 3KWVA 4L8DB 2OJZH 4H7VA 2V7NA 4PRNA 2WVVB 2XWCA 4BK4A 1IFHL 5I6LA 15C8L 2OMWA 4FL4B 4KHTL 2YK1H 1QYGH 1ZEAL 5D1QB 2G9HB 1IQDA 3LKOA 3N40F 2X1WL 4OQTA 3BYTA 4FQJH 4JO3L 4KV5F 4DO5A 3DX9B 2Q5BA 1WITA 4PP1C 1T20B 2BJMH 2Z8SA 3MKGA 5KZCD 2EXWC 2VB5A 1DO5A 1QLEL 4DZBA 3L3IA 4XI5D 4WO4C 4IIZA 4M43L 2WXRA 1U6AH 4TM9A 2XC8A 3WN6A 3ULAB 2CXKA 1X6LA 1AOHA 3NJHA 3TCLA 5DTFB 1IEBA 3J8F7 2VM3A 3ULSA 3AG3B 2OK0L 3M1BA 3SGEI 3FUEA 1E65A 3K2UL 1A22B 1CK0H 1JK9B 3GKWL 3NJVA 4LAQL 4A37A 1NCCH 1P7QA 3VQMA 4P4KC 2GHZA 1EO8H 1ZIBA 3LKNB 4MQ7B 1XCXA 4L5FL 3MBXH 1DZ0A 4OJFH 1TLMA 2XN9A 4PG9A 3WLBA 1EDHA 1YEFH 4XCYB 2NXYD 4JFQB 3H9ZA 1ZXKA 4OD1L 4OF5A 1GC1H 2BNRA 2EIZB 3OKDA 2IXQB 2J88H 4OF6A 1GCFA 3QJFA 3PGCB 5F1NB 4BBWA 1F18A 4OZHB 2E0PA 2YXFA 1CXIA 1T7WA 2DDQL 5DZPA 4QKTA 4DN4L 4N0CC 1LDPL 2NLJA 2F53A 4K15A 4A66A 1S4IA 1WWAX 5DI8A 2JI3A 4JRXA 4JG0H 2BY3A 5DJCA 4XXDB 1ILUA 3GI9L 1B6UA 3BT2H 2ALWA 1T0OA 3IM1A 3L3HA 2AV1A 3K6OA 4P3CL 1FDLL 3LEYL 4IK7A 5HI5C 5JHLA 5IW3A 2QKIB 3G5ZA 4JCLA 5HYJB 4CGTA 4HIXL 1OF2B 3H2PA 3VFTB 2BH0A 1DUYA 4S1DC 2AQNA 5DD1L 3QZLA 1XR8B 2WJ7A 4CU8A 1BMWA 4MCZB 4PS4L 1EBPA 5TE7L 2F6AA 1WE5A 2IBZX 1R3KB 2V5SA 2NNAA 3W5NA 4OZHF 5KSAB 3FTSA 5C0BD 1BEXA 3I6LD 4IW4C 5EUKA 1SLUA 3D3VE 3FQTA 2BFVL 1H5BB 4MQXC 3MJ7A 5KSVA 3MXWH 4G8GE 5IEHB 3G04B 4RX4A 4XVUD 3HMXL 1ADQA 1V3LA 4UOZA 5DK2B 3GBNH 2ZTBA 4NIYE 3RGVB 4ZYKB 4D9QE 2PP7A 4YC2C 3JVGC 4RMBA 1CUOA 2VIRA 1R3HA 4YHPA 1XH1A 4X8JA 3UDWA 4J8RA 5GGTA 3IETB 4H1LG 3FT9A 4PJGE 1PD6A 1WFUA 1Z1WA 1NIDA 3HN8A 3B7RL 2PKDA 1BFTA 3WS6C 3JVGA 2DYRB 4G7YL 5TK4A 4F8LA 1SF5A 3OKLA 3WGVB 2Z64C 4FNSA 4AL8H 1E27B 2OQJB 2VR7A 1UCBL 5DD5H 3ZJAA 3SQRA 4TUOB 2YLHA 4P4RA 1ZT4A 2AEPH 1SEQH 5I15H 4XMKL 2GB2A 4ODXB 3W11D 4BFIB 3DX1A 1SM3H 2FBOJ 2BINA 3ETBJ 2OXHA 5C2BH 3KPQB 5I66B 4N1EA 4ZMZA 4LCUA 4YHNA 4UAOB 4M6AA 1EXUA 4GRLC 5BV7C 3A47A 4PRPA 4A6YA 3EG9A 4NJ9H 5C0NC 3OR6A 2FSEB 3RIFF 2Q76A 3D33A 1QWUA 4DK5A 1ZV2A 2XTJD 2OV0A 3KS0J 2OMVB 4HOMA 5EEUA 3QAZC 3CDZA 3MR9B 1YVLA 2GI7A 4UT6H 4YGAB 5EHFA 1TZ8A 4IU3A 4XCFH 4AK2A 1VF5C 4JCMA 2MPAH 1OKEA 4GI8A 2FT7A 3MHZA 1P9MA 2B1AH 3FUFA 1HXYA 1GSMA 3SGKA 4AT6A 2DBJA 3BVNB 4JLRB 4L9LC 5D9SB 5B22A 4AGLA 2BP3A 3IDJB 2X0UA 2EC8A 4G11A 2YD7A 3L5HA 4ELDA 2F8OA 1BVNT 4P99A 4JRWA 5FFLA 2CG9X 3BD3A 3GBML 3QXDA 4X9HA 2XVKA 4KDVA 3WV0A 2OP4L 2C1OB 3B2VH 4UUJB 5F3BA 3VXMB 5EZIL 1E0OB 4HK0B 4Q4EA 5KVDH 3SBWA 3OSKA 4WI3A 3VFSB 5D70L 1FJ1A 1RZ8A 4WUKH 1MFEL 1TEGA 3O0LA 1P1ZB 3ZE0B 4Q9QH 4MYPA 1IIIA 4HFWB 1HH9B 3MRQB 3VMNA 4AIZB 2IWKA 4S0TD 2FT8A 5CINL 5HBBA 3TS8A 1B0IA 2OMUB 1XX9C 5FDWA 2HLFC 4H26A 1U3HA 1ACYH 1KFAH 1SOKA 2V8MA 4NM4H 5F9JB 3FQRB 3CVIL 1TVDA 3V8OA 4PJAA 3VXPA 3BRGC 3BP6A 2JJUA 1NLDL 5F89A 5I30L 3WFEL 3WKPA 3QRLA 4FZ8L 1SJEB 3CZEA 1JYWA 3QUYB 1T1YB 3V9EA 2OPCA 3KLHC 4FKHA 3WE6A 3ZE0F 1L9QA 1S7SB 4ZI8A 1AGEB 3QPKA 4N1CA 4D0CA 5JDSA 1HU8A 1F4HA 4JFZL 1P4IL 4H0LC 4P46A 4CSPA 5JR1H 3VFUA 3EXLA 1T80A 4B50A 4U49A 4ZX4A 1P7KB 2HSIA 3UJJH 4QRRD 2J4WL 1OARL 5IB4B 1EZSA 4DCQA 5D1ZA 3HE7D 2LU4A 3TO4A 3KPRA 5H35B 1K72A 1RP8A 1Z9OA 4BKTC 1MUJB 5I5MA 2P5EB 2AK4A 1WF5A 4X98B 4YHKH 5TH2A 1EFXA 2XY1A 2CZNA 2GT9A 2NYKA 4M4PA 4ODWA 2JCWA 1D9KB 3BKYH 4N6RA 4NUJB 3VFGL 5DJ6A 3AREB 4XWGH 2NY2D 1NM4A 4URTB 3HVDA 1IILE 3NEOA 4AV5A 2VAJA 4H5SB 3LZPA 2F15A 3GMRB 4WNJA 1CDUA 1ACZA 3AWEA 3U25A 4KKAC 1ZA6B 4BFFA 4F7TB 1QHPA 2XSKA 4PFEA 4EI6B 4NHUA 3UBGA 2CDEB 3BZ4A 3SQBB 1WUZA 1QFWH 4BCZA 1LVEA 32C2A 4AYID 4AYGA 3M8OL 4MJIA 5HHNA 4D7BA 1IVLA 1IFRA 4JAMA 1YMMA 4BA0A 3A6CH 1MH5B 1SHWA 1TSHA 1DSWA 1RZ7H 3FCBA 3P9LA 1AHKA 4XTRD 4YZFE 2E9JA 2JNZA 3FSAA 2OCCB 3ARZA 3OG6B 3NJJA 3QH3A 3VGEA 3ISRA 3LZFH 4MCNA 1U30A 5DZVA 3BN9D 4XNBA 2V2XA 5HHOD 4TLKA 1J1OL 5JUEL 4RQQB 2QADC 4HJEA 2BOCA 2JB6A 3F7LA 1A1NA 1G6RA 3IT8D 5E2TL 5B4MD 1MHEA 5B38A 2G5UA 3ARDB 4NRZA 4OCYL 1R5VA 1SDYA 3STLA 3PG2A 3FT2B 1EEZA 1H8OA 3PL6B 4JFXA 1NCWH 1BLIA 2VITB 4XP1L 5D8JH 4BRVA 3EGXB 3LHPH 2ILLA 2OBGA 3PWPE 4MHHG 4NFDA 1NFDA 3EH2A 1W16A 4LNVA 5IVZB 1PZBA 2XWJB 1HQ4B 4FERA 2BVPB 5C71A 4FQQB 5JPNC 1LEIA 2HFEB 2C4XA 2YARA 2FL5B 2F1BA 4AMWA 4CVXB 4K5MA 3WNNA 2XWZA 1DE4B 3KE0A 3NSYA 2EEFA 3OQ3B 4HXBH 3SKOB 5HPMB 1MG3C 3E7JA 3TFKD 1BYOA 4N2CA 3TVMC 4FTVA 3OHMB 2V2WB 5C08A 1KT2B 1MEXH 3C8KB 5I1JL 1RZJH 5DT1H 1TVBA 4HS3A 3FU6A 4NQEE 3TBTA 1M7DB 2NXZB 4GAYA 3M86A 1KYOJ 2YPLD 4K3DH 3U7AA 4ENED 4TSCH 1J9SA 3CVHB 1W8NA 3TOPA 3C60C 1U3YA 2CJ3A 5MEQA 5I8KH 2DQHL 4OCLC 2Z0UA 5IJCC 3W5MA 3B2DC 4ZOEA 1FL6A 5L0QB 2H32B 3OAZH 2YGVA 4AQOA 3FTVA 4IKJA 4IRSB 2WWKO 1LDSA 1E9PA 4HCFA 1FBIL 5E6IB 5JW4Q 4H40A 4JJ5B 4FA6A 1JZ6A 2XFXA 2VXSH 2XWTB 3T71A 3HC4H 1XCWA 4WO0A 2BLFA 3IMWA 4XAKE 3UBXB 5JHMA 1JZGA 1ZA3B 4U6YB 4WJ5B 4PWEA 4WW2B 4UMGA 1HH6A 3K2IA 5FGSA 4M61A 5HHXL 4WGVB 4LEOB 5FB8B 4S1QH 4E68A 1I3VA 2XKSA 4FKKA 4RFEA 4LZKA 1O6SB 4RGNE 1U8PB 4F57H 1IEAB 5JQ6L 4X9FA 3V6FB 3CFDA 3FMGH 3CLFL 3BPLC 4P2OA 4URKA 2NDGA 4EUPH 3VNYA 2O1AA 1TITA 4XHQA 2DMHA 4GSRA 3S2CA 3RNKA 2N7AA 4E5XA 1BLNA 2GTWA 5AL0A 1QFUL 3L9BA 3DO4A 3LNGA 1U21A 2NSMA 2H3XC 4BRJA 4WW2F 4XPHL 2VLRD 3BMVA 1HN1A 1VADB 2IPKA 4JRYB 5IY5B 2ZWSA 4X80H 1X5JA 1HKLL 1L6PA 1W80A 2J44A 2X53A 3CDCA 1ZS8B 2FR4B 4G80A 3HNSH 4YPGA 2O5XL 3BW9A 2VJ0A 3LQAC 3EO0A 3FTYA 3AXLA 2C3VB 3AXIA 4XBEL 5IM7B 3ZPDA 2X70A 1PSKL 5GZOC 1I4FB 2DQTL 2F54D 2ZXGA 3D4GA 4HCRL 1FO0H 2Q7YB 3U6XS 4PJEE 1NCTA 3SDAD 5ILTH 3TO2A 5IJVB 1BYPA 5K1VA 1C1EH 4NQVA 3S34L 3BFOA 4UI2A 1VZIA 5IBUG 3OSVA 4N2DA 4ZQTA 1GJIA 5JMRA 2UZYA 3CDFA 1HSBA 2IH3B 5TDPA 4GP4B 3HE6B 1A3ZA 3SJVD 5MENE 2V3DA 3DPBB 1F42A 5FKPB 3CSGA 3PHAA 4NENA 4IGBD 3GXTA 4P5RA 5DFTA 3TCTA 1HOCA 2GUOB 3AAZB 5IK3A 3SZKC 2K9UA 2XQBL 1E5YA 1CICA 3DURB 3L3GA 4K2UH 5BZWB 2J55A 2ED6A 4NUPA 4Z8FH 5C0AB 2AV7A 3MCKB 3ZR5A 1XGQA 3N9GH 4EI0A 3GIZH 5M94B 1FA4A 1ZLSL 4B41A 1DQKA 1F2QA 5A7EA 1JZ2A 4LLAA 1OZTG 1YEGL 1XGRA 3C6EA 4JUTA 1FG2B 4NT6A 4XB8A 3QQ9C 4YE0A 2X87A 3U9UA 3VXUB 4DO6A 1MHHB 2BVOA 1L7IH 4GKNA 4O2FA 1XSKA 5DWUH 1UATA 5J6GA 2V5YA 5GS1A 1CR9L 2A3TA 3PWVB 4HW6A 4YHIA 1A8ZA 3ZDYB 4KKZA 1Z32X 1SY6A 4TPRL 3DGDA 4FQHA 1ZT1A 1U8NA 2WXHA 4QY8B 2Z31C 2W91A 5KVFE 3T0BA 3P73A 5BVPL 3IKKA 3K8MA 4HJ1A 4PW3A 3D3VD 2XPZA 2A6KB 2VDLL 3G6JB 5D96C 4F8PA 1NGQL 3ILEA 3FU8A 5EOQL 1BZ8A 2W07A 5JIMA 1Q1PA 1HIML 4G8GD 4FCHA 1YUHB 4PBWD 3ARFB 2I26N 3WIIH 2H9GA 1Q9LA 3PP4L 1VB9A 3ALXA 3ROOB 3IJYA 5ABZA 2X2HA 4PRHD 2N7BA 2GEEA 4JHWH 4N9GA 5TD4A 1A6WH 4QRUB 2VKWA 3U30B 1WEJL 4KDWA 3ZDYF 4JKMA 1OAYL 2Y5EA 4NC0B 1IKFL 1A9EA 3BWAA 3V52H 2ROXA 1M7IA 2R59A 5IFHL 3H3KA 3M7OA 2R2CA 4GSQA 3BPCB 3G6JF 2Q3AA 1N6QL 2HT4C 1TEYA 3PWNB 1EHXA 1JDDA 4YDJA 3RUGB 5DLML 5TPWL 2B4CL 4Y88A 1KPUB 2FO4B 1NAMA 4YS4A 1LP9E 2FHFA 3LMJL 3CU7A 3KYOA 5CHNA 4Z7WE 3QORB 2OZ4L 1B4JH 4M8QA 1PLGH 2G5BB 3LZOA 3ESMA 2D4DA 3CVDA 1GR7A 1JJUA 4PY7A 4M3KB 4NUMA 1Z9SB 2I07B 1CF8L 3RY6C 3WIHH 1NFIB 1G7PA 2VAAA 2NW3A 2YD0A 3NZSA 4KX7A 4HH8A 4CL7A 2PP9A 2JKWA 4UB0H 1XDTT 4BGLA 3G7TA 4ELME 3DVNA 3T0AA 2RALA 3QZBA 4C4KO 5C09B 5DZLA 2Q6WA 3HRZA 4EOWL 1RZQA 3DVIA 3RUGF 1UKQA 3VW3H 4ZD3H 1KJ2L 1A3LL 3DHJA 1TQTA 1Y6MR 3IDXL 1WBYB 2VMJA 1QSEE 3VWJD 1HILA 1R1CA 1K8IB 3ARBA 4OCWH 3IJHB 1OPGH 3QSKB 5DHVH 4BELD 3TJHD 4RWYH 1PEWA 2GK0B 4YDVA 5ALBL 3NAAH 1G7LA 3TNNA 4U1SA 3RWDB 1L7TH 2FSDA 1JUFA 4WU7A 4RLDA 5E5RB 1BGXH 2A1WL 4WWOA 3T3PE 1CJYA 4OZFA 1AS6A 4Z5RA 4X4ME 2W88A 4QRBA 4WW1A 3VRIB 3EO9L 4JDVB 3EYSH 4GRWE 3UGXA 3MLSL 4MMZB 2AF2A 1DQQA 4HMDA 3C9NB 1P6AB 3CFKA 3H8NA 3MLVL 4RMRA 4XVTL 3EDKA 4MB4A 3IDNA 3V0VA 4U6HA 1P5VA 3L6FB 2I9LB 2WIIB 5TGBB 1B0GA 4K9EL 4DGYL 1OGAD 4MFHA 4QF1A 4Y2OA 5IR1A 2VLJE 1N19A 3SBQA 4HWNA 4ZDHA 2W0LA 4OJEH 2HJFB 3BAEH 1LEGA 3TN0C 4F7MA 4Y4FB 4GAGL 1WA0X 2F74B 2WP3T 3MFFB 4NRYB 1EXGA 2V7HA 4PJCA 1IAIM 4PLJD 4NZUL 3MMEA 2VWEC 2JVUA 2KKQA 4FNQA 2R15A 2MQ3A 3S88H 2X7LA 5B1JA 3T4YA 3DIDA 2GEQA 4JQXA 1C16B 2DICA 3BAXA 5KTEH 2QHLA 2ADFH 1UM5L 5FKAA 3U0WH 3ESOA 5T5FH 3GMQB 3T6WA 4AGQA 1JXFA 5JHDD 3QJVB 4KI5E 3C5JB 4L4VD 1ASOA 5AVWB 2AXFA 4JZNA 4PJDB 4QXUH 1WCQA 1BX2B 5FHBL 3QHFH 1B2WH 4KJQD 3CQFA 5SX4I 1XF3A 2CCVA 4P9HH 4ONGL 5CSZA 3VG0L 2HKHH 3UBXG 2ICWI 3QUXB 3SKMA 1GKOA 4UIKL 1JWSB 1YEDB 1YN6B 1LO5B 4KO6A 4R83A 5D4QA 3LXCA 2AXJA 3T65B 3Q6GH 4L8SA 3OKYA 1JZ8A 2A6DB 4XMLL 5HJGA 4I77H 4X42A 4WKZA 2EDJA 4MXQC 1ZDSA 1CBVH 3FT4A 2QSTA 3L17A 2Y07H 4JHBA 3HG5A 5CCGE 1FNEA 4L8CA 4WRLA 1FFTB 4GFXA 4L8BB 3UCQA 4GKZB 4AE1A 1KJVB 4PJDF 1JCKA 1PMYA 4P2RB 4GW1B 1QATA 2EADA 3LDBB 2Z4TA 5LCVL 3U2SB 2JIXB 3OLIA 4DK3A 4AM0A 1BQHB 3ARGC 1M2VB 4F37K 4UTAL 2ZX8A 3HI1B 3I50L 4HGWB 4HLJA 4CRPA 2CUIA 1NCDL 4Z78A 2FT6A 4MNGA 3BGFC 1QX1A 4B9CA 4F7PA 3CVBA 1VGKB 5KW9H 4M7KH 1E9QB 4JFDD 2OMNA 4NKDB 5AWNH 3D2UD 3IWVA 3VG9B 5DVKA 5JHBA 2JK5B 1DHKA 3QQ3B 3I6GA 3FCSB 3NTCL 4TVPE 1E2VA 4JN1L 3MNWB 4XNXH 5EOTA 3MACH 4H1LA 5AOLA 3SPHA 4S1SL 5BJTB 5AZEL 2DQUL 3B9KA 4ZPVA 4M56A 1RFDH 1GOFA 2NR6A 1BZ9B 1X4ZA 1A5FH 4J23A 1JMZA 2V2TA 4PTUA 3MRCA 2FWUA 2BW5A 3SOTA 2MFNA 2DIBA 5GSVA 4GXVL 4X7TB 4N0FA 3DGGB 1AGDA 2YXMA 2E56A 4Q9BA 1J05A 1BFOA 3QPQD 3LNHA 2IDTA 3I75A 2KLRA 2CHNA 4MA7H 2APXA 4ZUTB 5FFGA 2LT9A 3EFFA 4QCIA 3TURA 1TFPA 7PAZA 5HYQB 1XF5B 1H6TA 5EN3A 5F7LB 5K69A 3ZHNA 2A0LD 1A7NH 1PKOA 1G7IA 4NN7C 4Z3EA 1Q94B 4AGNA 2XXCB 1NLBH 2IAMD 2R0WH 2ITDB 3MRPA 4G8EB 4C56A 3U4BL 1CQKA 1OW0A 4I8DA 2FJHB 5ANMB 4LT7A 3ULVC 2QFPA 3IDMA 2X12A 2VDMH 2WBWB 1IM9A 3F58L 2R56L 3ETTA 3O81A 4UZGA 2F8VA 3B1TA 4IOSA 3T77B 3G5XA 5TDNB 4BA8A 1X7TA 1JHKH 5EIIB 5HVGB 4YHZL 1QMUA 4XO5A 5EDXA 1DN2A 1NOLA 2ZKYA 1II4E 4AQZA 3O2VH 4HPOL 5IBTH 4UANA 1A02N 3QUHA 4DGVL 1MPAH 2QTEA 4J4PA 2ZKMX 4P2YA 4I0PA 2R4RH 2APWA 3MRGB 4L1BA 1H8SA 3M17A 4LPCA 2XDHA 4HIJA 4XGZB 4XPBH 3SOBH 4QRFA 2IMNA 4XBMA 2BNQD 3PHOB 3ZIMA 3DV4A 3BXNB 2B0SL 4HBQA 4HIIA 3QUMA 2VXTL 5SV4A 2QHRH 3HEIB 4GEJA 4PEEA 3ZYIA 3N1FC 5GGUB 1E28A 4G6KH 1X9UA 8CGTA 1MF2H 2GIXA 3V2AR 2Y25A 4KK9C 4PV9A 3RA7H 1W72B 2JKTM 4D0BA 5ERWB 3EFOA 5MEOA 2Q10A 3O9WD 2R0KH 3O8XC 3CD4A 2VM9A 1IGIL 1W91A 5C0FB 1WS7A 3DARA 2X1PA 2PLTA 1J48A 1FAIL 3KPSB 4OTXH 2A5UA 2HKAA 2XN9E 4R9HA 5D1XA 1BG9A 4DP4X 5I6OA 3MCYA 4CVZB 5IOPA 3O0RH 3DXAA 1KELL 2QQKH 4HIHA 4DP1X 1CU4L 2BP0A 5HVWA 4PY8I 1RPUA 4AYFA 2XX1A 2BNRE 4F7CA 1W0WB 2MCPL 1U8CB 3VQLA 2F68X 3MA9L 3L48A 5CMAA 3X1BA 4GMSH 2VN5A 3HKZA 1MJ7L 3F6JA 3T0XA 1JPTL 4BFEA 5DHVB 5ACZA 5JOFA 1GYAA 1E9OA 4GQ9L 5FGBC 2K45A 4L3AA 3VWKB 1TZIB 4PSRA 5H4YA 3L1FA 4JRXE 3L1OL 4FI7A 1OAUL 4PJ9D 5JYMA 1BD2E 2HUHA 1O7DE 4DQOL 2WKLA 2DQEH 3PF2A 3MI6A 3PDGA 2WAQA 4K8RH 1YEEH 3NFPB 4IKNA 2X9XA 2H6PB 5IREA 3P3TA 4LAJH 5LGJA 3MBEC 2HMIC 1A7RL 3U2IA 4F8TA 3F2LA 1W6LA 1EPFA 1I31A 5HDRA 4Y5XC 3Q48A 4Z6AT 2ZPKL 5JQIB 4M5SA 2Y36H 3WIFA 2FBRA 3UTSB 5HD8C 1WISA 1VFAB 2ZKHL 4L8DA 5E2WH 5BZDB 1NCUA 2P47B 1H3GA 2WVVA 2ENJA 3A67L 3ML9A 2JKJA 4X5WB 1FFOB 3BFWA 4XHJD 4JMNA 5D1QA 1T5XA 2G9HA 1ZVHA 2JB5H 3GSUB 4XX5A 3DX9A 4XRCB 1SDAB 3L2LA 2LFEA 3ESUF 4AYDC 1T20A 1QSFD 3FH7A 4YLBA 1LK2B 3G5WA 4KNSA 3T6QC 4R0LB 4TNVK 2OM5A 1DVQA 4Y2DC 2P43B 4I3SH 2X3CA 2WZPA 3ATDA 5KZCB 4M9PA 5FC9A 1KZQA 2G75B 2NY5C 4HSQA 1NPUA 2VW4A 2PTVA 3MRDB 4GQQA 5DTFA 4RSVA 4NSKB 1I8LA 3IGKA 3ECVA 3EYFB 3L3OB 4IIQB 1KXVA 5DEGB 5E08L 1RHHB 3H42H 4NBYB 4MA8L 1CDBA 4U3SB 1V3KA 1RZKC 3G5VB 4Q9RL 4FYQA 1KJMB 5FK9B 3LKNA 4MQ7A 3VSUA 3CZUB 1FRGH 2EDHA 4XCYA 4PRPE 4JFQA 1WIUA 3NSDA 1U42A 4Y5YA 1K5NB 3GZOA 4K3EL 4FNLL 1PX8A 5DJDB 1KIPB 2NXYB 5JXED 5EEXA 2EIZA 2IXQA 4G7SB 3WN5C 4CMHC 3PGCA 5F1NA 5FYLE 3SODB 2EDMA 3STZB 4OZHA 3TT1L 4A7VA 4OV5A 4N28A 1URLA 4NLAA 4PLKC 4B95C 2EP6A 5KS9E 5G55A 4QOKD 3WJJA 5IFAH 4CKVX 2A9NH 3MXVH 5KVFL 4XXDA 3H85A 5KUKA 2EIDA 2IPTH 5LDUA 5I1EH 2Q20A 2PPEA 3GS7A 1HHJB 3K4DA 1AE6H 2QKIA 4QHUA 3C2AL 3H9SD 5HYJA 3LOWA 2VH5L 2J5WA 1OF2A 2JF1A 3VGFA 4UF7C 4HG4J 3OC5A 2OS7A 1DANU 4FYSA 3BUYB 1RZGA 1XR8A 1V7NL 4MQSB 1MCPH 4MCZA 1YYLH 4RFOH 3KPMB 1BPLB 2KHAA 3RI5F 1R3KA 5IHWA 1PLBA 3GC3A 4FQXD 4Y9FA 5KSAA 1QZNA 2JQMA 4XPGH 2E7LA 3D2TA 3NBNA 3BKCH 1BQHG 3LRHA 4F37F 2YUWA 3TBWB 4TSAH 1MWAB 4M1DL 4IS6B 5INCB 1H5BA 2ZX6A 5C0BB 5DC9B 4ZMTA 5IEKB 5LJYH 4TS6A 4Y5VB 3BSZH 4HJIA 2EJ1A 3G04A 4LSUL 5SX5K 1XR9B 2HLEB 2DB8A 5DK2A 1GZQB 4YL9A 3RGVA 4ZYKA 1OP5H 5ESAB 3U6RB 1FYHB 1D6VL 2WO2B 3AS3A 4RESB 3MLXH 4PJAE 3ZL4L 5GS2D 5AENA 3IETA 2ZOKB 2OTUB 2IVFC 5FYJH 1DEEB 4BZ2A 5HI4D 4LHUD 4A7TA 3AS2A 2NY1C 1J0JA 1SUJA 5HVHC 2F9BT 4XPAH 2R29H 2EC9U 2R1YB 1E27A 3RWFB 2OQJA 2VMEA 4DPBX 1N2RB 4FFYL 2G9KA 3JWNC 4HWEL 3P1VA 4TUOA 5DD3L 2J6EL 4AEIL 1LO0L 2QPDB 4KZEH 2F58H 1SYSB 3CFBB 4ODXA 4BFIA 4N20A 4J6RL 1ET7A 1DBMH 5DVMA 3KPQA 5I66A 1RL1A 4DOHE 3B3IB 4RMSA 3KPRE 4EZKA 2FD6H 1J88A 2AK4E 2HN7B 1BZQK 5T3XE 4Z7UB 1BQLH 2FSEA 2OX5B 2IH9A 1CFBA 2DQGL 2ICEB 1SXBA 2OMVA 3FQWB 1PJWA 3MR9A 3T1FB 2RFXA 3NUKA 5I1LB 2XTJB 2DQ6A 5K9KB 3N3EA 5F72S 1KCVH 1DBAL 3UERA 4DSYA 3NIFB 1FE8L 3RY5A 1AQ8A 1E6OH 1MIEH 2VUKA 1AJ7H 3O6FC 2OXGB 5EIIG 3BVNA 3IFNH 4JLRA 5D9SA 4HPYL 1QAWA 3IDJA 1Z2KA 3E3QC 4EN3C 4G43B 5ICZB 4MJIE 3K4ZA 4PP2B 5HDOA 3TL5A 2QFRA 4KO7A 4JM2B 3QIBB 3MJ8A 3UH8A 4IMKC 4UNUA 4WK2B 5D93C 5BRPA 5C97A 4YDMA 3W39B 2CJSA 2DWXA 4G7VH 2C1OA 2OCFD 2X4NB 3L5JA 3VXMA 5F7UA 4HK0A 1PG7H 3CG8A 5K33A 3RTQC 2NY7H 3NIFF 3VFSA 3APMA 3Q1SL 3T8VA 1P1ZA 3QJHB 1XGZA 1UM6H 1OD7A 4JKKA 3MRQA 5EU4B 4AIZA 1G7JB 3K0WA 2JWYA 4UTBL 3N43B 3S6CA 3IE9A 2OMUA 2YD6A 1XB6A 1CLZL 3RURA 3ISWA 2WIMA 4JM2F 1JNNH 5F9JA 3FQRA 5HI3D 3HS0C 1GTNA 1FLRL 2O6FA 5HHVH 4JVWA 2BMKB 4DGUA 1RD6A 1KACB 2WWNA 1GIGH 2I24N 3GZKA 3IBEA 4JKWA 5F6HJ 5SWZD 2YWYA 5J3HD 1NFDE 4D3CL 4F7EB 4XO9A 4OVUA 3HPLB 4M48H 4X7FC 1SJEA 3HS0A 4GY4A 3QUYA 3NCCB 1T1YA 1QSVA 4POZC 4U6VH 1S7SA 5A7BA 1AGEA 4FFZL 1S9VB 3CHSA 1C8PA 5LBSA 3EFDH 4FQLL 3RAJH 4ALAL 2M26A 3N43F 3RZCB 4B9JA 4WTZG 4FTVE 4GQRA 1JGVL 2ZONA 5DDHB 1P7KA 2R23B 3O6ML 5EZOH 1MFCH 5IB4A 5LAXB 3BP5B 4M7JH 3B8YA 5H35A 1UQSB 1C7TA 1JPGB 4QRRB 1MUJA 5AQ0A 2BIQA 2P5EA 2MSPA 1MCEA 3F7VA 4LQ1A 1D9KA 4NUJA 3AREA 4EJ1C 4G8AC 1KBPA 1KLGB 2EE6A 5D1ZI 2BFGA 2IAND 3HLKA 3EGSB 4H5SA 5DJXB 3GMRA 2NY2B 4HETA 3BDYH 3TA3D 3TV3H 6CGTA 5JIQA 1ZA6A 4F7TA 4JNXA 3FCTB 2XX0A 3IRPX 4Y16D 1XMEB 1BJ1H 3NDZE 4TYUA 2CDEA 3WFCH 2CBTA 2B15A 1PIFA 4YXKH 3SQBA 2P5PA 4TVPL 3G08B 2V6HA 4W9EC 3OKKB 4IOIB 1NPJA 1MH5A 4TNVF 2YHGA 3RFRA 3ATFA 3AB0B 5AW0B 2BVYA 3KWUA 1WWWX 1CDCA 3O2WH 4G6FD 2FJSA 4PGCB 3ZDXE 1M71B 1OGTB 5DHYB 1QO3B 1GAFL 2BOLA 3ULUE 3EDJA 4BEIA 1AO7D 3IDGB 3S3PA 2AJXH 4RQQA 2OULB 5TE6L 3Q6FB 2EE0A 4TULH 5HHOB 3KJ4B 4KKBD 2CDGB 2E8ZA 3LCYA 3IDIB 5GISH 2W0KA 4OQ1A 4R7LA 5SWSD 2R2EB 3INOA 2A77L 3KLLA 3D25B 3V4LA 3ARDA 3DYOA 4RFNB 3QWRD 4KNTA 2EXWD 3FT2A 3PL6A 4WO4D 2VITA 5AOZA 1H19A 3EGXA 5ITBL 5AB0A 2Y5TB 2BVQB 4LASL 1AY1L 1T2QH 1JGUH 3L5IA 2EDBA 4HWZB 5IVZA 1JZFA 2BVPA 1HL8A 4FQQA 3C6SB 2HFEA 2K1MA 2LTQB 2FL5A 4CA4A 4Q7DA 4CVXA 1CFTB 7FABH 4XCCH 1TVHB 4OKDA 1F1GA 4D9RD 1DE4A 1EAQA 3BZ5A 1CLVA 1F6AB 1ZTXL 1OCCB 4LLMA 4F33B 5HPMA 4PUBL 4OQTL 2VDNB 3CXDL 1J12A 3GQFA 4P4KD 2YD8A 2V2WA 4Z77B 1F6LL 3C8KA 3P30L 3BT0A 1M7DA 2J1WA 4E9XA 4GYBA 3EYVB 5M95B 3CVHA 4B9KC 4FYRA 2YPLB 2F53D 4MD4B 1G9NC 4XXWC 2N59A 2P5WD 4FNTA 3U7WL 2NY6C 1NANI 4YBHA 2H32A 4QXGL 4AL8C 5IBLC 2EH7H 1YNTB 3FHEA 1JZDC 3WBDA 5IWLC 1IE4A 4IRSA 4HJJL 2CE6A 4PYGA 1TZGH 2BVTA 3QP3A 4N0CD 3S37X 5E6IA 3CIQA 4ZMWA 4JJ5A 2CKNA 2WWMC 2XWBA 2XWTA 5IVNA 3LS4L 5C0EB 1A4BA 3VM5A 2Y23A 4WI6A 2BW4A 1EJ6A 3UBXA 1X4YA 2XZAH 3DX7B 5HI5D 5JDJA 1T1ZB 1A7OH 1ZA3A 4U6YA 2MJWA 2O26U 3NJFA 2CCWA 4GFTB 4WJ5A 2QMJA 2DQDL 4U1LB 4UAHA 2Y7LA 2EDXA 4WW2A 2WBXA 3AUVA 3LPFA 4AG4L 5CD5C 2JQAA 1FAKT 4K07A 3N44B 3WLWD 1VERA 3EO1B 4LEOA 3VXQB 4EMZA 1N18A 5FB8A 3CZJA 1T1WB 1UWYA 2C5DC 3HR5B 2V9TA 1CFVL 1O6SA 1L3WA 1U8PA 1YNTF 4RX4D 1IEAA 4N22A 4Y19A 1HINH 2EABA 3NH7H 1TQWA 3V6FA 3AGVA 4Z3GA 3MODH 4UQBA 4UT6A 5EOCH 4FLRA 3UJIH 4MQXD 4AI7A 1FH2A 5J89A 3U36B 5GRJH 1JMXA 3QR2A 4F9LC 5I1IL 1URZA 5JHLL 1ZT7B 2XKNB 4MXWH 5GHWL 4EBQH 1ZGLA 3GTTA 4OCSL 4OLVL 3VMPA 4JHZA 1WLHA 1DANT 4JRYA 4NGHH 2APVA 2WANA 1N5YH 4H2AA 3N44F 1ZS8A 3US0A 2FR4A 3AT0A 3WTSA 1JCVA 4CDGC 1TTAA 1RCYA 3JQOB 2XV0A 4YDLC 1YY9C 2C3VA 5IM7A 3NCXA 4M93B 4WHYG 5HYFA 4L29B 4U2YA 4CUCA 1I4FA 3ME0B 1CWVA 2F19H 2CBMA 2Q7YA 4ODTH 5FLUA 2Z8VC 3I85A 3M1OA 3RL2B 5IJVA 2F54B 5E99L 3HZMB 4XP5L 1IBZA 3UG5A 2CLZB 1ADQL 1NSNH 3SDAB 1SOQA 1I3GL 2IH3A 4PRPD 4R4NC 3HE6A 3VE0B 1S9XB 5FWQA 2XN1A 1QSZA 3DPBA 2B1HL 5E4IA 5FKPA 5E56A 1SXSA 5B1KA 2FBJH 2B3IA 2GUOA 3AAZA 3NPSC 5GGTL 4GRLD 2Y6SC 3SPGA 3DURA 5MI0C 4IGBB 5BVJB 1NMAL 4OGQC 5BZWA 3QDMD 3SGJC 2GJ6D 1OLLA 1QFHA 5C0AA 25C8H 3UP6A 3R4DA 3MCKA 3MOQA 3PLYA 4QRPD 2EC9T 1UOVA 3AWGA 5K9QI 1DDHB 2L4OA 4GW4B 4QWWC 3VXUA 1FG2A 2DEXX 3SGJA 2FX9H 4CC1A 1Q9WB 2FZ3B 3MRFB 4GAJL 1S7UB 1MHHA 2CAKA 2HA1A 3NCJH 4LOUD 2KH2B 3D8MA 2VJXA 3RWJB 3S96B 3S3DB 1AANA 5ITFB 2QKSA 4HK3N 2EO1A 1UC6A 2D3VA 4Y1AD 2N3JA 3DSNB 1BF2A 4ORZC 3PWVA 1D5RA 4PWKA 5LG1A 3EOTL 5HTSA 4N8CH 1UA3A 4A6YL 4QY8A 1FGNH 3K2KA 3MRNA 4R7VA 1M7XA 3QG7H 3H6JA 3MLWH 4DESA 2A6KA 1LD9B 1WYJA 3D7PA 3J2PA 5FYLL 1EJOH 1EANA 1YUHA 1Y1DA 1MRDL 2WZAA 3ARFA 1E5ZA 4H8UA 4FLOA 4IYKA 1T2XA 1J5DA 2YXVA 4UV7H 1WGVA 4W9HC 3DV6B 1UJTA 1U0QA 3ROOA 2ZUTA 2CRYA 1BXVA 1KV3A 4FC3E 2P26A 3QRGH 4KK6C 4NQXB 2VR6A 3E1F1 2EDWA 4AMKL 3EXJA 3ZRCC 2VDQH 4QDGA 1AI1H 4PRHB 2HLFD 4B9FA 4BFRA 1NMCB 4PI0A 4YHYC 5CBAB 1ZD6A 5JW5B 3BVTA 4IDJH 3BE1H 4QXWA 2XYCA 2CMRL 1UWEH 3PAUA 3BPCA 5JA9A 2C7FA 3QG6B 5CP3H 2VC2L 3SPIA 3S5YA 1VLXA 3DX3A 3MCLH 1SBSL 3PWNA 3KGSA 4G3YL 3RUGA 3BCDA 2WSKA 3KLHD 2FO4A 3T0EC 1Y0LB 4CJ0A 2WTRB 4JKPL 4KRMB 1DJHA 3QORA 4RRPG 5DUPL 3ALWA 3IJEB 4FXKB 2B1OA 3SDCC 1EAJA 1S7XB 2G5BA 5D1ZD 3B37A 3IRZA 3LQMA 2I07A 1Z9SA 2AK4D 1NFIA 5T3XD 1RHFA 4KXAA 3T0EA 4O2EB 4NIKB 2DQIL 4XMWA 4WSKA 2AQ2A 3G3LA 2VZ1A 3GMMB 2I69A 3V4UH 1GZPB 1D5XA 3RJDA 1ORQB 1PY9A 4I5BB 5C09A 2AK1L 1UUSA 4F2EA 4NWUL 1Q90A 1TMQA 4I2XB 2EKJA 1NGYB 3NG5A 1MG2C 3PQYD 3KAAA 1WBYA 1X5KA 3KXFD 4DW2L 5JHAA 1K8IA 5LGHH 3IJHA 4GAAA 1AGBB 2E7BA 1ULVA 2GK0A 5C0CD 2Z8WC 1WZLA 3VWJB 5JIIA 1N3NB 4KAQH 1YMMD 4U05A 3FYIB 2MNWA 1CLOL 3RWDA 3ARVA 1RZJC 3SZ6A 3P2DA 3P4LA 2ATAA 1IT9L 3JWOH 4LKXB 4MNGE 2P44B 2KDGA 1E7VA 1IO4C 2ZWLT 3VRIA 3QJZA 1A6PA 5T3XL 4JDVA 3SY0B 1FVCB 1YQVL 4MMZA 3BAJA 3C9NA 1DL7L 2HFGL 3CFMA 3L6FA 1AC0A 2I9LA 4KO9A 5TGBA 4YHLL 3QJXA 1OLZA 5E9AA 4BH8B 3GRBA 2Y06L 3DYPA 1CIUA 1J1PH 4TXVB 5IB1B 2H0JA 2MKWA 3WKML 4F93B 1XF2B 5F7HA 1OGAB 2OL3H 2QADD 4HK3J 4GG8B 2EE3A 2JJSC 2HJFA 5CSBA 1A65A 3MLPA 1XGTB 5ENWB 4Y4FA 4PJXB 2X38A 4ANKA 2F74A 3MFFA 4NRYA 3S35H 4WV1C 2DI8A 3D4CA 5D2LB 2BDNL 4GLRI 2PPFA 1ZVSB 3FRUB 3BCFA 4E0RB 3ZSTA 3WD5H 2DWTA 3CTTA 4RGOH 3F7KA 1C16A 3QDGD 1D6EB 3B2PA 2G30A 1IJ9A 5KVEH 1PY0A 3V0HA 3GMQA 2W0PA 3C5JA 2ZUXA 4L2LA 5CJOL 1OAQL 2XVBA 4X6FB 4PJDA 5C08D 4NJAL 4S1RH 5ETUB 4BWTA 2AI0H 3W38A 1BX2A 5JHDB 1KGWA 1G6RL 4N0RA 5F0JB 4L4VB 4PJXF 2PPCA 5DRZB 4H88H 1RIHH 4QAMB 1RUAH 3TVMD 3QUXA 3FO1B 5D2LF 1JWSA 3VI3B 5EV7A 1YEDA 1YN6A 1LO5A 2ZUQB 2YD4A 3A0OA 3T65A 2HRPH 1TNNA 3GJEB 1FG9C 1MNUH 2A6DA 4TNFA 4WI0B 5ECJE 3EHBD 3C60D 1KCSH 1CFMA 3ULUC 1A4CA 3FONB 3WDHA 3N1PC 1T04B 4M9OA 4ZMQA 2YAQA 4DKTA 2IDSA 4L8BA 4ADJA 4N68A 4GKZA 1EZVY 4QHMB 2ZXQA 3TYFB 3HI5L 4M3JA 4P2RA 4GW1A 5I1AB 4HYTB 2ATPB 3GXUB 4PWFA 2FCBA 4G83A 2JIXA 4MNHB 5E1GA 3T08A 4MB3A 1TKWB 1BQHA 4ODUB 4NN5C 3VI3F 3H56A 5D7HA 3HI1A 4HGWA 2VLMD 2ZCLH 1UZGA 2RR3A 4XP9H 1T0MB 4MDJB 1EGJH 2QZQA 2RD0A 1CDJA 1DJGA 3JV6B 3RJQB 4WZ9A 5KJRH 1T03H 2CBPA 3OPZL 5F96L 2ZNWA 1VGKA 1F58H 1CFSB 1E9QA 4P2OD 4NKDA 5D1XE 3L5XL 5F7BA 3QQ3A 4WEUD 1UOKA 3DXAE 1ZVNA 3FCSA 4PW4A 3SY6A 3WNKA 3N5AA 2N01B 4JFDB 5J56B 1I3RA 2BM3A 2PCFB 2VDRH 3D2UB 3IDYC 3MNWA 4LCCB 1AXTL 3K5RA 4Z95L 3UGEA 5BJTA 1F8TL 1GHFL 2D0FA 2EDTA 5H94B 1NCAH 1DVYA 1BZ9A 1JI1A 5F7EL 2BC4B 4I0CC 1QBMH 4NBXB 1YEJH 4PBDA 3T2QA 1YUKB 4CSTA 4X7TA 5TF1L 1CZ8H 2F7OA 2IH1B 3DGGA 5DQDH 3T5WA 3RVUD 2D9QB 1ND0B 4IHBA 3S2AA 4ZTOH 4YSDA 1PZ3A 5ADOH 3PUUA 3KLKA 4KV5E 5F9OH 4ZUTA 3REWB 4RAVB 3S4SB 3ARQA 5D7JC 4PMFA 3OZ9L 4NN6C 4HP5A 3D9AL 5HYQA 1XF5A 3FH5A 3F7YA 4S11A 4XAWL 3VFVB 4WI7A 5GS2H 5K5YA 3KG5A 4U1HB 3SE9H 4LOEA 3CN0A 1XTLA 1AVAA 2X41A 3MV8D 1YEKH 1Q94A 4QR7A 3ZHLA 3RFZB 2CXGA 2EO9A 2ITDA 1E4WH 4G8EA 4L4TE 3BPOC 2FJHA 5ANMA 5BRZE 1MQKH 2IAMB 4JFPB 4WWID 1ZHBB 1NC2D 5DHXB 4HSAC 3FTGB 5C7XL 2H2SC 5ESQB 4I9WD 5IHLB 2EXTA 4HXAH 3BH4A 3FO0H 4JZJB 4QRQB 1KTLB 3BP7B 3T77A 3VFPB 5TDNA 5D1QE 2VDQB 1UASA 4AQEB 4DN3L 3EH1A 5EIIA 1WSST 3CDGA 5EU6B 1TZOA 2EXYC 4MBRA 1QUPA 3EOBB 1J5OL 3HG1D 4TN9A 2B9AA 3MRGA 1EJ8A 1Z3GH 4XGZA 2QQLL 1JPST 3IXTB 4OLEA 1YHPA 3PHOA 3QQ9D 1GGCH 1CMOA 1D7CA 3BXNA 2YRPA 3QCUH 1SLVA 4NO2B 4FX5A 2O5ZL 1IGFL 4OLWH 2BNQB 5FUOH 2FB4H 1AD0B 1ETZB 1N5AB 3H4HA 5GGUA 1CI5A 5AAMC 1NIEA 4ONHB 4L1DA 2PABA 1W72A 4KZDH 3BVWA 5ERWA