2KLUA

Nmr structure of the transmembrane and cytoplasmic domains of human cd4
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
GPLVPRGSMALIVLGGVAGLLLFIGLGIFFSVRSRHRRRQAERMSQIKRLLSEKKTSQSPHRFQKTHSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-cell surface glycoprotein CD4
publication title NMR structure of the transmembrane and cytoplasmic domains of human CD4 in micelles.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system, membrane protein
total genus 9
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12104 Tcell_CD4_C T cell CD4 receptor C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.900 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces transmembrane domain of human cd4 2kluA00
2KLUA
chains in the Genus database with same CATH superfamily
4YXWH 4PV1D 1SVFA 1S3JA 3L73E 3B5ND 4WB4A 5AVTB 5AW6B 3H1LG 1FDIA 2CPSA 3RK2C 1PGQA 3PTZA 3AEAC 2V7QJ 3L4FA 2JWDA 4R4LA 3M0AA 3WUTA 2M5AA 4W7YA 1RQVA 1K04A 1FBMA 1NTZK 3E1IA 2R32A 4D6TE 5KJ7D 2BASA 1KQSO 1S5LE 4D6TJ 1SQPG 3SFDC 3RK3D 1FZCA 3RBXA 2IFNA 1AVYA 1GL2C 1LGHB 1ZXGA 1NTKK 1P84H 4PV1B 3MD0A 1NAYA 3H1JD 3I55P 1L0LG 2JR8A 2K9JA 1U57A 3M06A 4MN4C 5E79E 3B5NB 2YKOA 5APQA 2FYUG 2KLUA 2E74C 3A7OA 3BCCG 1LTBC 2RN0A 3CMAP 1JUNA 1YTZT 3Q2YA 2KOGA 2V7QH 1LTGC 4OGQD 3WMM0 2NPSC 3O8ZA 2MKVA 1M90Q 2YMYA 4W7ZA 3Q3DA 1IK9A 3GW6A 2KLVA 2Q9IA 1LTAC 2IYOA 3TGUG 3P32A 3RBZA 2PP6A 1OIPA 1KQLA 2W83C 2FBWC 4WY4C 2OQQA 2K37A 2HPCB 3L36A 3RK3B 3L73D 1S5LH 1J2JB 3AE2C 2M3EA 2LKMA 1OW7A 2HG5D 3H1HG 4R4MA 1YIJP 5APVA 2ZXEB 2H89C 1ZV8A 4KT0J 3HUSB 1BE3E 4HH2A 1VQMP 1SP4A 2C9NY 1S5LX 1PP9E 1HH0A 1IFMA 3U1CA 4D6TD 5E79H 3HD7D 4EDFA 5GTIE 1JCCA 3L72G 4OGQB 2OYIC 2M8RA 4U3FE 3B5NA 1BCCJ 3B4SA 1H88A 3L37A 4PJ0E 2QVAA 1M8OB 5BU8B 2OTKE 3K5BA 4U3FJ 3GHGC 1VF5D 1YQ3C 1VQ6P 1LJ2A 4BXLA 3D6ZA 1VQ4P 3CX5E 1EZVE 1JCDA 2FYUK 4GIFA 1GU5A 5M1BA 1Q81Q 5AW8B 1JTHB 3PH0A 1SQVG 5KJ7A 3CL3D 2KSJA 3CCJP 5EFWB 2A06E 2BCCE 5KLIB 1W5CE 2HPCA 4LLHA 1W2EA 2FXOA 2BCCJ 2Z5HA 1ZP0C 3CCMP 1IFJA 1ZW0A 3PHLA 1N7SC 4YPCA 3HUSA 3N4XA 1LP1B 3HD7B 3D70A 2E5YA 1LTTC 3RL0D 1AQ5A 4GOFA 4NPDA 5GTIH 1FS0E 2DW3A 4GKGA 3LW5J 2YNYA 1IFDA 2YIUC 1FZFA 1VQKP 2P67A 1HTLC 4PD4I 4PJ0H 1JMMA 3SSUA 1VF5B 5AW4B 2SPZA 3E1RA 1L4AC 1EXIA 2IBZE 2J5UA 1SQQE 3FXEA 3CX5H 1S9KE 4I6MC 2G8YA 1EDIA 1RF1C 2WQYC 2QM7A 3AEEC 1PP9D 5AVWB 3CC2P 1FJPA 1SQQJ 1SQBE 5L8RJ 3W68A 4C7NB 2QJPB 1NJIQ 1M1KQ 4BRYB 1QGKB 1PV3A 1BCCD 1SS1A 3HE4B 3V6IA 2AXTE 1PGJA 4U3FD 1Y47A 2YO2A 1JTHA 1JY3P 1X8YA 4GT1A 4Y99B 5AW7B 3CCLP 1NU1K 1LWUB 1PIXA 1K8AQ 3CX5D 3RL0B 2OTJP 1E79H 4IFMA 2ZJSE 1CW5A 3LW5H 4YXDC 5KAIE 1KMIZ 4QMAA 3F5HA 1U7MA 2ZT9D 1LP1A 3HD7A 4XE5B 2R3SA 1R5LA 1RE4C 3UIAA 3AEFC 2WSSH 3L74J 1HUCA 2BCCD 2RMZA 1Z56A 2D2CD 2AEJA 3H1JG 2KYVA 3D71A 1LTJC 2O01J 4IFDK 1GK6A 3G6EP 2LXCB 3FX0A 2JO1A 2Q1KA 3MTUE 2KP8A 1PZQA 2PAJA 3VMZA 3CCQP 1G2CB 1RE3C 3LIEA 1KZUB 1L0NE 1EDJA 5CBNA 3NMDA 1FZGA 3MZWB 1LT9B 3VYIA 3G3ZA 2AXTH 2QJKB 3MP7B 4C7NA 3L70G 4BRYA 2E76D 3HE4A 2A45H 1XTGB 3RL0g 4OVNF 5APTA 3AE8C 2IBZD 5KKZC 1EQ7A 2Q3EA 3SWYA 4ZKPA 5TISE 1SQQD 1S9KD 1GMJA 3AEBC 2OARA 1SFCD 1S4XA 1LT1A 4H0LD 5BVZA 3L73G 4TT3H 1LWUA 4H13C 2ZT9B 5KAIH 2Y0CA 2OTLP 3JC22 3CCSP 2D2CB 2IFMA 1N8RQ 1N73B 2CPBA 1VL2A 2O01H 1USDA 2KZJA 3L75J 3KDPB 4JYCA 4RO0A 4CPGA 2RKLA 2Y0EA 2N1TC 1BSHA 2JEEA 4ZMDA 4AUWA 4D6TG 2V4HA 1NKNA 1KD1Q 3CPWO 3T97B 3GMAA 5AW5B 1URQD 1G2CA 3H1KE 3C8VA 4JPZB 1GD2E 3D6YA 3FGAD 1W2BO 2E76B 2HLOA 2K9JB 1LT9A 3H1KJ 1SQXK 3CWBJ 2KI7B 2OYHB 3W67A 4GOEA 5KLVG 1KILC 1RF0C 1SFCB 5TISH 4H0LB 1HJ0A 1YITP 2KB7P 3QH9A 5TJHA 4HKZH 2JDIH 3ZDMA 2E5TA 3Q1MA 1J1DB 5KTBA 1L0ND 1P84I 3KZIE 1DD3A 3BASA 3AE4C 1Q7YQ 1NO4A 5AW0B 2IZ0A 1KILD 1KV4A 2BEQD 1G1IA 1NTZE 2R3CA 3OJAB 1T2KC 2M3BA 5K5GB 4A7PA 4UB6E 4XA4A 3AE7C 1QVFO 1JY3O 1N73A 1NTZJ 3MUDC 1KTMA 2AEFA 4JF7A 1AV1A 1LTIC 1URQB 3RK2D 5CJ0A 1N2DC 4M3LA 1M1JB 2M0BA 3PLNA 3V5BA 1JOCA 3P8CD 1NTKE 2XU6A 2RH0A 3T97A 2WZ7A 3GG2A 2W90A 3L75D 1NTKJ 1OZHA 2JP3A 2Y9YA 3SWFA 2GUVA 1BE3G 3PRJA 2WTYA 2QEXP 2C9LY 2QJYC 1PP9G 3A3YB 1ZN5A 2FYNB 2R5DA 2XDJA 1GL2D 2OYHA 2P58A 5CCHC 4RJTA 1SFCA 3KZIH 3RGUA 1IC2A 5AVYB 4YTPC 1K73Q 5AVXB 2H7HA 4U3FG 1J1EC 3E7KA 3H1KD 2QG4A 4AQRD 1HWTC 3B71A 3BATA 5KLVK 2Q7CA 2W6JH 5CCHD 2E74D 1AA0A 2GA1A 3V2RA 3TK1A 1LNQA 2J58A 4UB6H 4WBAA 1EZVG 2E75C 2Q6QA 1EC5A 1YQ4C 3RK2B 3M0DA 3H32B 1OVRA 2NPSD 1NTMG 2JKVA 2P2UA 1FC2C 2POHA 2I8DA 3CMEP 4HJGH 1OXZA 1NOHA 1URQA 3NXSA 2A06G 2FXMA 2BCCG 1JM0A 2KNCB 4LGDE 1M1JA 4N78E 2JJLA 4WY4D 1MFTA 3BVHA 1TU3F 1OFCX 1IFPA 1MKMA 1NTZD 2L5GB 2QM8A 2JWAA 2E42A 2FFDC 1GL2B 4HYTB 3EWKA 1SQPK 3AE1C 5AVVB 3CCEP 1ZR4A 1KYOI 2Q5UA 3Q5RA 1BCCE 5DJUB 5AVZB 5AW1B 2WSFJ 1KB9E 1NTKD 3WUUA 3IF4A 1PL5A 2WPSA 2HODB 5DJTB 1FJKA 4ZNCA 5CCGC 1L0LJ 2FYUE 1L0LK 3S9OA 3ABVC 1JY2P 2E74B 3IN6A 1KILA 3GF7A 1WT6A 2QSIA 2GUSA 3CCRP 1SQQG 1VDFA 1YYCA 2FYUJ 1LTSC 2NPSB 1M56D 1NH4A 3H1IE 3L35A 1BDDA 2B87A 1SQBG 5CCGD 3H1IJ 3N7NA 1GK4A 3H32A 3PP5A 3FWLA 3FWNA 2KIKA 3CX5I 1EZVI 1OWAA 3TGUJ 2J59M 1AVOA 2I1KA 4WY4B 2WPRA 3P7KA 2W8ZA 2A45G 4WVZA 1NTMK 2KNCA 1CI6B 3P8MC 1DEEG 1RY3A 2QRXA 1RQUA 2O1KA 2FKWB 3MHVA 3H1HJ 3KQGA 4I7ZC 3V2NA 4AYCA 2W6AA 1GL2A 4PD4E 3VTPC 1M7LA 2PFXA 1KB9H 1ZRTE 5B66E 1WMKA 1N7SD 3U59A 1OVVA 1KFMA 2WWWA 4N78D 1SLQA 2L91A 1PPJE 3IAOA 2OYIB 1G1JA 2HODA 1QLED 1QVGO 5AW9B 2B9BA 3GHGB 1L0NG 3CLQA 3OA7A 3B8EB 1L4AD 2GM4A 2NPSA 4KHXA 1PGOA 4DOJA 1QX8A 1NU1E 1KB9D 2ZVOB 4DJGA 4ASVA 2WVRA 2FYUD 1NU1J 4WY4A 2NZ2A 1SQBK 4TLFA 2I1JA 4IL6E 4H44C 2WSCJ 1SQVK 3H1ID 1GZLA 1CI6A 4C7RA 2A45I 3L74E 1HGZA 4EIJA 1NAFA 1N7SB 4PD4H 3G9RA 5B66H 5APWA 1QL1A 1X9VA 2WMMA 2LR2A 1VQLP 3CXHE 1GDTA 3USSA 3F89A 2YIUB 4HB1A 3HE5B 4N6JA 1HVVA 1H89A 3H1HD 4WWIA 3H25A 1FZCC 1L4AB 1HGVA 4IFFA 4L74A 2OYIA 5B5EE 3GF3A 2K9YA 2VRSA 3LIDA 4JQ0D 1KC8Q 1KILE 3H1KG 5CCGA 1RF1B 2NRGA 3GHGA 4PD4D 3VMXA 1DD4A 1ZRTD 5APUA 4IOIH 1GTWA 2KUBA 2YXRB 3QWOC 4GDOA 4EI2A 1PPJD 4C46A 1KQFB 1JY2O 2P1JA 1EDLA 3H6PA 4IL6H 2ZYDA 2FYZA 3P8CE 1OMIA 2B88A 1Y9BA 2BEZF 3L75E 3V4QA 2R5BA 1NYHA 3VP8A 3MGNA 1NU1D 2QE7H 1NTZG 4IL6X 3CXHH 1N7SA 2KSEA 4H13D 2R44A 1FZEA 2O3JA 2LXBA 3BRTB 5GTHE 3TSIA 1VQPP 1BSNA 1EXJA 4UB8E 3HE5A 5B5EH 1LTJB 3TNUB 2W6BA 1M57D 3H1JJ 1NTKG 3AE3C 3L74D 1L4AA 2YKPA 1SQXE 4KJMA 2N1TD 3AE9C 3CWBE 3HRNA 1R5SA 4PV1C 1SQXJ 3AE5C 3TDKA 1RF1A 2HFED 2UWJE 3CXHD 4DCKA 2Y9ZA 2IDBA 2XNXA 2Y0DA 1WRGA 2WSEJ 4K35A 3TF5A 3B5NC 3MIWA 1OW6A 5KKZB 3L70J 1EDKA 3AECC 2K1AA 2YO3A 1H0TB 3M91A 3HTKB 1FU1A 1Q86Q 4H13B 5KAFE 3L73J 1BGYE 4NPFX 5GTHH 5AVRB 5KJ7C 2N9BA 3VMAA 3M9BA 3VOPA 1BGYJ 3OAKA 4UB8H 2IX7C 3EFFK 1RE4A 3IR9A 3RK3C 1A02J 1Q82Q 2QIWA 1T2KD 2N1TB 1E5WA 4LC1A 5CMZA 1D7MA 2OGUA 2P10A 3BRVB 1LTJA 3TNUA 2H8PD 2HYNA 3HUSC 2WITA 5AVQB 1JY3N 3M9QA 2Z4EA 1FOSF 5C39A 1N7LA 1RE3A 2WSEH 1OX3A 2G3AA 1FZBA 2FXPA 1KORA 3L71E 3EQ2A 1YJNP 3SFEC 1BCCG 1AQTA 4OGQC 5KLVE 1KILB 3L71J 4JYBA 3KXDA 1SQXD 1IFIA 5KLVJ 1JEKA 3CWBD 4RKUJ 3SWKA 1NGMB 2B87B 1NKZB 2FY8A 2WPQA 3JCUE 2E43A 1H0TA 3HTKA 3H1LE 5KAFH 2IZ1A 3H1IG 4JBZA 3H1LJ 1CZQA 3L70D 3EFGA 1P84D 1GW3A 4ASWA 1T3JA 1ZMEC 2B89A 5CHXA 2E75D 5KLIC 4L76A 1FDOA 3A0BE 1S2EA 2N1TA 3OW2O 1SQPE 2KZIA 2AXCA 1L2PA 1GU4A 1BGYD 1HF9A 1KYOE 1SQPJ 3HD7C 1AFOA 2XNDH 2WPVB 2ZAEB 1FDMA 2XV5A 3A0HE 4L73A 2ITAA 3CCUP 5AW3B 1KQGB 3WU2E 1L0LE 2QJYB 1GW4A 1BE3J 1KN7A 1K05A 3ITKA 1NVOA 1VF5C 3BCCE 3C9IA 1PP9J 1PPJG 1RF0A 2IBZG 2Z5IA 3JCUH 1NHLA 1R8EA 2CK3H 4RESB 3BCCJ 1J1EB 2H43A 2ZVNB 1KB9I 4XFJA 1ZOYC 3NFQA 3TGUE 1IJDB 3S4RA 2K3RA 2QJPC 3L71D 1FAVA 2K88A 3KPEA 4OH8B 3V2PA 1CSBA 1Q2NA 2E75B 1H8AA 5H2FE 4GODA 5APSA 4Y28J 5KLVD 1NTME 5AVSB 1JB0J 1NU1G 5BU5A 3R2PA 2C0XA 1VQ7P 3A0BH 4Y99C 2H88C 1YI2P 3MUDA 1NTMJ 3VP9A 2AEMA 3H1HE 4O9BA 3Q5SA 1A02F 1LWUC 3H1LD 3M9HA 1X0TA 1YTZI 3Q5PA 1DH3A 3RL0C 1KYOH 5CJ4A 3KYQA 1IK7A 1S1CX 2WSFH 2ZXXA 3V4WA 1VQOP 3A0HH 3A5TA 2XZRA 1YJ9P 3L74G 3CI9A 1HBWA 3WU2H 2C0WA 2FFDB 5AW2B 4DT0A 1S72P 1VQNP 3CD6P 1IFNA 3A2AA 1DIPA 3L72E 4Z1MH 1SQPD 5CCHA 3GLMA 3L72J 3G71P 2HR3A 1QL2A 3KHUA 1VQ5P 2OYOA 1KYOD 3C1LA 4EOTA 1MUUA 1KFNA 3U1AA 1OVUA 1RH5B 1UIIA 1LT9C 1Y8AA 2IBZI 1BE3D 3CCVP 2YXQB 5H2FH 2IPPA 1L0LD 2QJKC 4I2LC 4EYYQ 1ZR2A 1SQQK 1PFIA 3R4YA 2Q3IA 1MZ9A 2PGDA 1T6AA 1K9MQ 1YBKA 1SQVE 1QEXA 3BCCD 1SQBJ 2PRRA 3VMYA 4U7JA 4BWNA 1JMBA 1SQVJ 2WT7B 2ZT9C 2ZFCA 3TGUD 4DZOA 1OW8A 1EZVD 3O6QB 3L75G 2D2CC 5APYA 3WUVA 4W80A 4I7ZB 4H44D 1N73C 1NTMD 2KS1B 1YHQP 1XTCC 1FZAA 4NPEA 2FFDA 2QA4P 3II6A 1T8ZA 1FOSE 2MJZA 2A06D 2IYPA 3I5CA 4I1LA 3CC4P 1IO4A 1AJYA 5CBOA 3AEDC 2W27A 1ZLLA 3TYYA 3CXHI 1MV8A 3FXDA 3AE6C 4B86A 1SQXG 2KK7A 2ZYGA 4K3AA 3CWBG 1Q90D 2E76C 2P7JA 2YKQA 1NWQA 3S1KA 2WSCH 2OYHC 3L72D 1L0NJ 1L0NK 1PGPA 1SFCC 1BDCA 4H0LC 2O01N 3IFMA 1J1DC 1HJBA 5AVUB 1JO5A 4OWFA 1VQ8P 3CC7P 1DEBA 4H44B 2WT7A 1UIXA 2ZYAA 5APXA 3M0DC 3I56P 3RK3E 1SQBD 1VQ9P 3O6QA 4ZKUA 1JY2N 2YMKA 1SQVD 1BGYG 2M5AB 2KS1A 3JSVC 3H1JE 1URQC 1FE6A 1DX7A 4N3YB 1M1JC 1IZNB 3G4SP 1MFZA 2KXPB 1X79B 3V2QA 1USEA 1JNMA 1FZCB 1VPCA 1X22A 3PJSK 4L75A 1T3UA 2N9YB 1N86A 3AEGC 2FYNC 3VN0A 1U7JA 3L70E 2XKMA 1YJWP 3NTNA 2O1JA 1P84E 3L71G 1RHZB
chains in the Genus database with same CATH topology
2KLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLU A; 
#chains in the Genus database with same CATH topology
 4YXW H;  4PV1 D;  1SVF A;  1S3J A;  3L73 E;  3B5N D;  4WB4 A;  5AVT B;  5AW6 B;  3H1L G;  1FDI A;  2CPS A;  3RK2 C;  1PGQ A;  3PTZ A;  3AEA C;  2V7Q J;  3L4F A;  2JWD A;  4R4L A;  3M0A A;  3WUT A;  2M5A A;  4W7Y A;  1RQV A;  1K04 A;  1FBM A;  1NTZ K;  3E1I A;  2R32 A;  4D6T E;  5KJ7 D;  2BAS A;  1KQS O;  1S5L E;  4D6T J;  1SQP G;  3SFD C;  3RK3 D;  1FZC A;  3RBX A;  2IFN A;  1AVY A;  1GL2 C;  1LGH B;  1ZXG A;  1NTK K;  1P84 H;  4PV1 B;  3MD0 A;  1NAY A;  3H1J D;  3I55 P;  1L0L G;  2JR8 A;  2K9J A;  1U57 A;  3M06 A;  4MN4 C;  5E79 E;  3B5N B;  2YKO A;  5APQ A;  2FYU G;  2KLU A;  2E74 C;  3A7O A;  3BCC G;  1LTB C;  2RN0 A;  3CMA P;  1JUN A;  1YTZ T;  3Q2Y A;  2KOG A;  2V7Q H;  1LTG C;  4OGQ D;  3WMM 0;  2NPS C;  3O8Z A;  2MKV A;  1M90 Q;  2YMY A;  4W7Z A;  3Q3D A;  1IK9 A;  3GW6 A;  2KLV A;  2Q9I A;  1LTA C;  2IYO A;  3TGU G;  3P32 A;  3RBZ A;  2PP6 A;  1OIP A;  1KQL A;  2W83 C;  2FBW C;  4WY4 C;  2OQQ A;  2K37 A;  2HPC B;  3L36 A;  3RK3 B;  3L73 D;  1S5L H;  1J2J B;  3AE2 C;  2M3E A;  2LKM A;  1OW7 A;  2HG5 D;  3H1H G;  4R4M A;  1YIJ P;  5APV A;  2ZXE B;  2H89 C;  1ZV8 A;  4KT0 J;  3HUS B;  1BE3 E;  4HH2 A;  1VQM P;  1SP4 A;  2C9N Y;  1S5L X;  1PP9 E;  1HH0 A;  1IFM A;  3U1C A;  4D6T D;  5E79 H;  3HD7 D;  4EDF A;  5GTI E;  1JCC A;  3L72 G;  4OGQ B;  2OYI C;  2M8R A;  4U3F E;  3B5N A;  1BCC J;  3B4S A;  1H88 A;  3L37 A;  4PJ0 E;  2QVA A;  1M8O B;  5BU8 B;  2OTK E;  3K5B A;  4U3F J;  3GHG C;  1VF5 D;  1YQ3 C;  1VQ6 P;  1LJ2 A;  4BXL A;  3D6Z A;  1VQ4 P;  3CX5 E;  1EZV E;  1JCD A;  2FYU K;  4GIF A;  1GU5 A;  5M1B A;  1Q81 Q;  5AW8 B;  1JTH B;  3PH0 A;  1SQV G;  5KJ7 A;  3CL3 D;  2KSJ A;  3CCJ P;  5EFW B;  2A06 E;  2BCC E;  5KLI B;  1W5C E;  2HPC A;  4LLH A;  1W2E A;  2FXO A;  2BCC J;  2Z5H A;  1ZP0 C;  3CCM P;  1IFJ A;  1ZW0 A;  3PHL A;  1N7S C;  4YPC A;  3HUS A;  3N4X A;  1LP1 B;  3HD7 B;  3D70 A;  2E5Y A;  1LTT C;  3RL0 D;  1AQ5 A;  4GOF A;  4NPD A;  5GTI H;  1FS0 E;  2DW3 A;  4GKG A;  3LW5 J;  2YNY A;  1IFD A;  2YIU C;  1FZF A;  1VQK P;  2P67 A;  1HTL C;  4PD4 I;  4PJ0 H;  1JMM A;  3SSU A;  1VF5 B;  5AW4 B;  2SPZ A;  3E1R A;  1L4A C;  1EXI A;  2IBZ E;  2J5U A;  1SQQ E;  3FXE A;  3CX5 H;  1S9K E;  4I6M C;  2G8Y A;  1EDI A;  1RF1 C;  2WQY C;  2QM7 A;  3AEE C;  1PP9 D;  5AVW B;  3CC2 P;  1FJP A;  1SQQ J;  1SQB E;  5L8R J;  3W68 A;  4C7N B;  2QJP B;  1NJI Q;  1M1K Q;  4BRY B;  1QGK B;  1PV3 A;  1BCC D;  1SS1 A;  3HE4 B;  3V6I A;  2AXT E;  1PGJ A;  4U3F D;  1Y47 A;  2YO2 A;  1JTH A;  1JY3 P;  1X8Y A;  4GT1 A;  4Y99 B;  5AW7 B;  3CCL P;  1NU1 K;  1LWU B;  1PIX A;  1K8A Q;  3CX5 D;  3RL0 B;  2OTJ P;  1E79 H;  4IFM A;  2ZJS E;  1CW5 A;  3LW5 H;  4YXD C;  5KAI E;  1KMI Z;  4QMA A;  3F5H A;  1U7M A;  2ZT9 D;  1LP1 A;  3HD7 A;  4XE5 B;  2R3S A;  1R5L A;  1RE4 C;  3UIA A;  3AEF C;  2WSS H;  3L74 J;  1HUC A;  2BCC D;  2RMZ A;  1Z56 A;  2D2C D;  2AEJ A;  3H1J G;  2KYV A;  3D71 A;  1LTJ C;  2O01 J;  4IFD K;  1GK6 A;  3G6E P;  2LXC B;  3FX0 A;  2JO1 A;  2Q1K A;  3MTU E;  2KP8 A;  1PZQ A;  2PAJ A;  3VMZ A;  3CCQ P;  1G2C B;  1RE3 C;  3LIE A;  1KZU B;  1L0N E;  1EDJ A;  5CBN A;  3NMD A;  1FZG A;  3MZW B;  1LT9 B;  3VYI A;  3G3Z A;  2AXT H;  2QJK B;  3MP7 B;  4C7N A;  3L70 G;  4BRY A;  2E76 D;  3HE4 A;  2A45 H;  1XTG B;  3RL0 g;  4OVN F;  5APT A;  3AE8 C;  2IBZ D;  5KKZ C;  1EQ7 A;  2Q3E A;  3SWY A;  4ZKP A;  5TIS E;  1SQQ D;  1S9K D;  1GMJ A;  3AEB C;  2OAR A;  1SFC D;  1S4X A;  1LT1 A;  4H0L D;  5BVZ A;  3L73 G;  4TT3 H;  1LWU A;  4H13 C;  2ZT9 B;  5KAI H;  2Y0C A;  2OTL P;  3JC2 2;  3CCS P;  2D2C B;  2IFM A;  1N8R Q;  1N73 B;  2CPB A;  1VL2 A;  2O01 H;  1USD A;  2KZJ A;  3L75 J;  3KDP B;  4JYC A;  4RO0 A;  4CPG A;  2RKL A;  2Y0E A;  2N1T C;  1BSH A;  2JEE A;  4ZMD A;  4AUW A;  4D6T G;  2V4H A;  1NKN A;  1KD1 Q;  3CPW O;  3T97 B;  3GMA A;  5AW5 B;  1URQ D;  1G2C A;  3H1K E;  3C8V A;  4JPZ B;  1GD2 E;  3D6Y A;  3FGA D;  1W2B O;  2E76 B;  2HLO A;  2K9J B;  1LT9 A;  3H1K J;  1SQX K;  3CWB J;  2KI7 B;  2OYH B;  3W67 A;  4GOE A;  5KLV G;  1KIL C;  1RF0 C;  1SFC B;  5TIS H;  4H0L B;  1HJ0 A;  1YIT P;  2KB7 P;  3QH9 A;  5TJH A;  4HKZ H;  2JDI H;  3ZDM A;  2E5T A;  3Q1M A;  1J1D B;  5KTB A;  1L0N D;  1P84 I;  3KZI E;  1DD3 A;  3BAS A;  3AE4 C;  1Q7Y Q;  1NO4 A;  5AW0 B;  2IZ0 A;  1KIL D;  1KV4 A;  2BEQ D;  1G1I A;  1NTZ E;  2R3C A;  3OJA B;  1T2K C;  2M3B A;  5K5G B;  4A7P A;  4UB6 E;  4XA4 A;  3AE7 C;  1QVF O;  1JY3 O;  1N73 A;  1NTZ J;  3MUD C;  1KTM A;  2AEF A;  4JF7 A;  1AV1 A;  1LTI C;  1URQ B;  3RK2 D;  5CJ0 A;  1N2D C;  4M3L A;  1M1J B;  2M0B A;  3PLN A;  3V5B A;  1JOC A;  3P8C D;  1NTK E;  2XU6 A;  2RH0 A;  3T97 A;  2WZ7 A;  3GG2 A;  2W90 A;  3L75 D;  1NTK J;  1OZH A;  2JP3 A;  2Y9Y A;  3SWF A;  2GUV A;  1BE3 G;  3PRJ A;  2WTY A;  2QEX P;  2C9L Y;  2QJY C;  1PP9 G;  3A3Y B;  1ZN5 A;  2FYN B;  2R5D A;  2XDJ A;  1GL2 D;  2OYH A;  2P58 A;  5CCH C;  4RJT A;  1SFC A;  3KZI H;  3RGU A;  1IC2 A;  5AVY B;  4YTP C;  1K73 Q;  5AVX B;  2H7H A;  4U3F G;  1J1E C;  3E7K A;  3H1K D;  2QG4 A;  4AQR D;  1HWT C;  3B71 A;  3BAT A;  5KLV K;  2Q7C A;  2W6J H;  5CCH D;  2E74 D;  1AA0 A;  2GA1 A;  3V2R A;  3TK1 A;  1LNQ A;  2J58 A;  4UB6 H;  4WBA A;  1EZV G;  2E75 C;  2Q6Q A;  1EC5 A;  1YQ4 C;  3RK2 B;  3M0D A;  3H32 B;  1OVR A;  2NPS D;  1NTM G;  2JKV A;  2P2U A;  1FC2 C;  2POH A;  2I8D A;  3CME P;  4HJG H;  1OXZ A;  1NOH A;  1URQ A;  3NXS A;  2A06 G;  2FXM A;  2BCC G;  1JM0 A;  2KNC B;  4LGD E;  1M1J A;  4N78 E;  2JJL A;  4WY4 D;  1MFT A;  3BVH A;  1TU3 F;  1OFC X;  1IFP A;  1MKM A;  1NTZ D;  2L5G B;  2QM8 A;  2JWA A;  2E42 A;  2FFD C;  1GL2 B;  4HYT B;  3EWK A;  1SQP K;  3AE1 C;  5AVV B;  3CCE P;  1ZR4 A;  1KYO I;  2Q5U A;  3Q5R A;  1BCC E;  5DJU B;  5AVZ B;  5AW1 B;  2WSF J;  1KB9 E;  1NTK D;  3WUU A;  3IF4 A;  1PL5 A;  2WPS A;  2HOD B;  5DJT B;  1FJK A;  4ZNC A;  5CCG C;  1L0L J;  2FYU E;  1L0L K;  3S9O A;  3ABV C;  1JY2 P;  2E74 B;  3IN6 A;  1KIL A;  3GF7 A;  1WT6 A;  2QSI A;  2GUS A;  3CCR P;  1SQQ G;  1VDF A;  1YYC A;  2FYU J;  1LTS C;  2NPS B;  1M56 D;  1NH4 A;  3H1I E;  3L35 A;  1BDD A;  2B87 A;  1SQB G;  5CCG D;  3H1I J;  3N7N A;  1GK4 A;  3H32 A;  3PP5 A;  3FWL A;  3FWN A;  2KIK A;  3CX5 I;  1EZV I;  1OWA A;  3TGU J;  2J59 M;  1AVO A;  2I1K A;  4WY4 B;  2WPR A;  3P7K A;  2W8Z A;  2A45 G;  4WVZ A;  1NTM K;  2KNC A;  1CI6 B;  3P8M C;  1DEE G;  1RY3 A;  2QRX A;  1RQU A;  2O1K A;  2FKW B;  3MHV A;  3H1H J;  3KQG A;  4I7Z C;  3V2N A;  4AYC A;  2W6A A;  1GL2 A;  4PD4 E;  3VTP C;  1M7L A;  2PFX A;  1KB9 H;  1ZRT E;  5B66 E;  1WMK A;  1N7S D;  3U59 A;  1OVV A;  1KFM A;  2WWW A;  4N78 D;  1SLQ A;  2L91 A;  1PPJ E;  3IAO A;  2OYI B;  1G1J A;  2HOD A;  1QLE D;  1QVG O;  5AW9 B;  2B9B A;  3GHG B;  1L0N G;  3CLQ A;  3OA7 A;  3B8E B;  1L4A D;  2GM4 A;  2NPS A;  4KHX A;  1PGO A;  4DOJ A;  1QX8 A;  1NU1 E;  1KB9 D;  2ZVO B;  4DJG A;  4ASV A;  2WVR A;  2FYU D;  1NU1 J;  4WY4 A;  2NZ2 A;  1SQB K;  4TLF A;  2I1J A;  4IL6 E;  4H44 C;  2WSC J;  1SQV K;  3H1I D;  1GZL A;  1CI6 A;  4C7R A;  2A45 I;  3L74 E;  1HGZ A;  4EIJ A;  1NAF A;  1N7S B;  4PD4 H;  3G9R A;  5B66 H;  5APW A;  1QL1 A;  1X9V A;  2WMM A;  2LR2 A;  1VQL P;  3CXH E;  1GDT A;  3USS A;  3F89 A;  2YIU B;  4HB1 A;  3HE5 B;  4N6J A;  1HVV A;  1H89 A;  3H1H D;  4WWI A;  3H25 A;  1FZC C;  1L4A B;  1HGV A;  4IFF A;  4L74 A;  2OYI A;  5B5E E;  3GF3 A;  2K9Y A;  2VRS A;  3LID A;  4JQ0 D;  1KC8 Q;  1KIL E;  3H1K G;  5CCG A;  1RF1 B;  2NRG A;  3GHG A;  4PD4 D;  3VMX A;  1DD4 A;  1ZRT D;  5APU A;  4IOI H;  1GTW A;  2KUB A;  2YXR B;  3QWO C;  4GDO A;  4EI2 A;  1PPJ D;  4C46 A;  1KQF B;  1JY2 O;  2P1J A;  1EDL A;  3H6P A;  4IL6 H;  2ZYD A;  2FYZ A;  3P8C E;  1OMI A;  2B88 A;  1Y9B A;  2BEZ F;  3L75 E;  3V4Q A;  2R5B A;  1NYH A;  3VP8 A;  3MGN A;  1NU1 D;  2QE7 H;  1NTZ G;  4IL6 X;  3CXH H;  1N7S A;  2KSE A;  4H13 D;  2R44 A;  1FZE A;  2O3J A;  2LXB A;  3BRT B;  5GTH E;  3TSI A;  1VQP P;  1BSN A;  1EXJ A;  4UB8 E;  3HE5 A;  5B5E H;  1LTJ B;  3TNU B;  2W6B A;  1M57 D;  3H1J J;  1NTK G;  3AE3 C;  3L74 D;  1L4A A;  2YKP A;  1SQX E;  4KJM A;  2N1T D;  3AE9 C;  3CWB E;  3HRN A;  1R5S A;  4PV1 C;  1SQX J;  3AE5 C;  3TDK A;  1RF1 A;  2HFE D;  2UWJ E;  3CXH D;  4DCK A;  2Y9Z A;  2IDB A;  2XNX A;  2Y0D A;  1WRG A;  2WSE J;  4K35 A;  3TF5 A;  3B5N C;  3MIW A;  1OW6 A;  5KKZ B;  3L70 J;  1EDK A;  3AEC C;  2K1A A;  2YO3 A;  1H0T B;  3M91 A;  3HTK B;  1FU1 A;  1Q86 Q;  4H13 B;  5KAF E;  3L73 J;  1BGY E;  4NPF X;  5GTH H;  5AVR B;  5KJ7 C;  2N9B A;  3VMA A;  3M9B A;  3VOP A;  1BGY J;  3OAK A;  4UB8 H;  2IX7 C;  3EFF K;  1RE4 A;  3IR9 A;  3RK3 C;  1A02 J;  1Q82 Q;  2QIW A;  1T2K D;  2N1T B;  1E5W A;  4LC1 A;  5CMZ A;  1D7M A;  2OGU A;  2P10 A;  3BRV B;  1LTJ A;  3TNU A;  2H8P D;  2HYN A;  3HUS C;  2WIT A;  5AVQ B;  1JY3 N;  3M9Q A;  2Z4E A;  1FOS F;  5C39 A;  1N7L A;  1RE3 A;  2WSE H;  1OX3 A;  2G3A A;  1FZB A;  2FXP A;  1KOR A;  3L71 E;  3EQ2 A;  1YJN P;  3SFE C;  1BCC G;  1AQT A;  4OGQ C;  5KLV E;  1KIL B;  3L71 J;  4JYB A;  3KXD A;  1SQX D;  1IFI A;  5KLV J;  1JEK A;  3CWB D;  4RKU J;  3SWK A;  1NGM B;  2B87 B;  1NKZ B;  2FY8 A;  2WPQ A;  3JCU E;  2E43 A;  1H0T A;  3HTK A;  3H1L E;  5KAF H;  2IZ1 A;  3H1I G;  4JBZ A;  3H1L J;  1CZQ A;  3L70 D;  3EFG A;  1P84 D;  1GW3 A;  4ASW A;  1T3J A;  1ZME C;  2B89 A;  5CHX A;  2E75 D;  5KLI C;  4L76 A;  1FDO A;  3A0B E;  1S2E A;  2N1T A;  3OW2 O;  1SQP E;  2KZI A;  2AXC A;  1L2P A;  1GU4 A;  1BGY D;  1HF9 A;  1KYO E;  1SQP J;  3HD7 C;  1AFO A;  2XND H;  2WPV B;  2ZAE B;  1FDM A;  2XV5 A;  3A0H E;  4L73 A;  2ITA A;  3CCU P;  5AW3 B;  1KQG B;  3WU2 E;  1L0L E;  2QJY B;  1GW4 A;  1BE3 J;  1KN7 A;  1K05 A;  3ITK A;  1NVO A;  1VF5 C;  3BCC E;  3C9I A;  1PP9 J;  1PPJ G;  1RF0 A;  2IBZ G;  2Z5I A;  3JCU H;  1NHL A;  1R8E A;  2CK3 H;  4RES B;  3BCC J;  1J1E B;  2H43 A;  2ZVN B;  1KB9 I;  4XFJ A;  1ZOY C;  3NFQ A;  3TGU E;  1IJD B;  3S4R A;  2K3R A;  2QJP C;  3L71 D;  1FAV A;  2K88 A;  3KPE A;  4OH8 B;  3V2P A;  1CSB A;  1Q2N A;  2E75 B;  1H8A A;  5H2F E;  4GOD A;  5APS A;  4Y28 J;  5KLV D;  1NTM E;  5AVS B;  1JB0 J;  1NU1 G;  5BU5 A;  3R2P A;  2C0X A;  1VQ7 P;  3A0B H;  4Y99 C;  2H88 C;  1YI2 P;  3MUD A;  1NTM J;  3VP9 A;  2AEM A;  3H1H E;  4O9B A;  3Q5S A;  1A02 F;  1LWU C;  3H1L D;  3M9H A;  1X0T A;  1YTZ I;  3Q5P A;  1DH3 A;  3RL0 C;  1KYO H;  5CJ4 A;  3KYQ A;  1IK7 A;  1S1C X;  2WSF H;  2ZXX A;  3V4W A;  1VQO P;  3A0H H;  3A5T A;  2XZR A;  1YJ9 P;  3L74 G;  3CI9 A;  1HBW A;  3WU2 H;  2C0W A;  2FFD B;  5AW2 B;  4DT0 A;  1S72 P;  1VQN P;  3CD6 P;  1IFN A;  3A2A A;  1DIP A;  3L72 E;  4Z1M H;  1SQP D;  5CCH A;  3GLM A;  3L72 J;  3G71 P;  2HR3 A;  1QL2 A;  3KHU A;  1VQ5 P;  2OYO A;  1KYO D;  3C1L A;  4EOT A;  1MUU A;  1KFN A;  3U1A A;  1OVU A;  1RH5 B;  1UII A;  1LT9 C;  1Y8A A;  2IBZ I;  1BE3 D;  3CCV P;  2YXQ B;  5H2F H;  2IPP A;  1L0L D;  2QJK C;  4I2L C;  4EYY Q;  1ZR2 A;  1SQQ K;  1PFI A;  3R4Y A;  2Q3I A;  1MZ9 A;  2PGD A;  1T6A A;  1K9M Q;  1YBK A;  1SQV E;  1QEX A;  3BCC D;  1SQB J;  2PRR A;  3VMY A;  4U7J A;  4BWN A;  1JMB A;  1SQV J;  2WT7 B;  2ZT9 C;  2ZFC A;  3TGU D;  4DZO A;  1OW8 A;  1EZV D;  3O6Q B;  3L75 G;  2D2C C;  5APY A;  3WUV A;  4W80 A;  4I7Z B;  4H44 D;  1N73 C;  1NTM D;  2KS1 B;  1YHQ P;  1XTC C;  1FZA A;  4NPE A;  2FFD A;  2QA4 P;  3II6 A;  1T8Z A;  1FOS E;  2MJZ A;  2A06 D;  2IYP A;  3I5C A;  4I1L A;  3CC4 P;  1IO4 A;  1AJY A;  5CBO A;  3AED C;  2W27 A;  1ZLL A;  3TYY A;  3CXH I;  1MV8 A;  3FXD A;  3AE6 C;  4B86 A;  1SQX G;  2KK7 A;  2ZYG A;  4K3A A;  3CWB G;  1Q90 D;  2E76 C;  2P7J A;  2YKQ A;  1NWQ A;  3S1K A;  2WSC H;  2OYH C;  3L72 D;  1L0N J;  1L0N K;  1PGP A;  1SFC C;  1BDC A;  4H0L C;  2O01 N;  3IFM A;  1J1D C;  1HJB A;  5AVU B;  1JO5 A;  4OWF A;  1VQ8 P;  3CC7 P;  1DEB A;  4H44 B;  2WT7 A;  1UIX A;  2ZYA A;  5APX A;  3M0D C;  3I56 P;  3RK3 E;  1SQB D;  1VQ9 P;  3O6Q A;  4ZKU A;  1JY2 N;  2YMK A;  1SQV D;  1BGY G;  2M5A B;  2KS1 A;  3JSV C;  3H1J E;  1URQ C;  1FE6 A;  1DX7 A;  4N3Y B;  1M1J C;  1IZN B;  3G4S P;  1MFZ A;  2KXP B;  1X79 B;  3V2Q A;  1USE A;  1JNM A;  1FZC B;  1VPC A;  1X22 A;  3PJS K;  4L75 A;  1T3U A;  2N9Y B;  1N86 A;  3AEG C;  2FYN C;  3VN0 A;  1U7J A;  3L70 E;  2XKM A;  1YJW P;  3NTN A;  2O1J A;  1P84 E;  3L71 G;  1RHZ B; 
#chains in the Genus database with same CATH homology
 2KLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...