2KLUA

Nmr structure of the transmembrane and cytoplasmic domains of human cd4
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
b'GPLVPRGSMALIVLGGVAGLLLFIGLGIFFSVRSRHRRRQAERMSQIKRLLSEKKTSQSPHRFQKTHSPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-cell surface glycoprotein CD4
molecule tags Immune system, membrane protein
source organism Homo sapiens
publication title NMR structure of the transmembrane and cytoplasmic domains of human CD4 in micelles.
pubmed doi rcsb
total genus 9
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12104 Tcell_CD4_C T cell CD4 receptor C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.900 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces transmembrane domain of human cd4 2kluA00
2KLUA
chains in the Genus database with same CATH superfamily
1N7SC 3B5NA 2AXCA 2HODB 2WSFJ 3AE9C 1PP9G 1PP9J 2C0XA 5DJTB 5KAFE 5KTBA 2ZYDA 3V2NA 3TF5A 2LXBA 1OMIA 4GDOA 3RK2C 3RK3D 1RH5B 4H13D 2E74D 3IN6A 1SQXE 3SWKA 4WY4C 2Q7CA 3JCUE 4WBAA 1SQVD 2B87B 1X0TA 2P67A 2QSIA 1JNMA 1NYHA 2FYZA 3H1LG 2ZVOB 3HE4A 1AVOA 2WSCJ 1NOHA 3L74G 2FYUG 3CX5H 1RE3A 3H1JJ 4N3YB 1A02F 1NTZJ 3FWLA 1FDOA 1RQUA 1SQXJ 3G9RA 4DZOA 1Z56A 1LT1A 1PFIA 3AECC 1LT9A 1GL2B 1N73A 1SQQD 1HF9A 1CW5A 1NTKK 1LNQA 3RL0D 2IYOA 2HPCA 1KD1Q 1KILA 3KDPB 1IFDA 2OGUA 3VMZA 1USEA 2NZ2A 3MZWB 5GTHE 4W7ZA 1ZV8A 1NTKE 4ASWA 2WQYC 1PPJG 3T97A 3HE4B 1G2CB 3TNUA 5AVZB 4EYYQ 2OYIB 1KILC 2K88A 1T6AA 3VP9A 1GK4A 2RN0A 3TNUB 1J1DC 1M90Q 2OYIA 3TK1A 3E7KA 2Q3IA 5AW3B 2FYUE 2C9LY 2YMKA 2MKVA 1KILB 3G4SP 3USSA 5KAIE 1NU1G 5AW1B 1BGYG 1AVYA 2Y0CA 1T3JA 1GW4A 1KN7A 2A06G 3CCMP 1KQLA 1L0ND 1SQQK 1DEEG 3GMAA 3NMDA 4NPFX 1UIXA 4WB4A 4XA4A 5AW4B 5CCGD 3D70A 1OZHA 1VF5B 5CJ4A 1D7MA 2FXMA 1LTJA 2IBZE 2ZYAA 1Y47A 2GUSA 1HUCA 1LJ2A 2KB7P 3H1IE 3L72G 2JO1A 3M06A 4JBZA 4TLFA 5KJ7D 1FZAA 3H1KD 3I55P 1FJPA 1YHQP 2XNDH 1BGYD 1FZEA 3BATA 1NKNA 4GODA 3JCUH 1GD2E 2W8ZA 2FKWB 1OW8A 2G8YA 1NO4A 3P7KA 2FYUK 2R32A 1N7SA 1L0NJ 3HRNA 2E76D 3TDKA 2N9YB 1SP4A 3TGUG 1DX7A 1L0LD 5AW2B 2KOGA 1DIPA 3L75G 3L70D 3CD6P 3AE4C 5AW6B 1L4AC 3H1KJ 3VN0A 1H8AA 4WY4A 4RJTA 1IFIA 1SS1A 2RMZA 3L72E 3BRTB 3LIEA 4TT3H 4AUWA 3L75J 2OTJP 3M0DA 1SQQG 4DCKA 1K73Q 1JO5A 3JC22 3KPEA 2JEEA 4L73A 3MTUE 2YO2A 4PD4H 5KLVJ 1OVVA 3M0AA 2E43A 4L76A 3ZDMA 1EZVD 2LKMA 3PJSK 3TGUD 2P1JA 4GOFA 1IFJA 1Q86Q 1VQ4P 3CPWO 2P10A 1KZUB 3MP7B 5APXA 3QH9A 3KQGA 5AW0B 3CX5I 2QJYB 4GKGA 3H32B 4C46A 1S72P 2CK3H 2FFDB 2YIUC 1NU1E 2Z5HA 3L71G 4PJ0E 1FOSE 3GF7A 1M7LA 3HE5B 4WVZA 4LGDE 1FZFA 1W2EA 2Y0EA 3W68A 5B66H 4I2LC 3CCRP 1SQQE 4U3FD 1QEXA 1RF0A 1L0NG 3A0HH 3E1IA 3CCEP 4ZKUA 3KZIE 2PGDA 3MD0A 2I1KA 1NTZK 2RKLA 4DT0A 1Q90D 4UB8E 1KB9I 2ZVNB 3CC2P 1BCCG 1RF0C 2MJZA 3AE5C 2M5AA 3L71D 4KHXA 1W5CE 1XTGB 1NTZE 2K3RA 3F89A 1KYOH 1BCCJ 1LTSC 1SFCD 1IK9A 3O6QA 3VYIA 2E75D 2M8RA 1CI6B 3CXHE 4GIFA 5KLIC 1RF1B 4IFDK 1HJ0A 1VL2A 2I1JA 1IO4A 4HKZH 2A45I 1KORA 3GHGC 1U7JA 3PLNA 2KSEA 2NPSB 2XNXA 3H1LJ 2N1TA 3CMEP 1SQPG 2JJLA 1MV8A 5AVUB 3BCCE 1URQD 1SFCA 2K37A 3V4QA 3L70G 3Q2YA 3M91A 1FOSF 1W2BO 4DJGA 2O01N 4Y99B 4OVNF 3Q5SA 1Q7YQ 3R4YA 4IFMA 2W6BA 1LP1B 1LTTC 3CWBD 3PH0A 4N6JA 4PD4E 1BGYE 2Q9IA 3H1HJ 2XKMA 2YXQB 3H1HE 1PV3A 2V7QH 1AJYA 1P84I 5E79H 4IL6E 3LW5H 1EZVE 3GHGB 5KKZB 1K05A 1K04A 3H1LD 3G6EP 4EOTA 2N1TD 3VMXA 2B88A 2V4HA 3M0DC 2R3CA 1GU5A 1J2JB 2BCCD 3L73G 3SSUA 3WU2E 4C7NB 3MGNA 2WSSH 2P58A 1SQPE 1FZCB 1FC2C 2D2CD 4LLHA 2WPRA 3P8CE 1LWUC 3L70E 1SQXG 2K9JB 3L73J 2WT7B 3D6YA 1JTHA 3H1LE 1KYOD 1PIXA 5C39A 1AFOA 1HGZA 3F5HA 4Y99C 1N7SD 3A2AA 1RY3A 2Q6QA 3EFFK 3KXDA 3R2PA 4KT0J 5AVQB 1VQOP 1PL5A 3V2PA 1PPJD 2W83C 3SWFA 4HB1A 3IF4A 1L0LJ 2P2UA 3GW6A 4H13C 1ZR4A 2IZ1A 4W7YA 1KV4A 3K5BA 2FY8A 3G71P 1VQ8P 2O01H 3VMAA 1YJNP 3L35A 1USDA 3L72J 3CC7P 2QM8A 2SPZA 2YNYA 1NTME 1Q81Q 1JY2N 2YKPA 5KAIH 3V2QA 1SFCB 3GLMA 3IR9A 5KAFH 3B8EB 2PAJA 3MUDA 4OGQB 4C7NA 4ZKPA 1H88A 2BCCE 2LXCB 1NWQA 3HD7C 1FZGA 1NU1J 5B5EH 1R5LA 3H1KG 3H6PA 3MUDC 3P8CD 1A02J 1U7MA 1L4AB 3GHGA 3BASA 2YO3A 4XFJA 1RE3C 1SQBD 3KYQA 2Y0DA 3L71E 3HD7B 4HH2A 3AEGC 3TYYA 3V2RA 1KILD 3L4FA 2IX7C 3SFEC 4OGQC 1NVOA 5KLVE 1OIPA 1EDLA 1XTCC 5CJ0A 2ZXXA 1MFTA 1SFCC 2QIWA 4C7RA 1JTHB 4H44D 1KQSO 2Y9ZA 1NAFA 1BSHA 2OQQA 2ZJSE 1YJ9P 1VF5D 1SQBG 2IZ0A 4UB8H 1TU3F 5BU5A 1PP9D 5L8RJ 5KKZC 4KJMA 2KK7A 2N1TB 2Q1KA 4I6MC 1SQPJ 3CXHH 1PGOA 1NTKJ 3PP5A 4AYCA 3V5BA 1KYOE 3RK2B 3RK3E 3H1ID 2QJKC 1MUUA 1LTBC 1SQVE 2R44A 2H89C 2FXOA 2Q3EA 3VMYA 2E42A 1N7SB 3RK3C 1LWUA 2JP3A 3AEDC 1VQLP 1EC5A 1AA0A 2M3BA 4QMAA 1ZLLA 1SQBE 2ITAA 1Y8AA 2QJPC 2Y9YA 1LTJC 4K35A 1YIJP 2Z4EA 2E76C 2OARA 1H0TB 2FBWC 1SQPD 2W27A 1PGQA 1RF1C 1YBKA 1M1JA 2HG5D 2Z5IA 4Y28J 1QL2A 5CBNA 1L0LE 3B5NC 3HE5A 1RE4C 1YQ4C 1S1CX 3H1JE 4U3FG 3CX5D 3NXSA 1PP9E 4NPEA 1M1JC 1KB9H 2H88C 2M0BA 2AXTE 2PP6A 3FGAD 4UB6H 4YPCA 3RL0C 1RE4A 1QL1A 3PTZA 2KYVA 1JMBA 2XZRA 3P32A 4JYBA 2AEFA 4MN4C 4PV1C 3RBZA 1NAYA 1SLQA 1SQVK 2FXPA 1N86A 3L73E 4NPDA 3L74J 2OTLP 1EXJA 1S2EA 1X9VA 4JYCA 3CXHI 1LTGC 3NFQA 4RKUJ 1S5LE 3UIAA 3PRJA 1Q2NA 1S4XA 5GTIH 2A06D 1IZNB 1IK7A 3C1LA 3MHVA 3S4RA 3H1HG 1OVUA 4GT1A 4WY4B 5AW7B 2IBZI 1N73C 1LTJB 1QX8A 2A45G 2GM4A 3D71A 1K9MQ 2PFXA 2OTKE 1U57A 1BGYJ 1DH3A 1L0LK 2L91A 3L74E 1AQTA 3AEEC 1M8OB 5AVSB 1N73B 1BE3G 2W6AA 3CCUP 1S5LX 2H7HA 1VQ6P 1SQPK 1MZ9A 1PGPA 1JY3P 2FYUD 4RESB 2WITA 5KJ7C 1VQ9P 1FJKA 2OYIC 4GOEA 3BCCJ 3WUTA 2FYNC 2IBZG 4WWIA 3CCSP 1QVFO 1VQKP 1CSBA 1JCCA 4EIJA 4M3LA 3RK2D 3G3ZA 2DW3A 4H0LC 4I7ZC 5B5EE 2E74C 1G2CA 3RGUA 1G1JA 1SQXK 3CMAP 3AE1C 2BEZF 2E74B 1K8AQ 1GZLA 1P84H 1DD3A 1ZN5A 2BASA 3C8VA 5H2FE 1BCCE 5TISH 2XV5A 1SQBJ 2WPQA 3H1KE 4D6TG 2HODA 1SQVG 1NTZG 1R5SA 1ZMEC 2ZXEB 4U7JA 2WSEH 4HJGH 4YTPC 3BCCD 1SQVJ 3H1JD 3QWOC 3VOPA 1NTKG 3I5CA 1OW6A 4B86A 2QJPB 1HH0A 2JKVA 1GTWA 3AE8C 2IYPA 2ZT9D 1SQQJ 1NTZD 3A5TA 1M1KQ 5AW9B 3T97B 5GTHH 5CHXA 2AEMA 2N9BA 2ZYGA 1QVGO 1KFNA 1L0LG 1RHZB 1X8YA 4H0LD 1GU4A 1NTKD 3BRVB 3M9BA 3U59A 3L36A 3AEBC 3JSVC 5CBOA 2QM7A 3EFGA 3H1IJ 1LT9B 3A7OA 3EQ2A 1VQ7P 1IFNA 1X79B 5APYA 1YI2P 1IC2A 1DD4A 2E5TA 2QJKB 3OA7A 3Q5RA 1KC8Q 3AE3C 3VP8A 1KB9E 4JPZB 3A0HE 4N78D 4IFFA 1BE3E 2GA1A 1HJBA 1BCCD 2R5BA 2CPSA 3L71J 3N7NA 4A7PA 2B87A 1VDFA 1L2PA 2KIKA 1L0NE 3L75E 5KLVK 1H0TA 1RQVA 1VQPP 3FX0A 5APUA 1PPJE 2R3SA 1GL2C 4L74A 4XE5B 2W6JH 4DOJA 5CCHD 3CC4P 1G1IA 3A3YB 1N7LA 4PJ0H 3S1KA 2WZ7A 2HPCB 2P7JA 2QJYC 1BDCA 2AXTH 3Q3DA 1ZR2A 1YTZT 2KZIA 1E5WA 1ZP0C 1GL2A 2KS1A 3B5NB 2NPSD 4R4MA 3Q5PA 3V6IA 1NTMJ 3PHLA 4ZMDA 2D2CB 2WPVB 3RK3B 4EI2A 2L5GB 2QEXP 1URQA 3HTKB 4OH8B 2KI7B 1PGJA 4PD4I 3L74D 4BWNA 1KYOI 3AE2C 3BVHA 3HD7D 1Y9BA 2E5YA 3CWBJ 1URQC 4PD4D 1VQ5P 1H89A 2HFED 1FDMA 1EZVI 1M57D 2K1AA 4BRYB 3BCCG 2YKOA 5APSA 1JY3N 2Q5UA 3LIDA 1BE3D 2WSEJ 3I56P 1VPCA 3H25A 4YXDC 2WMMA 5BVZA 1GL2D 1OW7A 1T8ZA 2WPSA 3N4XA 2OYHB 1FDIA 5CCHC 1HBWA 2UWJE 3L75D 2QRXA 3CI9A 3L70J 2HYNA 1FE6A 3RL0B 2ZAEB 1GDTA 1EDKA 4JQ0D 4H44C 5KLVD 2GUVA 1KFMA 2N1TC 3HD7A 5AVRB 2NPSC 1MKMA 1JOCA 3OJAB 1EZVG 1NTMK 1OVRA 1NH4A 1OWAA 1P84D 2FYUJ 1NJIQ 1M1JB 1T2KC 1EDIA 2XU6A 4H0LB 4I7ZB 5AVTB 2YKQA 1HVVA 2ZFCA 5APWA 5CCGA 2BEQD 2D2CC 1YQ3C 2E76B 5APTA 2O1KA 2FYNB 4D6TJ 1Q82Q 1YTZI 3OAKA 3CCJP 1BDDA 3HUSC 3CXHD 3AE6C 2J59M 2JDIH 4W80A 2C0WA 5APQA 5CCGC 3VTPC 1JY2O 4IL6X 2K9JA 5AW8B 3WUVA 1JY2P 2C9NY 1LWUB 2J5UA 3L72D 5TJHA 2QG4A 3HUSA 4CPGA 3H1JG 4U3FE 3S9OA 3SFDC 5K5GB 3Q1MA 1ZXGA 3FWNA 1X22A 2ZT9C 5H2FH 3II6A 2YMYA 3NTNA 1BSNA 2KNCA 1HWTC 1HGVA 2B89A 1L4AA 2QE7H 1YYCA 1FAVA 3MIWA 4U3FJ 4ASVA 1S3JA 3B4SA 3RL0g 4OWFA 2RH0A 2IPPA 1NKZB 1JMMA 2QA4P 3CWBE 2VRSA 2LR2A 4OGQD 1T2KD 4Z1MH 1NU1D 3WMM0 3A0BH 2WVRA 3B5ND 1KB9D 3CCLP 1LGHB 1YITP 4N78E 1JM0A 4PV1B 2KSJA 3FXEA 1M56D 5EFWB 1FZBA 1SVFA 2JR8A 2KP8A 3W67A 3U1CA 1L4AD 2WT7A 2KUBA 1JUNA 1KILE 1IFMA 4K3AA 1NU1K 5DJUB 5M1BA 1HTLC 3A0BE 4ZNCA 1WRGA 2W90A 3GF3A 5APVA 5AVYB 1ZRTD 3WU2H 2B9BA 3E1RA 4LC1A 2PRRA 2JWAA 2JWDA 3RBXA 3AE7C 3TGUE 5AVXB 2YXRB 5KLIB 3FXDA 3O6QB 2A45H 2KZJA 1NTMG 2R5DA 3IAOA 4IL6H 2IFMA 4RO0A 1GMJA 5E79E 1EQ7A 5AVVB 1S5LH 1OFCX 4EDFA 3H1HD 3IFMA 1JEKA 3TSIA 2OYHA 1E79H 2J58A 1GW3A 2E75B 2POHA 5TISE 1ZW0A 1ZOYC 1P84E 2WWWA 3H1IG 3KHUA 2IFNA 5CCHA 4IOIH 4UB6E 2OYHC 2WSFH 5BU8B 1PZQA 4R4LA 2XDJA 2KLVA 1KQGB 1NHLA 1QGKB 2NPSA 1NTMD 1IJDB 3B71A 4H13B 2KXPB 2BCCG 3L73D 2BCCJ 3M9HA 1URQB 2KLUA 3AEAC 2K9YA 2AEJA 3CCQP 2QVAA 2WSCH 2KS1B 1EXIA 1LT9C 2NRGA 2M5AB 1FBMA 1JB0J 3OW2O 1QLED 1J1EC 1WT6A 2E75C 3D6ZA 3C9IA 2V7QJ 3CWBG 5KJ7A 1GK6A 3CCVP 1S9KE 2IDBA 3LW5J 3CX5E 1FZCA 4YXWH 1BE3J 1MFZA 1JCDA 2H43A 1FS0E 1T3UA 3KZIH 4BXLA 1VQNP 1LTAC 1L0NK 1J1DB 1KMIZ 1N2DC 4O9BA 4AQRD 1AQ5A 1JY3O 2ZT9B 2H8PD 3SWYA 5CMZA 1FZCC 3ITKA 3CLQA 5GTIE 1EDJA 1S9KD 2O3JA 2KNCB 3L37A 5AVWB 1OXZA 3M9QA 2OYOA 1N8RQ 3H32A 4PV1D 1LP1A 2A06E 1OX3A 3HUSB 1ZRTE 3EWKA 3CL3D 3P8MC 1NGMB 3GG2A 1KTMA 5KLVG 2YIUB 3ABVC 1J1EB 4D6TD 4WY4D 1R8EA 4BRYA 4JF7A 1KQFB 1LTIC 2CPBA 2HLOA 2HR3A 3O8ZA 5AW5B 5B66E 3WUUA 1VQMP 1VF5C 1SQBK 3V4WA 1IFPA 4H44B 2O01J 2M3EA 2O1JA 2WTYA 3HTKA 2FFDC 3U1AA 4D6TE 1WMKA 3TGUJ 1FU1A 1CZQA 4HYTB 2I8DA 1CI6A 4I1LA 2IBZD 2G3AA 1YJWP 3AEFC 4L75A 1RF1A 1UIIA 1DEBA 1SQXD 2FFDA 1AV1A
chains in the Genus database with same CATH topology
2KLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLU A; 
#chains in the Genus database with same CATH topology
 1N7S C;  3B5N A;  2AXC A;  2HOD B;  2WSF J;  3AE9 C;  1PP9 G;  1PP9 J;  2C0X A;  5DJT B;  5KAF E;  5KTB A;  2ZYD A;  3V2N A;  3TF5 A;  2LXB A;  1OMI A;  4GDO A;  3RK2 C;  3RK3 D;  1RH5 B;  4H13 D;  2E74 D;  3IN6 A;  1SQX E;  3SWK A;  4WY4 C;  2Q7C A;  3JCU E;  4WBA A;  1SQV D;  2B87 B;  1X0T A;  2P67 A;  2QSI A;  1JNM A;  1NYH A;  2FYZ A;  3H1L G;  2ZVO B;  3HE4 A;  1AVO A;  2WSC J;  1NOH A;  3L74 G;  2FYU G;  3CX5 H;  1RE3 A;  3H1J J;  4N3Y B;  1A02 F;  1NTZ J;  3FWL A;  1FDO A;  1RQU A;  1SQX J;  3G9R A;  4DZO A;  1Z56 A;  1LT1 A;  1PFI A;  3AEC C;  1LT9 A;  1GL2 B;  1N73 A;  1SQQ D;  1HF9 A;  1CW5 A;  1NTK K;  1LNQ A;  3RL0 D;  2IYO A;  2HPC A;  1KD1 Q;  1KIL A;  3KDP B;  1IFD A;  2OGU A;  3VMZ A;  1USE A;  2NZ2 A;  3MZW B;  5GTH E;  4W7Z A;  1ZV8 A;  1NTK E;  4ASW A;  2WQY C;  1PPJ G;  3T97 A;  3HE4 B;  1G2C B;  3TNU A;  5AVZ B;  4EYY Q;  2OYI B;  1KIL C;  2K88 A;  1T6A A;  3VP9 A;  1GK4 A;  2RN0 A;  3TNU B;  1J1D C;  1M90 Q;  2OYI A;  3TK1 A;  3E7K A;  2Q3I A;  5AW3 B;  2FYU E;  2C9L Y;  2YMK A;  2MKV A;  1KIL B;  3G4S P;  3USS A;  5KAI E;  1NU1 G;  5AW1 B;  1BGY G;  1AVY A;  2Y0C A;  1T3J A;  1GW4 A;  1KN7 A;  2A06 G;  3CCM P;  1KQL A;  1L0N D;  1SQQ K;  1DEE G;  3GMA A;  3NMD A;  4NPF X;  1UIX A;  4WB4 A;  4XA4 A;  5AW4 B;  5CCG D;  3D70 A;  1OZH A;  1VF5 B;  5CJ4 A;  1D7M A;  2FXM A;  1LTJ A;  2IBZ E;  2ZYA A;  1Y47 A;  2GUS A;  1HUC A;  1LJ2 A;  2KB7 P;  3H1I E;  3L72 G;  2JO1 A;  3M06 A;  4JBZ A;  4TLF A;  5KJ7 D;  1FZA A;  3H1K D;  3I55 P;  1FJP A;  1YHQ P;  2XND H;  1BGY D;  1FZE A;  3BAT A;  1NKN A;  4GOD A;  3JCU H;  1GD2 E;  2W8Z A;  2FKW B;  1OW8 A;  2G8Y A;  1NO4 A;  3P7K A;  2FYU K;  2R32 A;  1N7S A;  1L0N J;  3HRN A;  2E76 D;  3TDK A;  2N9Y B;  1SP4 A;  3TGU G;  1DX7 A;  1L0L D;  5AW2 B;  2KOG A;  1DIP A;  3L75 G;  3L70 D;  3CD6 P;  3AE4 C;  5AW6 B;  1L4A C;  3H1K J;  3VN0 A;  1H8A A;  4WY4 A;  4RJT A;  1IFI A;  1SS1 A;  2RMZ A;  3L72 E;  3BRT B;  3LIE A;  4TT3 H;  4AUW A;  3L75 J;  2OTJ P;  3M0D A;  1SQQ G;  4DCK A;  1K73 Q;  1JO5 A;  3JC2 2;  3KPE A;  2JEE A;  4L73 A;  3MTU E;  2YO2 A;  4PD4 H;  5KLV J;  1OVV A;  3M0A A;  2E43 A;  4L76 A;  3ZDM A;  1EZV D;  2LKM A;  3PJS K;  3TGU D;  2P1J A;  4GOF A;  1IFJ A;  1Q86 Q;  1VQ4 P;  3CPW O;  2P10 A;  1KZU B;  3MP7 B;  5APX A;  3QH9 A;  3KQG A;  5AW0 B;  3CX5 I;  2QJY B;  4GKG A;  3H32 B;  4C46 A;  1S72 P;  2CK3 H;  2FFD B;  2YIU C;  1NU1 E;  2Z5H A;  3L71 G;  4PJ0 E;  1FOS E;  3GF7 A;  1M7L A;  3HE5 B;  4WVZ A;  4LGD E;  1FZF A;  1W2E A;  2Y0E A;  3W68 A;  5B66 H;  4I2L C;  3CCR P;  1SQQ E;  4U3F D;  1QEX A;  1RF0 A;  1L0N G;  3A0H H;  3E1I A;  3CCE P;  4ZKU A;  3KZI E;  2PGD A;  3MD0 A;  2I1K A;  1NTZ K;  2RKL A;  4DT0 A;  1Q90 D;  4UB8 E;  1KB9 I;  2ZVN B;  3CC2 P;  1BCC G;  1RF0 C;  2MJZ A;  3AE5 C;  2M5A A;  3L71 D;  4KHX A;  1W5C E;  1XTG B;  1NTZ E;  2K3R A;  3F89 A;  1KYO H;  1BCC J;  1LTS C;  1SFC D;  1IK9 A;  3O6Q A;  3VYI A;  2E75 D;  2M8R A;  1CI6 B;  3CXH E;  4GIF A;  5KLI C;  1RF1 B;  4IFD K;  1HJ0 A;  1VL2 A;  2I1J A;  1IO4 A;  4HKZ H;  2A45 I;  1KOR A;  3GHG C;  1U7J A;  3PLN A;  2KSE A;  2NPS B;  2XNX A;  3H1L J;  2N1T A;  3CME P;  1SQP G;  2JJL A;  1MV8 A;  5AVU B;  3BCC E;  1URQ D;  1SFC A;  2K37 A;  3V4Q A;  3L70 G;  3Q2Y A;  3M91 A;  1FOS F;  1W2B O;  4DJG A;  2O01 N;  4Y99 B;  4OVN F;  3Q5S A;  1Q7Y Q;  3R4Y A;  4IFM A;  2W6B A;  1LP1 B;  1LTT C;  3CWB D;  3PH0 A;  4N6J A;  4PD4 E;  1BGY E;  2Q9I A;  3H1H J;  2XKM A;  2YXQ B;  3H1H E;  1PV3 A;  2V7Q H;  1AJY A;  1P84 I;  5E79 H;  4IL6 E;  3LW5 H;  1EZV E;  3GHG B;  5KKZ B;  1K05 A;  1K04 A;  3H1L D;  3G6E P;  4EOT A;  2N1T D;  3VMX A;  2B88 A;  2V4H A;  3M0D C;  2R3C A;  1GU5 A;  1J2J B;  2BCC D;  3L73 G;  3SSU A;  3WU2 E;  4C7N B;  3MGN A;  2WSS H;  2P58 A;  1SQP E;  1FZC B;  1FC2 C;  2D2C D;  4LLH A;  2WPR A;  3P8C E;  1LWU C;  3L70 E;  1SQX G;  2K9J B;  3L73 J;  2WT7 B;  3D6Y A;  1JTH A;  3H1L E;  1KYO D;  1PIX A;  5C39 A;  1AFO A;  1HGZ A;  3F5H A;  4Y99 C;  1N7S D;  3A2A A;  1RY3 A;  2Q6Q A;  3EFF K;  3KXD A;  3R2P A;  4KT0 J;  5AVQ B;  1VQO P;  1PL5 A;  3V2P A;  1PPJ D;  2W83 C;  3SWF A;  4HB1 A;  3IF4 A;  1L0L J;  2P2U A;  3GW6 A;  4H13 C;  1ZR4 A;  2IZ1 A;  4W7Y A;  1KV4 A;  3K5B A;  2FY8 A;  3G71 P;  1VQ8 P;  2O01 H;  3VMA A;  1YJN P;  3L35 A;  1USD A;  3L72 J;  3CC7 P;  2QM8 A;  2SPZ A;  2YNY A;  1NTM E;  1Q81 Q;  1JY2 N;  2YKP A;  5KAI H;  3V2Q A;  1SFC B;  3GLM A;  3IR9 A;  5KAF H;  3B8E B;  2PAJ A;  3MUD A;  4OGQ B;  4C7N A;  4ZKP A;  1H88 A;  2BCC E;  2LXC B;  1NWQ A;  3HD7 C;  1FZG A;  1NU1 J;  5B5E H;  1R5L A;  3H1K G;  3H6P A;  3MUD C;  3P8C D;  1A02 J;  1U7M A;  1L4A B;  3GHG A;  3BAS A;  2YO3 A;  4XFJ A;  1RE3 C;  1SQB D;  3KYQ A;  2Y0D A;  3L71 E;  3HD7 B;  4HH2 A;  3AEG C;  3TYY A;  3V2R A;  1KIL D;  3L4F A;  2IX7 C;  3SFE C;  4OGQ C;  1NVO A;  5KLV E;  1OIP A;  1EDL A;  1XTC C;  5CJ0 A;  2ZXX A;  1MFT A;  1SFC C;  2QIW A;  4C7R A;  1JTH B;  4H44 D;  1KQS O;  2Y9Z A;  1NAF A;  1BSH A;  2OQQ A;  2ZJS E;  1YJ9 P;  1VF5 D;  1SQB G;  2IZ0 A;  4UB8 H;  1TU3 F;  5BU5 A;  1PP9 D;  5L8R J;  5KKZ C;  4KJM A;  2KK7 A;  2N1T B;  2Q1K A;  4I6M C;  1SQP J;  3CXH H;  1PGO A;  1NTK J;  3PP5 A;  4AYC A;  3V5B A;  1KYO E;  3RK2 B;  3RK3 E;  3H1I D;  2QJK C;  1MUU A;  1LTB C;  1SQV E;  2R44 A;  2H89 C;  2FXO A;  2Q3E A;  3VMY A;  2E42 A;  1N7S B;  3RK3 C;  1LWU A;  2JP3 A;  3AED C;  1VQL P;  1EC5 A;  1AA0 A;  2M3B A;  4QMA A;  1ZLL A;  1SQB E;  2ITA A;  1Y8A A;  2QJP C;  2Y9Y A;  1LTJ C;  4K35 A;  1YIJ P;  2Z4E A;  2E76 C;  2OAR A;  1H0T B;  2FBW C;  1SQP D;  2W27 A;  1PGQ A;  1RF1 C;  1YBK A;  1M1J A;  2HG5 D;  2Z5I A;  4Y28 J;  1QL2 A;  5CBN A;  1L0L E;  3B5N C;  3HE5 A;  1RE4 C;  1YQ4 C;  1S1C X;  3H1J E;  4U3F G;  3CX5 D;  3NXS A;  1PP9 E;  4NPE A;  1M1J C;  1KB9 H;  2H88 C;  2M0B A;  2AXT E;  2PP6 A;  3FGA D;  4UB6 H;  4YPC A;  3RL0 C;  1RE4 A;  1QL1 A;  3PTZ A;  2KYV A;  1JMB A;  2XZR A;  3P32 A;  4JYB A;  2AEF A;  4MN4 C;  4PV1 C;  3RBZ A;  1NAY A;  1SLQ A;  1SQV K;  2FXP A;  1N86 A;  3L73 E;  4NPD A;  3L74 J;  2OTL P;  1EXJ A;  1S2E A;  1X9V A;  4JYC A;  3CXH I;  1LTG C;  3NFQ A;  4RKU J;  1S5L E;  3UIA A;  3PRJ A;  1Q2N A;  1S4X A;  5GTI H;  2A06 D;  1IZN B;  1IK7 A;  3C1L A;  3MHV A;  3S4R A;  3H1H G;  1OVU A;  4GT1 A;  4WY4 B;  5AW7 B;  2IBZ I;  1N73 C;  1LTJ B;  1QX8 A;  2A45 G;  2GM4 A;  3D71 A;  1K9M Q;  2PFX A;  2OTK E;  1U57 A;  1BGY J;  1DH3 A;  1L0L K;  2L91 A;  3L74 E;  1AQT A;  3AEE C;  1M8O B;  5AVS B;  1N73 B;  1BE3 G;  2W6A A;  3CCU P;  1S5L X;  2H7H A;  1VQ6 P;  1SQP K;  1MZ9 A;  1PGP A;  1JY3 P;  2FYU D;  4RES B;  2WIT A;  5KJ7 C;  1VQ9 P;  1FJK A;  2OYI C;  4GOE A;  3BCC J;  3WUT A;  2FYN C;  2IBZ G;  4WWI A;  3CCS P;  1QVF O;  1VQK P;  1CSB A;  1JCC A;  4EIJ A;  4M3L A;  3RK2 D;  3G3Z A;  2DW3 A;  4H0L C;  4I7Z C;  5B5E E;  2E74 C;  1G2C A;  3RGU A;  1G1J A;  1SQX K;  3CMA P;  3AE1 C;  2BEZ F;  2E74 B;  1K8A Q;  1GZL A;  1P84 H;  1DD3 A;  1ZN5 A;  2BAS A;  3C8V A;  5H2F E;  1BCC E;  5TIS H;  2XV5 A;  1SQB J;  2WPQ A;  3H1K E;  4D6T G;  2HOD A;  1SQV G;  1NTZ G;  1R5S A;  1ZME C;  2ZXE B;  4U7J A;  2WSE H;  4HJG H;  4YTP C;  3BCC D;  1SQV J;  3H1J D;  3QWO C;  3VOP A;  1NTK G;  3I5C A;  1OW6 A;  4B86 A;  2QJP B;  1HH0 A;  2JKV A;  1GTW A;  3AE8 C;  2IYP A;  2ZT9 D;  1SQQ J;  1NTZ D;  3A5T A;  1M1K Q;  5AW9 B;  3T97 B;  5GTH H;  5CHX A;  2AEM A;  2N9B A;  2ZYG A;  1QVG O;  1KFN A;  1L0L G;  1RHZ B;  1X8Y A;  4H0L D;  1GU4 A;  1NTK D;  3BRV B;  3M9B A;  3U59 A;  3L36 A;  3AEB C;  3JSV C;  5CBO A;  2QM7 A;  3EFG A;  3H1I J;  1LT9 B;  3A7O A;  3EQ2 A;  1VQ7 P;  1IFN A;  1X79 B;  5APY A;  1YI2 P;  1IC2 A;  1DD4 A;  2E5T A;  2QJK B;  3OA7 A;  3Q5R A;  1KC8 Q;  3AE3 C;  3VP8 A;  1KB9 E;  4JPZ B;  3A0H E;  4N78 D;  4IFF A;  1BE3 E;  2GA1 A;  1HJB A;  1BCC D;  2R5B A;  2CPS A;  3L71 J;  3N7N A;  4A7P A;  2B87 A;  1VDF A;  1L2P A;  2KIK A;  1L0N E;  3L75 E;  5KLV K;  1H0T A;  1RQV A;  1VQP P;  3FX0 A;  5APU A;  1PPJ E;  2R3S A;  1GL2 C;  4L74 A;  4XE5 B;  2W6J H;  4DOJ A;  5CCH D;  3CC4 P;  1G1I A;  3A3Y B;  1N7L A;  4PJ0 H;  3S1K A;  2WZ7 A;  2HPC B;  2P7J A;  2QJY C;  1BDC A;  2AXT H;  3Q3D A;  1ZR2 A;  1YTZ T;  2KZI A;  1E5W A;  1ZP0 C;  1GL2 A;  2KS1 A;  3B5N B;  2NPS D;  4R4M A;  3Q5P A;  3V6I A;  1NTM J;  3PHL A;  4ZMD A;  2D2C B;  2WPV B;  3RK3 B;  4EI2 A;  2L5G B;  2QEX P;  1URQ A;  3HTK B;  4OH8 B;  2KI7 B;  1PGJ A;  4PD4 I;  3L74 D;  4BWN A;  1KYO I;  3AE2 C;  3BVH A;  3HD7 D;  1Y9B A;  2E5Y A;  3CWB J;  1URQ C;  4PD4 D;  1VQ5 P;  1H89 A;  2HFE D;  1FDM A;  1EZV I;  1M57 D;  2K1A A;  4BRY B;  3BCC G;  2YKO A;  5APS A;  1JY3 N;  2Q5U A;  3LID A;  1BE3 D;  2WSE J;  3I56 P;  1VPC A;  3H25 A;  4YXD C;  2WMM A;  5BVZ A;  1GL2 D;  1OW7 A;  1T8Z A;  2WPS A;  3N4X A;  2OYH B;  1FDI A;  5CCH C;  1HBW A;  2UWJ E;  3L75 D;  2QRX A;  3CI9 A;  3L70 J;  2HYN A;  1FE6 A;  3RL0 B;  2ZAE B;  1GDT A;  1EDK A;  4JQ0 D;  4H44 C;  5KLV D;  2GUV A;  1KFM A;  2N1T C;  3HD7 A;  5AVR B;  2NPS C;  1MKM A;  1JOC A;  3OJA B;  1EZV G;  1NTM K;  1OVR A;  1NH4 A;  1OWA A;  1P84 D;  2FYU J;  1NJI Q;  1M1J B;  1T2K C;  1EDI A;  2XU6 A;  4H0L B;  4I7Z B;  5AVT B;  2YKQ A;  1HVV A;  2ZFC A;  5APW A;  5CCG A;  2BEQ D;  2D2C C;  1YQ3 C;  2E76 B;  5APT A;  2O1K A;  2FYN B;  4D6T J;  1Q82 Q;  1YTZ I;  3OAK A;  3CCJ P;  1BDD A;  3HUS C;  3CXH D;  3AE6 C;  2J59 M;  2JDI H;  4W80 A;  2C0W A;  5APQ A;  5CCG C;  3VTP C;  1JY2 O;  4IL6 X;  2K9J A;  5AW8 B;  3WUV A;  1JY2 P;  2C9N Y;  1LWU B;  2J5U A;  3L72 D;  5TJH A;  2QG4 A;  3HUS A;  4CPG A;  3H1J G;  4U3F E;  3S9O A;  3SFD C;  5K5G B;  3Q1M A;  1ZXG A;  3FWN A;  1X22 A;  2ZT9 C;  5H2F H;  3II6 A;  2YMY A;  3NTN A;  1BSN A;  2KNC A;  1HWT C;  1HGV A;  2B89 A;  1L4A A;  2QE7 H;  1YYC A;  1FAV A;  3MIW A;  4U3F J;  4ASV A;  1S3J A;  3B4S A;  3RL0 g;  4OWF A;  2RH0 A;  2IPP A;  1NKZ B;  1JMM A;  2QA4 P;  3CWB E;  2VRS A;  2LR2 A;  4OGQ D;  1T2K D;  4Z1M H;  1NU1 D;  3WMM 0;  3A0B H;  2WVR A;  3B5N D;  1KB9 D;  3CCL P;  1LGH B;  1YIT P;  4N78 E;  1JM0 A;  4PV1 B;  2KSJ A;  3FXE A;  1M56 D;  5EFW B;  1FZB A;  1SVF A;  2JR8 A;  2KP8 A;  3W67 A;  3U1C A;  1L4A D;  2WT7 A;  2KUB A;  1JUN A;  1KIL E;  1IFM A;  4K3A A;  1NU1 K;  5DJU B;  5M1B A;  1HTL C;  3A0B E;  4ZNC A;  1WRG A;  2W90 A;  3GF3 A;  5APV A;  5AVY B;  1ZRT D;  3WU2 H;  2B9B A;  3E1R A;  4LC1 A;  2PRR A;  2JWA A;  2JWD A;  3RBX A;  3AE7 C;  3TGU E;  5AVX B;  2YXR B;  5KLI B;  3FXD A;  3O6Q B;  2A45 H;  2KZJ A;  1NTM G;  2R5D A;  3IAO A;  4IL6 H;  2IFM A;  4RO0 A;  1GMJ A;  5E79 E;  1EQ7 A;  5AVV B;  1S5L H;  1OFC X;  4EDF A;  3H1H D;  3IFM A;  1JEK A;  3TSI A;  2OYH A;  1E79 H;  2J58 A;  1GW3 A;  2E75 B;  2POH A;  5TIS E;  1ZW0 A;  1ZOY C;  1P84 E;  2WWW A;  3H1I G;  3KHU A;  2IFN A;  5CCH A;  4IOI H;  4UB6 E;  2OYH C;  2WSF H;  5BU8 B;  1PZQ A;  4R4L A;  2XDJ A;  2KLV A;  1KQG B;  1NHL A;  1QGK B;  2NPS A;  1NTM D;  1IJD B;  3B71 A;  4H13 B;  2KXP B;  2BCC G;  3L73 D;  2BCC J;  3M9H A;  1URQ B;  2KLU A;  3AEA C;  2K9Y A;  2AEJ A;  3CCQ P;  2QVA A;  2WSC H;  2KS1 B;  1EXI A;  1LT9 C;  2NRG A;  2M5A B;  1FBM A;  1JB0 J;  3OW2 O;  1QLE D;  1J1E C;  1WT6 A;  2E75 C;  3D6Z A;  3C9I A;  2V7Q J;  3CWB G;  5KJ7 A;  1GK6 A;  3CCV P;  1S9K E;  2IDB A;  3LW5 J;  3CX5 E;  1FZC A;  4YXW H;  1BE3 J;  1MFZ A;  1JCD A;  2H43 A;  1FS0 E;  1T3U A;  3KZI H;  4BXL A;  1VQN P;  1LTA C;  1L0N K;  1J1D B;  1KMI Z;  1N2D C;  4O9B A;  4AQR D;  1AQ5 A;  1JY3 O;  2ZT9 B;  2H8P D;  3SWY A;  5CMZ A;  1FZC C;  3ITK A;  3CLQ A;  5GTI E;  1EDJ A;  1S9K D;  2O3J A;  2KNC B;  3L37 A;  5AVW B;  1OXZ A;  3M9Q A;  2OYO A;  1N8R Q;  3H32 A;  4PV1 D;  1LP1 A;  2A06 E;  1OX3 A;  3HUS B;  1ZRT E;  3EWK A;  3CL3 D;  3P8M C;  1NGM B;  3GG2 A;  1KTM A;  5KLV G;  2YIU B;  3ABV C;  1J1E B;  4D6T D;  4WY4 D;  1R8E A;  4BRY A;  4JF7 A;  1KQF B;  1LTI C;  2CPB A;  2HLO A;  2HR3 A;  3O8Z A;  5AW5 B;  5B66 E;  3WUU A;  1VQM P;  1VF5 C;  1SQB K;  3V4W A;  1IFP A;  4H44 B;  2O01 J;  2M3E A;  2O1J A;  2WTY A;  3HTK A;  2FFD C;  3U1A A;  4D6T E;  1WMK A;  3TGU J;  1FU1 A;  1CZQ A;  4HYT B;  2I8D A;  1CI6 A;  4I1L A;  2IBZ D;  2G3A A;  1YJW P;  3AEF C;  4L75 A;  1RF1 A;  1UII A;  1DEB A;  1SQX D;  2FFD A;  1AV1 A; 
#chains in the Genus database with same CATH homology
 2KLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...