2KLVA

Membrane-bound structure of the pf1 major coat protein in dhpc micelle
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phage-induced alignment of membrane proteins enables the measurement and structural analysis of residual dipolar couplings with dipolar waves and lambda-maps.
pubmed doi rcsb
source organism Pseudomonas phage pf1
molecule tags Membrane protein
molecule keywords Capsid protein G8P
total genus 12
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2009-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2klvA00
2IFNA 2XKMA 1PFIA 3IFMA 4IFMA 1QL1A 2KSJA 1QL2A 1ZN5A 2IFMA 1IFNA 1IFMA 2KLVA
chains in the Genus database with same CATH superfamily
1AV1A 5GTIE 1SFCA 4N78E 1SQBK 1QLED 1SQVD 3Q5SA 1J1DC 1PZQA 1QL2A 3EFGA 3IN6A 1IK7A 3KHUA 3KZIH 3U59A 4WY4C 1VL2A 1FZCA 2OYIB 4PV1D 1LT9A 1XTGB 4U3FJ 3B5NA 5APVA 1G2CB 1LTJC 2WT7A 2ITAA 5CCGA 3L73J 3HUSB 4RO0A 1PGPA 4OH8B 1JM0A 2OQQA 1FJPA 2XU6A 5TISE 1EC5A 2YXRB 2XV5A 1T2KC 1M1KQ 1PP9E 2W90A 1Y47A 1FZFA 4Y28J 5KKZC 2BEZF 3GMAA 1SQPG 3MUDA 2JWAA 1JY2N 4YXWH 3HTKB 4N6JA 1NTZG 2BEQD 1N7SA 2IBZE 2ZT9C 3FGAD 5DJTB 3S1KA 4JYCA 4AYCA 5CBNA 2D2CB 2IFMA 2NPSA 1J1EB 1SQBJ 2ZYDA 3HD7A 3P8CD 4IL6E 4B86A 1M1JC 2CPBA 2JP3A 2E76B 1LNQA 5KLVK 1CI6A 1NU1D 3AE5C 2PP6A 3B5NB 5KKZB 1LT9B 1PV3A 1X8YA 1KILD 1KD1Q 1BGYD 1KN7A 1L4AA 5KAFH 2A45H 1EXJA 1MUUA 4IFDK 1JUNA 1AVYA 3Q2YA 3H32A 3RBZA 2A06D 3T97A 3H1KJ 1HJBA 4UB6E 2YKPA 5EFWB 2AXTE 1SQQK 3LIEA 4M3LA 1LWUA 1GU5A 2OGUA 2XNDH 5KAIH 2GUVA 4K35A 4JYBA 3TGUG 1BCCE 1GW4A 2KS1B 3N4XA 4CPGA 2QVAA 1N8RQ 3GG2A 1QGKB 4DJGA 2JEEA 1J2JB 3WU2H 2PFXA 1FDMA 5B5EE 3L73D 1NU1G 1WRGA 2LKMA 3B71A 5AVVB 1BE3G 2I1JA 3AE4C 3BCCE 4BRYA 5CCGD 3KZIE 3L74J 1W2BO 1N7SC 5BVZA 1SS1A 4D6TE 1MZ9A 1NKNA 1IFNA 2FXOA 1RF0C 5CCHC 4GOEA 3I5CA 3B5NC 3Q1MA 1EZVG 1GU4A 2N9YB 2XKMA 1NU1K 2YMYA 4XA4A 1LJ2A 4HJGH 1D7MA 5E79E 2E43A 3E1IA 3W68A 1ZV8A 4KHXA 1FZBA 1G2CA 1P84I 1SQQJ 4PD4D 2HPCB 5B5EH 2KSEA 4PD4H 3D71A 3Q5PA 1PP9D 2QM7A 5AVUB 3OA7A 1VF5B 1Z56A 3IF4A 4PV1B 1FOSF 2GM4A 1KYOH 1Q2NA 1NVOA 3AE2C 4PJ0E 2V7QH 1A02F 5CBOA 2IBZD 4IFMA 2C0XA 3VOPA 1HGVA 1M8OB 4YTPC 3TDKA 2O1KA 3PLNA 2E5TA 2K3RA 2M3EA 1WMKA 1RQVA 3C1LA 1OVRA 3AE1C 1AFOA 3BVHA 3BRTB 2FFDA 3HRNA 3C9IA 3V2RA 1RF1C 4GIFA 1SQXE 3L70D 1BGYE 2NRGA 2O01H 2K9YA 3R4YA 2M3BA 2ZAEB 3AE6C 5DJUB 4L75A 1IO4A 2GUSA 1YTZI 2Q6QA 1SQBD 2A06E 2ZVOB 1GL2D 3HD7C 3Q5RA 1LTAC 1W5CE 1QVGO 4HH2A 3EWKA 3L71D 3KPEA 3RK2D 3HUSA 4XE5B 3S4RA 1H0TA 1M56D 2KLUA 3TYYA 4WBAA 2C9LY 1K04A 1R8EA 1EDJA 5M1BA 1IFJA 2YO3A 3L71G 1GTWA 1LT9C 3H1IJ 3JC22 4OGQC 3WU2E 4NPEA 1N86A 3L72G 2Y0EA 1HTLC 1M7LA 5APUA 3RK3B 1NWQA 1L0ND 1FDIA 5AVQB 1L0NJ 4C7NA 1YI2P 1HBWA 3BCCD 3JCUE 1H0TB 3BATA 4R4LA 1DEEG 1X0TA 5KAIE 2N1TC 1OWAA 2JO1A 4D6TD 3RL0C 2OYIA 5BU5A 1NTKE 4H0LB 2OYIC 2L5GB 2E76C 1ZRTD 1LWUC 3SWKA 4A7PA 2KSJA 4DOJA 1HGZA 2WZ7A 1SQXG 2I1KA 3AEFC 3MP7B 4PD4E 3V2PA 5KLVG 2RH0A 2J59M 3CCLP 4D6TG 1YJWP 2Q7CA 3CLQA 1YBKA 3L74D 1JY3O 2OARA 3F89A 2BCCJ 5APYA 3C8VA 1AJYA 5KJ7A 1URQC 1SQPK 2MKVA 1LTSC 2R5DA 2R3CA 2FFDC 1VQ8P 1K05A 3CC7P 3L70J 2QSIA 5KJ7D 1CSBA 2J58A 1PFIA 1FZEA 2WSEH 3H1JE 3VN0A 1FAVA 1S5LE 2LR2A 3L72D 5L8RJ 1M57D 1PGOA 1SQQD 3CWBG 3M0DA 1UIXA 2OTLP 4DCKA 1RE3C 1GMJA 3H6PA 1Q86Q 2CPSA 2KB7P 1KQGB 1LTJB 2O3JA 3H1HG 1IC2A 1NHLA 3M9BA 3RK2B 2Z4EA 2K88A 1ZOYC 3EQ2A 3FXEA 2KNCA 1HVVA 2KZIA 3AE8C 3M0AA 4GOFA 3H1HJ 4XFJA 1CI6B 4ZKUA 3RL0B 4I6MC 2YKQA 4DZOA 1Q82Q 1OZHA 2Z5IA 5AW3B 5AVTB 3CWBJ 1EZVE 1JOCA 4MN4C 2KLVA 5TISH 3D6ZA 3CCUP 1LT1A 1NTZJ 2QJPC 2AXCA 1SQPJ 3B4SA 4YPCA 1EZVI 2BASA 3QH9A 1IJDB 2ZYAA 1NO4A 1KFMA 2CK3H 2QJYC 4H0LD 5AW6B 2JR8A 4QMAA 5BU8B 1KQSO 4KJMA 1RF1B 1IFIA 2OTKE 4U3FD 5KLVJ 1NTME 1QL1A 1VF5C 1NH4A 2KIKA 3AEEC 3L4FA 4LC1A 3Q3DA 2POHA 2QJPB 4Y99B 1BCCG 3SWFA 1RHZB 2OYHB 2WPQA 1GL2A 3H1LG 3AEBC 4IL6H 4U3FG 4N78D 1AVOA 1P84E 1SVFA 4NPDA 1ZN5A 2KZJA 3SWYA 2WPRA 1VQ4P 2P2UA 2W6JH 2XNXA 5TJHA 1N73B 1YITP 4ZNCA 3RBXA 1OVUA 2C9NY 3CC4P 2ZYGA 2YO2A 1A02J 4L73A 1KC8Q 2IZ0A 3AE9C 3L70G 1T2KD 2ZJSE 4RKUJ 2P67A 1GDTA 3MHVA 2QG4A 2WITA 3H1IG 4ZMDA 1Q81Q 1T3UA 2BCCG 3EFFK 1JCDA 3U1AA 2G3AA 4H13C 1LTGC 1PP9J 2R44A 3HD7B 4BRYB 1FOSE 3GF3A 2ZT9D 3L75E 2H7HA 4PV1C 2KOGA 4WB4A 2IBZG 4RESB 1YHQP 3CWBD 1USDA 2PAJA 3PTZA 5GTHE 1VQ5P 3LW5J 1KTMA 3CCVP 1L0LD 3P8CE 3PP5A 5H2FH 4EYYQ 3VMAA 2QEXP 1SQVG 1J1EC 1KORA 1KZUB 4U7JA 1NU1E 1YTZT 1YYCA 3G6EP 1L0NG 3L37A 3CCJP 3MZWB 1DD3A 1BDDA 4PD4I 2P10A 4I7ZB 3L72J 2FYNC 2H88C 2VRSA 2WSFJ 3HE5B 1EZVD 1NKZB 2UWJE 2FYUJ 3MIWA 1R5SA 3LW5H 3L71J 3A0BE 5GTHH 1BDCA 4IFFA 2PGDA 1OW7A 2YMKA 2KNCB 1ZR2A 2R32A 1YQ3C 2H8PD 3HE4B 3AEAC 3VTPC 2IYPA 1EDIA 1KILC 1M90Q 3G3ZA 2E75C 1OIPA 1LTBC 1ZW0A 1L4AD 2FYUG 2FYNB 4U3FE 3V4QA 2OYHC 1JMBA 4OGQB 3KQGA 1G1JA 1DIPA 2GA1A 2FKWB 2H89C 3WUTA 4ZKPA 3FX0A 1VQKP 3TGUJ 4IL6X 2HODA 3FWNA 3L73E 1PPJG 3NTNA 4LGDE 3A0BH 4WWIA 1GL2C 3HD7D 5B66H 1SQVJ 1P84D 1Q90D 3B8EB 4YXDC 1E5WA 1JY3P 1VQOP 1GW3A 3L74G 1N2DC 1G1IA 2WWWA 2D2CD 2QJKC 1BE3J 5CCHA 1BSHA 1BE3D 2W83C 3AE3C 5KLVD 5K5GB 3D70A 2WT7B 5AW2B 1NTZK 2W6AA 1CZQA 1LP1B 2JWDA 2N1TA 2WSFH 2AEFA 1NAFA 5APQA 1HWTC 2M5AA 1GZLA 3LIDA 2XDJA 3U1CA 1NJIQ 1LTIC 1DD4A 1W2EA 2Q3EA 3NMDA 1PP9G 2A45I 3GHGB 3GW6A 4H44B 1N7SD 2WQYC 5AVWB 3RK3C 2Q3IA 1PGJA 1K9MQ 4WY4A 1OW6A 2E75D 2IPPA 2O01J 1WT6A 2HLOA 3H1KG 4NPFX 3VP9A 1KYOI 4GODA 1JNMA 1H8AA 1IFDA 2AXTH 5AW9B 4GKGA 1SQVK 1ZLLA 2IZ1A 3E7KA 4DT0A 1VQMP 3H1KE 1LGHB 4ASWA 1L0LE 1SFCD 2ZXEB 3GHGC 2B88A 4I2LC 4C46A 1H89A 1GL2B 2LXBA 2MJZA 4JQ0D 3WMM0 4Z1MH 1KB9E 3V2NA 1FZGA 3H1LJ 1VQPP 1RY3A 3H1LD 2OYOA 1BCCJ 1BGYJ 3SFEC 1JO5A 3V4WA 2JJLA 2O1JA 3GLMA 2FFDB 1SQBE 1EQ7A 3II6A 3TNUB 1ZP0C 1NOHA 1MKMA 1PGQA 2KXPB 2QA4P 1RQUA 2O01N 4LLHA 1R5LA 3RK3D 1DX7A 4C7NB 2IYOA 4ASVA 3N7NA 3CMEP 1VQ6P 1ZMEC 1H88A 1JY3N 3A3YB 5AW4B 4EIJA 1VQNP 3CXHD 3L73G 3AE7C 4I1LA 2P7JA 1SQXK 2FYUD 3RGUA 3P8MC 3P32A 5KLIB 2JDIH 3A0HE 1JCCA 3FWLA 2KK7A 1VQLP 5H2FE 3T97B 4O9BA 3M9HA 1YQ4C 2FY8A 1T3JA 3AEGC 2AEMA 1AQ5A 2BCCD 2IBZI 1L2PA 3JCUH 1FC2C 1T6AA 1L4AB 3PRJA 4IOIH 1N73A 2Z5HA 4PJ0H 1NTKD 3I55P 2QRXA 1N73C 1FE6A 1ZRTE 2C0WA 1RF0A 2E75B 1L0LK 4WY4D 3CPWO 2QJYB 5KLIC 1JEKA 2A06G 2KUBA 3WUVA 1ZR4A 1K8AQ 4OWFA 2L91A 2ZXXA 5CJ0A 1NTMK 4I7ZC 2R5BA 1MFZA 1SP4A 2NPSB 3KYQA 3RL0g 3L74E 5APSA 4R4MA 3JSVC 4D6TJ 3BRVB 2E74C 2W6BA 3WUUA 2D2CC 3OAKA 1LTTC 1SQXJ 5APXA 1MV8A 4TT3H 2RKLA 5CCHD 1KILA 1EDKA 1GK6A 2WSEJ 3H1JJ 3AECC 1SQQE 2B89A 3H1KD 2J5UA 3M0DC 1U57A 1GK4A 1IFPA 1NTZD 2ZFCA 3M91A 1DEBA 3VYIA 1MFTA 2KI7B 1U7MA 1AA0A 1L0NK 1ZXGA 2N9BA 1FS0E 1PPJD 3IAOA 1IFMA 3CXHH 5AW8B 1X9VA 2YIUB 1DH3A 3H1HE 1OVVA 2RMZA 4H13B 2Q9IA 1FZCB 2QIWA 3HE5A 3CL3D 2PRRA 5AVSB 3BASA 2M8RA 1SFCB 1J1DB 2B87B 1M1JA 4KT0J 3CCMP 2WPVB 2M5AB 3RL0D 1JB0J 1PL5A 2NZ2A 3ABVC 1BCCD 3O8ZA 4JBZA 4JPZB 4H44C 5AVYB 5KAFE 1NTKJ 3H25A 3CCQP 1S9KE 2KYVA 3CXHE 3CCEP 1NTMD 5CJ4A 1FJKA 1JTHB 2A45G 2HYNA 4L76A 1VQ9P 1N7SB 4GT1A 3A7OA 2WVRA 1LWUB 4HB1A 3BCCJ 3IR9A 1IK9A 1KMIZ 5CMZA 1URQD 5CHXA 1BSNA 3VMZA 2KS1A 2NPSD 3MGNA 2ZT9B 4HYTB 2BCCE 1L0LG 4Y99C 1P84H 1HJ0A 1X79B 3G9RA 1HUCA 2ZVNB 3ZDMA 1VF5D 1S5LH 1M1JB 4BWNA 2Q1KA 1NGMB 1RE4C 3CI9A 1RE3A 2YXQB 3H32B 4W7YA 1HF9A 3GHGA 1RE4A 2QE7H 3S9OA 3TGUD 2FYUK 3W67A 1NYHA 3I56P 1YJ9P 2Y9ZA 3PJSK 4H13D 2K9JA 3L75D 1QEXA 3CCRP 1S72P 1SQQG 1L4AC 3QWOC 4UB8E 4UB8H 1KB9H 3G4SP 3CX5D 1JTHA 4EI2A 1FDOA 2K37A 3HTKA 1Y9BA 3CWBE 3CX5H 3FXDA 3TNUA 2QJKB 3G71P 3L75G 3SSUA 2OTJP 1U7JA 3CX5I 5AVXB 2SPZA 1NTZE 1BGYG 2Y9YA 3AEDC 3P7KA 1OFCX 5APWA 2IDBA 3A2AA 2M0BA 1PPJE 3VMYA 1NU1J 1S3JA 2V7QJ 1KYOE 2E74B 1SQXD 3H1HD 3L70E 2E42A 2K1AA 2K9JB 3L36A 3O6QB 4RJTA 2P1JA 1PIXA 1SLQA 4WVZA 3CMAP 1NTMJ 3V2QA 4AUWA 1VQ7P 1RH5B 3RK2C 2WSCJ 1CW5A 3NXSA 4TLFA 3KXDA 1TU3F 2FXPA 3L71E 1SQPD 5AW5B 1Y8AA 1GD2E 2HFED 1JY2O 1OMIA 3A5TA 3TSIA 2Y0DA 4WY4B 1LTJA 3E1RA 2HR3A 4JF7A 3H1IE 2WTYA 3UIAA 1S9KD 1KB9I 1NTMG 1E79H 3M06A 3OW2O 4W7ZA 1FZCC 1KILB 5AVZB 2WMMA 1K73Q 3MD0A 1L0NE 5APTA 1SFCC 1LP1A 2IX7C 3CCSP 2N1TD 2IFNA 3R2PA 1SQVE 2R3SA 1FBMA 5AW1B 2H43A 2OYHA 2QM8A 3F5HA 4K3AA 4H44D 3L75J 1SQBG 1BE3E 1S5LX 1S4XA 2FYZA 3BCCG 4BXLA 5KLVE 1NAYA 3A0HH 4EOTA 3K5BA 1AQTA 2HODB 2YIUC 3VP8A 1USEA 2B9BA 1URQB 4UB6H 1KFNA 2B87A 3TGUE 1QVFO 1N7LA 2NPSC 3D6YA 3OJAB 3CXHI 1FU1A 1IZNB 1VDFA 2RN0A 3HE4A 2Q5UA 5E79H 3TK1A 2KP8A 3CC2P 1X22A 3MUDC 1OXZA 3CX5E 2W27A 3H1JD 3IFMA 1S2EA 3L72E 1FZAA 4W80A 3USSA 3CD6P 1KV4A 3ITKA 4L74A 5C39A 1JMMA 3VMXA 5B66E 4OVNF 1L0LJ 1OX3A 2G8YA 2XZRA 2HPCA 1OW8A 1UIIA 5AW7B 1NTKK 1XTCC 3PH0A 3SFDC 2W8ZA 1KB9D 4OGQD 1JY2P 2LXCB 4EDFA 1KYOD 3H1LE 1KILE 2YNYA 2HG5D 3L35A 2E5YA 3NFQA 3V6IA 5KTBA 3TF5A 1EDLA 3M9QA 1QX8A 1RF1A 4AQRD 1URQA 3GF7A 1VPCA 3HUSC 1NTKG 1YIJP 3H1JG 2WSSH 3O6QA 2N1TB 2I8DA 4GDOA 5GTIH 4HKZH 1SQPE 5CCGC 2FBWC 2DW3A 2FXMA 4H0LC 3RK3E 2Y0CA 1YJNP 1EXIA 2E74D 3PHLA 1T8ZA 2YKOA 5AW0B 2E76D 4N3YB 3H1ID 2WPSA 3B5ND 5KJ7C 1Q7YQ 1S1CX 2P58A 2WSCH 4C7RA 1KQLA 3KDPB 5AVRB 1HH0A 1KQFB 2JKVA 2FYUE 2V4HA 3V5BA 2AEJA 3MTUE
chains in the Genus database with same CATH topology
1SFCA 4N78E 1SQBK 1J1DC 1QL2A 3EFGA 3U59A 2OYIA 1FZCA 4WY4C 2OYIB 1LT9A 1XTGB 3B5NA 5APVA 1G2CB 1LTJC 2WT7A 5CCGA 3HUSB 4OH8B 1FJPA 2XU6A 2XV5A 1T2KC 1FZFA 3MUDA 1JY2N 3HTKB 4N6JA 1N7SA 4JYCA 4AYCA 2IFMA 2NPSA 1J1EB 3HD7A 3P8CD 4B86A 1M1JC 2CPBA 5KLVK 1CI6A 2PP6A 3B5NB 1LT9B 1X8YA 1KILD 1L4AA 4IFDK 2A45H 1JUNA 1MUUA 3H32A 3T97A 1HJBA 2YKPA 1SQQK 3LIEA 4M3LA 1LWUA 1GU5A 2GUVA 4JYBA 1GW4A 3N4XA 2JEEA 1J2JB 2LKMA 1WRGA 5AVVB 5CCGD 2I1JA 1N7SC 5BVZA 1MZ9A 1NKNA 1IFNA 5CCHC 1RF0C 3I5CA 3B5NC 1GU4A 2XKMA 2YMYA 1NU1K 2E43A 4XA4A 3E1IA 1ZV8A 4KHXA 1FZBA 1G2CA 2HPCB 2QM7A 5AVUB 3OA7A 1Z56A 1FOSF 2GM4A 1A02F 4IFMA 2C0XA 3VOPA 1HGVA 2O1KA 1AFOA 3BVHA 3BRTB 3HRNA 3C9IA 3V2RA 1RF1C 4GIFA 2O01H 2M3BA 1IO4A 2GUSA 1YTZI 1GL2D 3HD7C 1LTAC 4HH2A 3KPEA 3RK2D 3HUSA 4XE5B 3TYYA 4WBAA 2C9LY 1IFJA 2YO3A 1GTWA 1LT9C 1N86A 1HTLC 1M7LA 5APUA 3RK3B 1NWQA 5AVQB 4C7NA 1HBWA 3BATA 2N1TC 1OWAA 3RL0C 5BU5A 2OYIC 2L5GB 1LWUC 2KSJA 4DOJA 1HGZA 2WZ7A 2I1KA 3V2PA 2J59M 2OYHB 2Q7CA 3CLQA 1JY3O 2OARA 5APYA 5KJ7A 1URQC 1SQPK 2R5DA 1LTSC 2R3CA 2FFDC 5KJ7D 1CSBA 2J58A 1PFIA 1FZEA 2WSEH 3VN0A 1FAVA 3M0DA 1RE3C 3H6PA 2CPSA 2KB7P 1LTJB 1IC2A 1NHLA 3M9BA 3RK2B 2Z4EA 3EQ2A 3M0AA 1HVVA 4ZKUA 1FDMA 1CI6B 3RL0B 4I6MC 2YKQA 2Z5IA 5AW3B 5AVTB 1JOCA 2KLVA 2BASA 1IJDB 1NO4A 1KFMA 5AW6B 5BU8B 1RF1B 1IFIA 1QL1A 1NH4A 3L4FA 4LC1A 2POHA 4Y99B 3SWFA 2WPQA 1GL2A 4N78D 1SVFA 1ZN5A 3SWYA 2WPRA 2P2UA 1N73B 2XNXA 2C9NY 2YO2A 1A02J 1T2KD 2P67A 2WITA 1T3UA 1JCDA 3U1AA 1LTGC 3HD7B 1FOSE 2H7HA 2KOGA 4WB4A 4RESB 2PAJA 3PP5A 3P8CE 1J1EC 1KZUB 4AUWA 1YTZT 1YYCA 3L37A 3MIWA 3HE5B 2VRSA 1NKZB 3LW5H 4IFFA 1ZR2A 2R32A 2H8PD 3HE4B 3VTPC 1KILC 3G3ZA 2OYHC 1LTBC 1L4AD 3V4QA 3KQGA 1G1JA 2FKWB 4ZKPA 2HODA 4LGDE 3NTNA 1GL2C 3HD7D 3B8EB 1E5WA 1JY3P 1GW3A 1N2DC 1G1IA 2WWWA 5CCHA 2WT7B 5AW2B 1NTZK 2W6AA 1CZQA 5APQA 2N1TA 2WSFH 1HWTC 1NAFA 1GZLA 3LIDA 2XDJA 3U1CA 1LTIC 1W2EA 3NMDA 1H8AA 5AVWB 2A45I 3GHGB 3RK3C 1N7SD 2Q3IA 4WY4A 2IPPA 1WT6A 2HLOA 3VP9A 1JNMA 1IFDA 5AW9B 4GKGA 1SQVK 1ZLLA 4C46A 1LGHB 1SFCD 2ZXEB 3GHGC 4I2LC 1GL2B 2MJZA 3WMM0 3V2NA 1FZGA 1RY3A 1JO5A 3V4WA 2JJLA 2O1JA 2FFDB 1EQ7A 3II6A 3TNUB 1NOHA 4LLHA 3RK3D 1DX7A 4C7NB 3N7NA 1H88A 1JY3N 3A3YB 5AW4B 4EIJA 4I1LA 2P7JA 1SQXK 3P8MC 3P32A 1JCCA 4O9BA 3M9HA 1T3JA 1AQ5A 1N73A 1L4AB 2Z5HA 1N73C 2C0WA 1RF0A 4WY4D 1L0LK 1GDTA 1ZR4A 5CJ0A 1NTMK 2R5BA 1MFZA 1SP4A 2NPSB 3KYQA 5APSA 3BRVB 2W6BA 3OAKA 1LTTC 5APXA 1MV8A 5CCHD 1KILA 1GK6A 3M0DC 2ZFCA 1GK4A 3M91A 4DZOA 1DEBA 3VYIA 1L0NK 1H89A 2N9BA 1IFMA 5AW8B 1DH3A 1X9VA 2Q9IA 1FZCB 3HE5A 3CL3D 5AVSB 3BASA 2M8RA 1SFCB 1J1DB 1M1JA 3RL0D 3O8ZA 5AVYB 1S9KE 2KYVA 5CJ4A 1FJKA 1JTHB 2A45G 2HYNA 1N7SB 4GT1A 3A7OA 1LWUB 3IR9A 3VMZA 1IK9A 5CMZA 1URQD 5CHXA 2NPSD 3MGNA 4Y99C 4HYTB 1X79B 1HUCA 1M1JB 1RE4C 3CI9A 1RE3A 3H32B 4W7YA 3GHGA 1RE4A 2FYUK 1L4AC 1JTHA 3HTKA 3TNUA 5AVXB 3P7KA 5APWA 3A2AA 3VMYA 2E42A 3L36A 2P1JA 1SLQA 1CW5A 3V2QA 3RK2C 3NXSA 5AW5B 1GD2E 2HFED 1JY2O 3A5TA 3TSIA 4WY4B 1LTJA 4JF7A 2WTYA 3UIAA 1S9KD 3M06A 4W7ZA 1FZCC 1KILB 5AVZB 3MD0A 5APTA 1SFCC 2IX7C 2N1TD 2IFNA 3R2PA 1FBMA 5AW1B 2H43A 2OYHA 2QM8A 2FFDA 2FYZA 4EOTA 2HODB 3VP8A 1URQB 1KFNA 1N7LA 2NPSC 3OJAB 1FU1A 1VDFA 3HE4A 2Q5UA 3TK1A 2KP8A 1OXZA 3IFMA 2W27A 1FZAA 4W80A 1JMMA 3VMXA 2HPCA 2XZRA 5AW7B 1NTKK 1XTCC 1JY2P 3NFQA 5KTBA 2YNYA 2HG5D 3L35A 3M9QA 1RF1A 4AQRD 1URQA 1VPCA 3HUSC 2N1TB 5CCGC 2FXMA 1T8ZA 2YKOA 5AW0B 4N3YB 2WPSA 3B5ND 5KJ7C 2WSCH 4C7RA 1KQLA 3KDPB 5AVRB 1HH0A 3V5BA 3MTUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFN A;  2XKM A;  1PFI A;  3IFM A;  4IFM A;  1QL1 A;  2KSJ A;  1QL2 A;  1ZN5 A;  2IFM A;  1IFN A;  1IFM A;  2KLV A; 
#chains in the Genus database with same CATH topology
 1AV1 A;  5GTI E;  1SFC A;  4N78 E;  1SQB K;  1QLE D;  1SQV D;  3Q5S A;  1J1D C;  1PZQ A;  1QL2 A;  3EFG A;  3IN6 A;  1IK7 A;  3KHU A;  3KZI H;  3U59 A;  4WY4 C;  1VL2 A;  1FZC A;  2OYI B;  4PV1 D;  1LT9 A;  1XTG B;  4U3F J;  3B5N A;  5APV A;  1G2C B;  1LTJ C;  2WT7 A;  2ITA A;  5CCG A;  3L73 J;  3HUS B;  4RO0 A;  1PGP A;  4OH8 B;  1JM0 A;  2OQQ A;  1FJP A;  2XU6 A;  5TIS E;  1EC5 A;  2YXR B;  2XV5 A;  1T2K C;  1M1K Q;  1PP9 E;  2W90 A;  1Y47 A;  1FZF A;  4Y28 J;  5KKZ C;  2BEZ F;  3GMA A;  1SQP G;  3MUD A;  2JWA A;  1JY2 N;  4YXW H;  3HTK B;  4N6J A;  1NTZ G;  2BEQ D;  1N7S A;  2IBZ E;  2ZT9 C;  3FGA D;  5DJT B;  3S1K A;  4JYC A;  4AYC A;  5CBN A;  2D2C B;  2IFM A;  2NPS A;  1J1E B;  1SQB J;  2ZYD A;  3HD7 A;  3P8C D;  4IL6 E;  4B86 A;  1M1J C;  2CPB A;  2JP3 A;  2E76 B;  1LNQ A;  5KLV K;  1CI6 A;  1NU1 D;  3AE5 C;  2PP6 A;  3B5N B;  5KKZ B;  1LT9 B;  1PV3 A;  1X8Y A;  1KIL D;  1KD1 Q;  1BGY D;  1KN7 A;  1L4A A;  5KAF H;  2A45 H;  1EXJ A;  1MUU A;  4IFD K;  1JUN A;  1AVY A;  3Q2Y A;  3H32 A;  3RBZ A;  2A06 D;  3T97 A;  3H1K J;  1HJB A;  4UB6 E;  2YKP A;  5EFW B;  2AXT E;  1SQQ K;  3LIE A;  4M3L A;  1LWU A;  1GU5 A;  2OGU A;  2XND H;  5KAI H;  2GUV A;  4K35 A;  4JYB A;  3TGU G;  1BCC E;  1GW4 A;  2KS1 B;  3N4X A;  4CPG A;  2QVA A;  1N8R Q;  3GG2 A;  1QGK B;  4DJG A;  2JEE A;  1J2J B;  3WU2 H;  2PFX A;  1FDM A;  5B5E E;  3L73 D;  1NU1 G;  1WRG A;  2LKM A;  3B71 A;  5AVV B;  1BE3 G;  2I1J A;  3AE4 C;  3BCC E;  4BRY A;  5CCG D;  3KZI E;  3L74 J;  1W2B O;  1N7S C;  5BVZ A;  1SS1 A;  4D6T E;  1MZ9 A;  1NKN A;  1IFN A;  2FXO A;  1RF0 C;  5CCH C;  4GOE A;  3I5C A;  3B5N C;  3Q1M A;  1EZV G;  1GU4 A;  2N9Y B;  2XKM A;  1NU1 K;  2YMY A;  4XA4 A;  1LJ2 A;  4HJG H;  1D7M A;  5E79 E;  2E43 A;  3E1I A;  3W68 A;  1ZV8 A;  4KHX A;  1FZB A;  1G2C A;  1P84 I;  1SQQ J;  4PD4 D;  2HPC B;  5B5E H;  2KSE A;  4PD4 H;  3D71 A;  3Q5P A;  1PP9 D;  2QM7 A;  5AVU B;  3OA7 A;  1VF5 B;  1Z56 A;  3IF4 A;  4PV1 B;  1FOS F;  2GM4 A;  1KYO H;  1Q2N A;  1NVO A;  3AE2 C;  4PJ0 E;  2V7Q H;  1A02 F;  5CBO A;  2IBZ D;  4IFM A;  2C0X A;  3VOP A;  1HGV A;  1M8O B;  4YTP C;  3TDK A;  2O1K A;  3PLN A;  2E5T A;  2K3R A;  2M3E A;  1WMK A;  1RQV A;  3C1L A;  1OVR A;  3AE1 C;  1AFO A;  3BVH A;  3BRT B;  2FFD A;  3HRN A;  3C9I A;  3V2R A;  1RF1 C;  4GIF A;  1SQX E;  3L70 D;  1BGY E;  2NRG A;  2O01 H;  2K9Y A;  3R4Y A;  2M3B A;  2ZAE B;  3AE6 C;  5DJU B;  4L75 A;  1IO4 A;  2GUS A;  1YTZ I;  2Q6Q A;  1SQB D;  2A06 E;  2ZVO B;  1GL2 D;  3HD7 C;  3Q5R A;  1LTA C;  1W5C E;  1QVG O;  4HH2 A;  3EWK A;  3L71 D;  3KPE A;  3RK2 D;  3HUS A;  4XE5 B;  3S4R A;  1H0T A;  1M56 D;  2KLU A;  3TYY A;  4WBA A;  2C9L Y;  1K04 A;  1R8E A;  1EDJ A;  5M1B A;  1IFJ A;  2YO3 A;  3L71 G;  1GTW A;  1LT9 C;  3H1I J;  3JC2 2;  4OGQ C;  3WU2 E;  4NPE A;  1N86 A;  3L72 G;  2Y0E A;  1HTL C;  1M7L A;  5APU A;  3RK3 B;  1NWQ A;  1L0N D;  1FDI A;  5AVQ B;  1L0N J;  4C7N A;  1YI2 P;  1HBW A;  3BCC D;  3JCU E;  1H0T B;  3BAT A;  4R4L A;  1DEE G;  1X0T A;  5KAI E;  2N1T C;  1OWA A;  2JO1 A;  4D6T D;  3RL0 C;  2OYI A;  5BU5 A;  1NTK E;  4H0L B;  2OYI C;  2L5G B;  2E76 C;  1ZRT D;  1LWU C;  3SWK A;  4A7P A;  2KSJ A;  4DOJ A;  1HGZ A;  2WZ7 A;  1SQX G;  2I1K A;  3AEF C;  3MP7 B;  4PD4 E;  3V2P A;  5KLV G;  2RH0 A;  2J59 M;  3CCL P;  4D6T G;  1YJW P;  2Q7C A;  3CLQ A;  1YBK A;  3L74 D;  1JY3 O;  2OAR A;  3F89 A;  2BCC J;  5APY A;  3C8V A;  1AJY A;  5KJ7 A;  1URQ C;  1SQP K;  2MKV A;  1LTS C;  2R5D A;  2R3C A;  2FFD C;  1VQ8 P;  1K05 A;  3CC7 P;  3L70 J;  2QSI A;  5KJ7 D;  1CSB A;  2J58 A;  1PFI A;  1FZE A;  2WSE H;  3H1J E;  3VN0 A;  1FAV A;  1S5L E;  2LR2 A;  3L72 D;  5L8R J;  1M57 D;  1PGO A;  1SQQ D;  3CWB G;  3M0D A;  1UIX A;  2OTL P;  4DCK A;  1RE3 C;  1GMJ A;  3H6P A;  1Q86 Q;  2CPS A;  2KB7 P;  1KQG B;  1LTJ B;  2O3J A;  3H1H G;  1IC2 A;  1NHL A;  3M9B A;  3RK2 B;  2Z4E A;  2K88 A;  1ZOY C;  3EQ2 A;  3FXE A;  2KNC A;  1HVV A;  2KZI A;  3AE8 C;  3M0A A;  4GOF A;  3H1H J;  4XFJ A;  1CI6 B;  4ZKU A;  3RL0 B;  4I6M C;  2YKQ A;  4DZO A;  1Q82 Q;  1OZH A;  2Z5I A;  5AW3 B;  5AVT B;  3CWB J;  1EZV E;  1JOC A;  4MN4 C;  2KLV A;  5TIS H;  3D6Z A;  3CCU P;  1LT1 A;  1NTZ J;  2QJP C;  2AXC A;  1SQP J;  3B4S A;  4YPC A;  1EZV I;  2BAS A;  3QH9 A;  1IJD B;  2ZYA A;  1NO4 A;  1KFM A;  2CK3 H;  2QJY C;  4H0L D;  5AW6 B;  2JR8 A;  4QMA A;  5BU8 B;  1KQS O;  4KJM A;  1RF1 B;  1IFI A;  2OTK E;  4U3F D;  5KLV J;  1NTM E;  1QL1 A;  1VF5 C;  1NH4 A;  2KIK A;  3AEE C;  3L4F A;  4LC1 A;  3Q3D A;  2POH A;  2QJP B;  4Y99 B;  1BCC G;  3SWF A;  1RHZ B;  2OYH B;  2WPQ A;  1GL2 A;  3H1L G;  3AEB C;  4IL6 H;  4U3F G;  4N78 D;  1AVO A;  1P84 E;  1SVF A;  4NPD A;  1ZN5 A;  2KZJ A;  3SWY A;  2WPR A;  1VQ4 P;  2P2U A;  2W6J H;  2XNX A;  5TJH A;  1N73 B;  1YIT P;  4ZNC A;  3RBX A;  1OVU A;  2C9N Y;  3CC4 P;  2ZYG A;  2YO2 A;  1A02 J;  4L73 A;  1KC8 Q;  2IZ0 A;  3AE9 C;  3L70 G;  1T2K D;  2ZJS E;  4RKU J;  2P67 A;  1GDT A;  3MHV A;  2QG4 A;  2WIT A;  3H1I G;  4ZMD A;  1Q81 Q;  1T3U A;  2BCC G;  3EFF K;  1JCD A;  3U1A A;  2G3A A;  4H13 C;  1LTG C;  1PP9 J;  2R44 A;  3HD7 B;  4BRY B;  1FOS E;  3GF3 A;  2ZT9 D;  3L75 E;  2H7H A;  4PV1 C;  2KOG A;  4WB4 A;  2IBZ G;  4RES B;  1YHQ P;  3CWB D;  1USD A;  2PAJ A;  3PTZ A;  5GTH E;  1VQ5 P;  3LW5 J;  1KTM A;  3CCV P;  1L0L D;  3P8C E;  3PP5 A;  5H2F H;  4EYY Q;  3VMA A;  2QEX P;  1SQV G;  1J1E C;  1KOR A;  1KZU B;  4U7J A;  1NU1 E;  1YTZ T;  1YYC A;  3G6E P;  1L0N G;  3L37 A;  3CCJ P;  3MZW B;  1DD3 A;  1BDD A;  4PD4 I;  2P10 A;  4I7Z B;  3L72 J;  2FYN C;  2H88 C;  2VRS A;  2WSF J;  3HE5 B;  1EZV D;  1NKZ B;  2UWJ E;  2FYU J;  3MIW A;  1R5S A;  3LW5 H;  3L71 J;  3A0B E;  5GTH H;  1BDC A;  4IFF A;  2PGD A;  1OW7 A;  2YMK A;  2KNC B;  1ZR2 A;  2R32 A;  1YQ3 C;  2H8P D;  3HE4 B;  3AEA C;  3VTP C;  2IYP A;  1EDI A;  1KIL C;  1M90 Q;  3G3Z A;  2E75 C;  1OIP A;  1LTB C;  1ZW0 A;  1L4A D;  2FYU G;  2FYN B;  4U3F E;  3V4Q A;  2OYH C;  1JMB A;  4OGQ B;  3KQG A;  1G1J A;  1DIP A;  2GA1 A;  2FKW B;  2H89 C;  3WUT A;  4ZKP A;  3FX0 A;  1VQK P;  3TGU J;  4IL6 X;  2HOD A;  3FWN A;  3L73 E;  1PPJ G;  3NTN A;  4LGD E;  3A0B H;  4WWI A;  1GL2 C;  3HD7 D;  5B66 H;  1SQV J;  1P84 D;  1Q90 D;  3B8E B;  4YXD C;  1E5W A;  1JY3 P;  1VQO P;  1GW3 A;  3L74 G;  1N2D C;  1G1I A;  2WWW A;  2D2C D;  2QJK C;  1BE3 J;  5CCH A;  1BSH A;  1BE3 D;  2W83 C;  3AE3 C;  5KLV D;  5K5G B;  3D70 A;  2WT7 B;  5AW2 B;  1NTZ K;  2W6A A;  1CZQ A;  1LP1 B;  2JWD A;  2N1T A;  2WSF H;  2AEF A;  1NAF A;  5APQ A;  1HWT C;  2M5A A;  1GZL A;  3LID A;  2XDJ A;  3U1C A;  1NJI Q;  1LTI C;  1DD4 A;  1W2E A;  2Q3E A;  3NMD A;  1PP9 G;  2A45 I;  3GHG B;  3GW6 A;  4H44 B;  1N7S D;  2WQY C;  5AVW B;  3RK3 C;  2Q3I A;  1PGJ A;  1K9M Q;  4WY4 A;  1OW6 A;  2E75 D;  2IPP A;  2O01 J;  1WT6 A;  2HLO A;  3H1K G;  4NPF X;  3VP9 A;  1KYO I;  4GOD A;  1JNM A;  1H8A A;  1IFD A;  2AXT H;  5AW9 B;  4GKG A;  1SQV K;  1ZLL A;  2IZ1 A;  3E7K A;  4DT0 A;  1VQM P;  3H1K E;  1LGH B;  4ASW A;  1L0L E;  1SFC D;  2ZXE B;  3GHG C;  2B88 A;  4I2L C;  4C46 A;  1H89 A;  1GL2 B;  2LXB A;  2MJZ A;  4JQ0 D;  3WMM 0;  4Z1M H;  1KB9 E;  3V2N A;  1FZG A;  3H1L J;  1VQP P;  1RY3 A;  3H1L D;  2OYO A;  1BCC J;  1BGY J;  3SFE C;  1JO5 A;  3V4W A;  2JJL A;  2O1J A;  3GLM A;  2FFD B;  1SQB E;  1EQ7 A;  3II6 A;  3TNU B;  1ZP0 C;  1NOH A;  1MKM A;  1PGQ A;  2KXP B;  2QA4 P;  1RQU A;  2O01 N;  4LLH A;  1R5L A;  3RK3 D;  1DX7 A;  4C7N B;  2IYO A;  4ASV A;  3N7N A;  3CME P;  1VQ6 P;  1ZME C;  1H88 A;  1JY3 N;  3A3Y B;  5AW4 B;  4EIJ A;  1VQN P;  3CXH D;  3L73 G;  3AE7 C;  4I1L A;  2P7J A;  1SQX K;  2FYU D;  3RGU A;  3P8M C;  3P32 A;  5KLI B;  2JDI H;  3A0H E;  1JCC A;  3FWL A;  2KK7 A;  1VQL P;  5H2F E;  3T97 B;  4O9B A;  3M9H A;  1YQ4 C;  2FY8 A;  1T3J A;  3AEG C;  2AEM A;  1AQ5 A;  2BCC D;  2IBZ I;  1L2P A;  3JCU H;  1FC2 C;  1T6A A;  1L4A B;  3PRJ A;  4IOI H;  1N73 A;  2Z5H A;  4PJ0 H;  1NTK D;  3I55 P;  2QRX A;  1N73 C;  1FE6 A;  1ZRT E;  2C0W A;  1RF0 A;  2E75 B;  1L0L K;  4WY4 D;  3CPW O;  2QJY B;  5KLI C;  1JEK A;  2A06 G;  2KUB A;  3WUV A;  1ZR4 A;  1K8A Q;  4OWF A;  2L91 A;  2ZXX A;  5CJ0 A;  1NTM K;  4I7Z C;  2R5B A;  1MFZ A;  1SP4 A;  2NPS B;  3KYQ A;  3RL0 g;  3L74 E;  5APS A;  4R4M A;  3JSV C;  4D6T J;  3BRV B;  2E74 C;  2W6B A;  3WUU A;  2D2C C;  3OAK A;  1LTT C;  1SQX J;  5APX A;  1MV8 A;  4TT3 H;  2RKL A;  5CCH D;  1KIL A;  1EDK A;  1GK6 A;  2WSE J;  3H1J J;  3AEC C;  1SQQ E;  2B89 A;  3H1K D;  2J5U A;  3M0D C;  1U57 A;  1GK4 A;  1IFP A;  1NTZ D;  2ZFC A;  3M91 A;  1DEB A;  3VYI A;  1MFT A;  2KI7 B;  1U7M A;  1AA0 A;  1L0N K;  1ZXG A;  2N9B A;  1FS0 E;  1PPJ D;  3IAO A;  1IFM A;  3CXH H;  5AW8 B;  1X9V A;  2YIU B;  1DH3 A;  3H1H E;  1OVV A;  2RMZ A;  4H13 B;  2Q9I A;  1FZC B;  2QIW A;  3HE5 A;  3CL3 D;  2PRR A;  5AVS B;  3BAS A;  2M8R A;  1SFC B;  1J1D B;  2B87 B;  1M1J A;  4KT0 J;  3CCM P;  2WPV B;  2M5A B;  3RL0 D;  1JB0 J;  1PL5 A;  2NZ2 A;  3ABV C;  1BCC D;  3O8Z A;  4JBZ A;  4JPZ B;  4H44 C;  5AVY B;  5KAF E;  1NTK J;  3H25 A;  3CCQ P;  1S9K E;  2KYV A;  3CXH E;  3CCE P;  1NTM D;  5CJ4 A;  1FJK A;  1JTH B;  2A45 G;  2HYN A;  4L76 A;  1VQ9 P;  1N7S B;  4GT1 A;  3A7O A;  2WVR A;  1LWU B;  4HB1 A;  3BCC J;  3IR9 A;  1IK9 A;  1KMI Z;  5CMZ A;  1URQ D;  5CHX A;  1BSN A;  3VMZ A;  2KS1 A;  2NPS D;  3MGN A;  2ZT9 B;  4HYT B;  2BCC E;  1L0L G;  4Y99 C;  1P84 H;  1HJ0 A;  1X79 B;  3G9R A;  1HUC A;  2ZVN B;  3ZDM A;  1VF5 D;  1S5L H;  1M1J B;  4BWN A;  2Q1K A;  1NGM B;  1RE4 C;  3CI9 A;  1RE3 A;  2YXQ B;  3H32 B;  4W7Y A;  1HF9 A;  3GHG A;  1RE4 A;  2QE7 H;  3S9O A;  3TGU D;  2FYU K;  3W67 A;  1NYH A;  3I56 P;  1YJ9 P;  2Y9Z A;  3PJS K;  4H13 D;  2K9J A;  3L75 D;  1QEX A;  3CCR P;  1S72 P;  1SQQ G;  1L4A C;  3QWO C;  4UB8 E;  4UB8 H;  1KB9 H;  3G4S P;  3CX5 D;  1JTH A;  4EI2 A;  1FDO A;  2K37 A;  3HTK A;  1Y9B A;  3CWB E;  3CX5 H;  3FXD A;  3TNU A;  2QJK B;  3G71 P;  3L75 G;  3SSU A;  2OTJ P;  1U7J A;  3CX5 I;  5AVX B;  2SPZ A;  1NTZ E;  1BGY G;  2Y9Y A;  3AED C;  3P7K A;  1OFC X;  5APW A;  2IDB A;  3A2A A;  2M0B A;  1PPJ E;  3VMY A;  1NU1 J;  1S3J A;  2V7Q J;  1KYO E;  2E74 B;  1SQX D;  3H1H D;  3L70 E;  2E42 A;  2K1A A;  2K9J B;  3L36 A;  3O6Q B;  4RJT A;  2P1J A;  1PIX A;  1SLQ A;  4WVZ A;  3CMA P;  1NTM J;  3V2Q A;  4AUW A;  1VQ7 P;  1RH5 B;  3RK2 C;  2WSC J;  1CW5 A;  3NXS A;  4TLF A;  3KXD A;  1TU3 F;  2FXP A;  3L71 E;  1SQP D;  5AW5 B;  1Y8A A;  1GD2 E;  2HFE D;  1JY2 O;  1OMI A;  3A5T A;  3TSI A;  2Y0D A;  4WY4 B;  1LTJ A;  3E1R A;  2HR3 A;  4JF7 A;  3H1I E;  2WTY A;  3UIA A;  1S9K D;  1KB9 I;  1NTM G;  1E79 H;  3M06 A;  3OW2 O;  4W7Z A;  1FZC C;  1KIL B;  5AVZ B;  2WMM A;  1K73 Q;  3MD0 A;  1L0N E;  5APT A;  1SFC C;  1LP1 A;  2IX7 C;  3CCS P;  2N1T D;  2IFN A;  3R2P A;  1SQV E;  2R3S A;  1FBM A;  5AW1 B;  2H43 A;  2OYH A;  2QM8 A;  3F5H A;  4K3A A;  4H44 D;  3L75 J;  1SQB G;  1BE3 E;  1S5L X;  1S4X A;  2FYZ A;  3BCC G;  4BXL A;  5KLV E;  1NAY A;  3A0H H;  4EOT A;  3K5B A;  1AQT A;  2HOD B;  2YIU C;  3VP8 A;  1USE A;  2B9B A;  1URQ B;  4UB6 H;  1KFN A;  2B87 A;  3TGU E;  1QVF O;  1N7L A;  2NPS C;  3D6Y A;  3OJA B;  3CXH I;  1FU1 A;  1IZN B;  1VDF A;  2RN0 A;  3HE4 A;  2Q5U A;  5E79 H;  3TK1 A;  2KP8 A;  3CC2 P;  1X22 A;  3MUD C;  1OXZ A;  3CX5 E;  2W27 A;  3H1J D;  3IFM A;  1S2E A;  3L72 E;  1FZA A;  4W80 A;  3USS A;  3CD6 P;  1KV4 A;  3ITK A;  4L74 A;  5C39 A;  1JMM A;  3VMX A;  5B66 E;  4OVN F;  1L0L J;  1OX3 A;  2G8Y A;  2XZR A;  2HPC A;  1OW8 A;  1UII A;  5AW7 B;  1NTK K;  1XTC C;  3PH0 A;  3SFD C;  2W8Z A;  1KB9 D;  4OGQ D;  1JY2 P;  2LXC B;  4EDF A;  1KYO D;  3H1L E;  1KIL E;  2YNY A;  2HG5 D;  3L35 A;  2E5Y A;  3NFQ A;  3V6I A;  5KTB A;  3TF5 A;  1EDL A;  3M9Q A;  1QX8 A;  1RF1 A;  4AQR D;  1URQ A;  3GF7 A;  1VPC A;  3HUS C;  1NTK G;  1YIJ P;  3H1J G;  2WSS H;  3O6Q A;  2N1T B;  2I8D A;  4GDO A;  5GTI H;  4HKZ H;  1SQP E;  5CCG C;  2FBW C;  2DW3 A;  2FXM A;  4H0L C;  3RK3 E;  2Y0C A;  1YJN P;  1EXI A;  2E74 D;  3PHL A;  1T8Z A;  2YKO A;  5AW0 B;  2E76 D;  4N3Y B;  3H1I D;  2WPS A;  3B5N D;  5KJ7 C;  1Q7Y Q;  1S1C X;  2P58 A;  2WSC H;  4C7R A;  1KQL A;  3KDP B;  5AVR B;  1HH0 A;  1KQF B;  2JKV A;  2FYU E;  2V4H A;  3V5B A;  2AEJ A;  3MTU E; 
#chains in the Genus database with same CATH homology
 1SFC A;  4N78 E;  1SQB K;  1J1D C;  1QL2 A;  3EFG A;  3U59 A;  2OYI A;  1FZC A;  4WY4 C;  2OYI B;  1LT9 A;  1XTG B;  3B5N A;  5APV A;  1G2C B;  1LTJ C;  2WT7 A;  5CCG A;  3HUS B;  4OH8 B;  1FJP A;  2XU6 A;  2XV5 A;  1T2K C;  1FZF A;  3MUD A;  1JY2 N;  3HTK B;  4N6J A;  1N7S A;  4JYC A;  4AYC A;  2IFM A;  2NPS A;  1J1E B;  3HD7 A;  3P8C D;  4B86 A;  1M1J C;  2CPB A;  5KLV K;  1CI6 A;  2PP6 A;  3B5N B;  1LT9 B;  1X8Y A;  1KIL D;  1L4A A;  4IFD K;  2A45 H;  1JUN A;  1MUU A;  3H32 A;  3T97 A;  1HJB A;  2YKP A;  1SQQ K;  3LIE A;  4M3L A;  1LWU A;  1GU5 A;  2GUV A;  4JYB A;  1GW4 A;  3N4X A;  2JEE A;  1J2J B;  2LKM A;  1WRG A;  5AVV B;  5CCG D;  2I1J A;  1N7S C;  5BVZ A;  1MZ9 A;  1NKN A;  1IFN A;  5CCH C;  1RF0 C;  3I5C A;  3B5N C;  1GU4 A;  2XKM A;  2YMY A;  1NU1 K;  2E43 A;  4XA4 A;  3E1I A;  1ZV8 A;  4KHX A;  1FZB A;  1G2C A;  2HPC B;  2QM7 A;  5AVU B;  3OA7 A;  1Z56 A;  1FOS F;  2GM4 A;  1A02 F;  4IFM A;  2C0X A;  3VOP A;  1HGV A;  2O1K A;  1AFO A;  3BVH A;  3BRT B;  3HRN A;  3C9I A;  3V2R A;  1RF1 C;  4GIF A;  2O01 H;  2M3B A;  1IO4 A;  2GUS A;  1YTZ I;  1GL2 D;  3HD7 C;  1LTA C;  4HH2 A;  3KPE A;  3RK2 D;  3HUS A;  4XE5 B;  3TYY A;  4WBA A;  2C9L Y;  1IFJ A;  2YO3 A;  1GTW A;  1LT9 C;  1N86 A;  1HTL C;  1M7L A;  5APU A;  3RK3 B;  1NWQ A;  5AVQ B;  4C7N A;  1HBW A;  3BAT A;  2N1T C;  1OWA A;  3RL0 C;  5BU5 A;  2OYI C;  2L5G B;  1LWU C;  2KSJ A;  4DOJ A;  1HGZ A;  2WZ7 A;  2I1K A;  3V2P A;  2J59 M;  2OYH B;  2Q7C A;  3CLQ A;  1JY3 O;  2OAR A;  5APY A;  5KJ7 A;  1URQ C;  1SQP K;  2R5D A;  1LTS C;  2R3C A;  2FFD C;  5KJ7 D;  1CSB A;  2J58 A;  1PFI A;  1FZE A;  2WSE H;  3VN0 A;  1FAV A;  3M0D A;  1RE3 C;  3H6P A;  2CPS A;  2KB7 P;  1LTJ B;  1IC2 A;  1NHL A;  3M9B A;  3RK2 B;  2Z4E A;  3EQ2 A;  3M0A A;  1HVV A;  4ZKU A;  1FDM A;  1CI6 B;  3RL0 B;  4I6M C;  2YKQ A;  2Z5I A;  5AW3 B;  5AVT B;  1JOC A;  2KLV A;  2BAS A;  1IJD B;  1NO4 A;  1KFM A;  5AW6 B;  5BU8 B;  1RF1 B;  1IFI A;  1QL1 A;  1NH4 A;  3L4F A;  4LC1 A;  2POH A;  4Y99 B;  3SWF A;  2WPQ A;  1GL2 A;  4N78 D;  1SVF A;  1ZN5 A;  3SWY A;  2WPR A;  2P2U A;  1N73 B;  2XNX A;  2C9N Y;  2YO2 A;  1A02 J;  1T2K D;  2P67 A;  2WIT A;  1T3U A;  1JCD A;  3U1A A;  1LTG C;  3HD7 B;  1FOS E;  2H7H A;  2KOG A;  4WB4 A;  4RES B;  2PAJ A;  3PP5 A;  3P8C E;  1J1E C;  1KZU B;  4AUW A;  1YTZ T;  1YYC A;  3L37 A;  3MIW A;  3HE5 B;  2VRS A;  1NKZ B;  3LW5 H;  4IFF A;  1ZR2 A;  2R32 A;  2H8P D;  3HE4 B;  3VTP C;  1KIL C;  3G3Z A;  2OYH C;  1LTB C;  1L4A D;  3V4Q A;  3KQG A;  1G1J A;  2FKW B;  4ZKP A;  2HOD A;  4LGD E;  3NTN A;  1GL2 C;  3HD7 D;  3B8E B;  1E5W A;  1JY3 P;  1GW3 A;  1N2D C;  1G1I A;  2WWW A;  5CCH A;  2WT7 B;  5AW2 B;  1NTZ K;  2W6A A;  1CZQ A;  5APQ A;  2N1T A;  2WSF H;  1HWT C;  1NAF A;  1GZL A;  3LID A;  2XDJ A;  3U1C A;  1LTI C;  1W2E A;  3NMD A;  1H8A A;  5AVW B;  2A45 I;  3GHG B;  3RK3 C;  1N7S D;  2Q3I A;  4WY4 A;  2IPP A;  1WT6 A;  2HLO A;  3VP9 A;  1JNM A;  1IFD A;  5AW9 B;  4GKG A;  1SQV K;  1ZLL A;  4C46 A;  1LGH B;  1SFC D;  2ZXE B;  3GHG C;  4I2L C;  1GL2 B;  2MJZ A;  3WMM 0;  3V2N A;  1FZG A;  1RY3 A;  1JO5 A;  3V4W A;  2JJL A;  2O1J A;  2FFD B;  1EQ7 A;  3II6 A;  3TNU B;  1NOH A;  4LLH A;  3RK3 D;  1DX7 A;  4C7N B;  3N7N A;  1H88 A;  1JY3 N;  3A3Y B;  5AW4 B;  4EIJ A;  4I1L A;  2P7J A;  1SQX K;  3P8M C;  3P32 A;  1JCC A;  4O9B A;  3M9H A;  1T3J A;  1AQ5 A;  1N73 A;  1L4A B;  2Z5H A;  1N73 C;  2C0W A;  1RF0 A;  4WY4 D;  1L0L K;  1GDT A;  1ZR4 A;  5CJ0 A;  1NTM K;  2R5B A;  1MFZ A;  1SP4 A;  2NPS B;  3KYQ A;  5APS A;  3BRV B;  2W6B A;  3OAK A;  1LTT C;  5APX A;  1MV8 A;  5CCH D;  1KIL A;  1GK6 A;  3M0D C;  2ZFC A;  1GK4 A;  3M91 A;  4DZO A;  1DEB A;  3VYI A;  1L0N K;  1H89 A;  2N9B A;  1IFM A;  5AW8 B;  1DH3 A;  1X9V A;  2Q9I A;  1FZC B;  3HE5 A;  3CL3 D;  5AVS B;  3BAS A;  2M8R A;  1SFC B;  1J1D B;  1M1J A;  3RL0 D;  3O8Z A;  5AVY B;  1S9K E;  2KYV A;  5CJ4 A;  1FJK A;  1JTH B;  2A45 G;  2HYN A;  1N7S B;  4GT1 A;  3A7O A;  1LWU B;  3IR9 A;  3VMZ A;  1IK9 A;  5CMZ A;  1URQ D;  5CHX A;  2NPS D;  3MGN A;  4Y99 C;  4HYT B;  1X79 B;  1HUC A;  1M1J B;  1RE4 C;  3CI9 A;  1RE3 A;  3H32 B;  4W7Y A;  3GHG A;  1RE4 A;  2FYU K;  1L4A C;  1JTH A;  3HTK A;  3TNU A;  5AVX B;  3P7K A;  5APW A;  3A2A A;  3VMY A;  2E42 A;  3L36 A;  2P1J A;  1SLQ A;  1CW5 A;  3V2Q A;  3RK2 C;  3NXS A;  5AW5 B;  1GD2 E;  2HFE D;  1JY2 O;  3A5T A;  3TSI A;  4WY4 B;  1LTJ A;  4JF7 A;  2WTY A;  3UIA A;  1S9K D;  3M06 A;  4W7Z A;  1FZC C;  1KIL B;  5AVZ B;  3MD0 A;  5APT A;  1SFC C;  2IX7 C;  2N1T D;  2IFN A;  3R2P A;  1FBM A;  5AW1 B;  2H43 A;  2OYH A;  2QM8 A;  2FFD A;  2FYZ A;  4EOT A;  2HOD B;  3VP8 A;  1URQ B;  1KFN A;  1N7L A;  2NPS C;  3OJA B;  1FU1 A;  1VDF A;  3HE4 A;  2Q5U A;  3TK1 A;  2KP8 A;  1OXZ A;  3IFM A;  2W27 A;  1FZA A;  4W80 A;  1JMM A;  3VMX A;  2HPC A;  2XZR A;  5AW7 B;  1NTK K;  1XTC C;  1JY2 P;  3NFQ A;  5KTB A;  2YNY A;  2HG5 D;  3L35 A;  3M9Q A;  1RF1 A;  4AQR D;  1URQ A;  1VPC A;  3HUS C;  2N1T B;  5CCG C;  2FXM A;  1T8Z A;  2YKO A;  5AW0 B;  4N3Y B;  2WPS A;  3B5N D;  5KJ7 C;  2WSC H;  4C7R A;  1KQL A;  3KDP B;  5AVR B;  1HH0 A;  3V5B A;  3MTU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...