2KM8B

Interdomain rrm packing contributes to rna recognition in the rna15, hrp1, anchor rna 3' processing ternary complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
84
structure length
84
Chain Sequence
NPPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQLGSRFLKCGYSSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Protein-Protein Contacts Facilitate mRNA 3'-Processing Signal Recognition by Rna15 and Hrp1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
molecule keywords 5'-R(P*UP*AP*UP*AP*UP*AP*UP*AP*AP*UP*AP*AP*U)-3'
total genus 8
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2km8B00
1X4HA 2RT3A 3ZZYA 2ADCA 1YHQS 1U1RA 1SJFA 2LCWA 2VOPA 1FHTA 4CH1A 2MZJA 2E44A 5GAGU 2CPHA 1U6BA 3R1LA 1Q86T 1D9AA 2M0GB 1ZZNA 1UAWA 4IOCQ 2MGZB 1X4CA 2N7CA 1BY9A 5LXRA 2RNEA 2PE8A 2RQCA 4LMZA 1WWHA 1QM9A 2CQCA 5JVGQ 2DISA 2LA4A 3DXBA 5DDRC 3CUNA 1WEZA 1QVGR 1WHXA 5IM0B 2HYIB 1VC5A 3CCQS 1Q81T 1HA1A 2CQBA 3P5TL 1OPIA 1U1PA 2BOPA 1U2FA 5LJ3Y 3JB9k 1DZ5A 1YJ9S 1VC0A 2XB2D 2XSFA 4Y0FA 2ADBA 1WI8A 2MKJA 5H1SV 4WFAQ 3IWNC 1U1KA 4C0OC 1K9MT 4YUDA 3VAIA 5GVQA 1CVJA 1N54B 2CQDA 3RW6A 4M5DB 2N3OA 1VQ8S 4OZ1A 2G1DA 3MI7X 2D3OR 4P6QA 2DIUA 1VQMS 5IM0A 2Q79A 2VOOA 1UFWA 3VALA 1WI6A 2MGZA 2QA4S 1QVFR 2WBRA 1OO0B 2YWKA 2E5HA 3MUVP 1FO1A 1SJRA 4C7QA 1HD0A 1D8ZA 1AUDA 1WEYA 2DNZA 1VQNS 4CH0S 1X4GA 1P1TA 3CCES 1VQLS 2HVZA 2L9WA 5DETA 2LECA 3NNAA 1VQ7S 3P6YC 2MSSA 3P49B 2KM8B 3TP2A 2E5IA 2XNQA 2CQPA 2DO0A 4F25A 3EGNA 4FXVA 2AYEA 1KC8T 2FHOB 2KH9A 1FXLA 2DGUA 1WG4A 2CQ2A 2DHSA 1U1MA 1U1LA 4TU9A 2DNPA 3CC2S 1M5OC 3TO8A 2K8GA 4PRFA 3EGZA 2DGXA 2KRRA 3H2UB 2DNHA 1U1QA 3TYTA 3J7ZT 1N8RT 1JJHA 2RS8A 3MUTP 2MB0B 1PGZA 3UD3P 4WFNQ 2MXYA 4ERDA 1WHWA 1X4BA 4QPTA 2N3LA 3S7RA 2LKZA 2MSTA 2M70A 2MZQA 3CULA 2HZCA 2V94A 2CPZA 2CJKA 2KXNB 1Q7YT 2KT5A 1O0PA 3S01A 2L08A 2KG1A 2U2FA 2MZ1A 2MQMA 3CCVS 2O3DA 2RUGA 1X4AA 2MKHA 1WHYA 3J7YU 1VQOS 4J5OA 2M9KA 3CMES 2VONA 2DB1A 2JX2A 2LA6A 1ZH5A 2ZJPQ 4WKRA 5HL7Q 2KXHA 2M7SA 1VC6A 2DNQA 2N82B 2CQIA 5EN1A 2DNMA 5JVHQ 2B0GA 1HL6A 5GAHU 3CCSS 3G8SA 3CCUS 2RQ4A 2F9DA 5GAEU 3CMAS 1WF2A 3OW2R 2MQLA 2AYMA 3L3CA 2CQGA 3UE2A 4YB1P 3SXLA 1SXLA 1RKJA 2AYGA 3FEXB 1VBYA 2M2BA 4WIIA 4QQBA 2BZ2A 3SDEA 2CQ1A 3BS9A 2KXFA 4YOEA 3VAGA 2JWNA 2DH8A 1ZZFA 3CC7S 1JJ2R 3EX7B 2LXUA 5LSLA 1S72S 4IUFA 3BO4A 1U1NA 2X1AA 3MDFA 3IRWP 2AYBA 2OTLS 2F9JA 1M5KC 1H2UX 1K73T 2M4MA 1X4EA 1DHMA 2PEHA 3P3DA 2JVRA 1R8PA 2HGMA 2K3KA 3G9CA 2OIHA 1WF0A 3THTA 2CQ3A 2F3JA 3D2WA 2DH9A 2M8DB 2JVOA 4W90B 1WTBA 4TU8A 2DK2A 1NO8A 5LSOA 5CXTA 1P27B 1X5SA 3NS5A 2NLWA 2MZSA 3CD6S 2EVZA 1VQ6S 2CQ0A 2MJUA 2LEAA 1DRZA 1X0FA 2DGQA 3CCLS 2GO9A 2ZJRQ 1M5VC 2MQQA 2OSQA 1HD1A 5D78A 3UWTA 4EGLA 2MZRA 2DNNA 2MMYA 1VQ9S 2JRSA 5LJ5Y 4FXWA 2DNGA 2CPDA 3I56S 5IFMA 2I38A 2XS5A 4TLQA 2FPHX 2FC8A 3MD3A 2MPUA 3FEYB 2DHAA 2CPJA 3R27A 1Q82T 4Z2XA 1JJ4A 1FJCA 2UP1A 1N52B 1A9NB 3DLLQ 1OWXA 1DBDA 3ZZZA 3G96A 1YITS 3S6EA 2FY1A 2DHXA 3MD1A 3CCMS 2HGLA 4W92B 1FT8A 3THPA 5HO4A 2M52A 4WCEQ 4CQ1A 2DHGA 2KFYA 2L41A 1URNA 3N9UC 3UCZP 2MYFA 3UCUP 4QU7A 2MKSA 1YWXA 2MQPA 4UQTA 1X5TA 2A3JA 2DITA 3LQVA 5D77A 2FC9A 2MQNA 1SJQA 2CPEA 2DNLA 2E5GA 3H2VE 5ITHA 3BO3A 1WHVA 2X1BA 2MJNA 1KD1T 3CCRS 2M88A 1YTYA 5CA5A 3UD4P 2YH1A 2YTCA 3NMRA 1IQTA 3I55S 2CQHA 2XNRA 2MKIA 1PO6A 1N88A 2YH0A 3CC4S 3S8SA 5DDQC 2NZ4A 3CTRA 4LIRA 1NJIT 1H2TZ 2RS2A 1KOOA 1YI2S 1X4FA 2G0CA 5FJ4A 5DDPC 3G4SS 2DNYA 3CXCR 2OSRA 2U1AA 1VQ4S 4F02A 2DNOA 2CQ4A 3NNHA 2LMIA 4ED5A 5BJRA 4WF9Q 1U1OA 2DNRA 1A7GE 5MLCV 2DGSA 3CPWR 2AD9A 4UY8T 3HHNB 4RU2A 1JMTA 5GMKa 2QFJA 2XS2A 1WF1A 1NU4A 2X1GA 2SXLA 3PIPQ 1VBXA 2DNKA 3G71S 1H2VZ 1KOHA 3VF0B 2DGTA 5DM6Q 1YIJS 3HI9A 1SJ3P 1SJ4P 2EK1A 1G2EA 4IOAQ 2MKCA 3SMZA 3VAJA 4A8XA 2ZJQQ 3CCJS 1H6KX 3SDEB 2KG0A 2GHPA 1VQKS 1B7FA 1KQSR 2CPFA 2M8HA 1U6FA 5LXYA 2MQOA 1M1KT 5GADU 2XS7A 2KVIA 1UW4A 2KM8C 2DGWA 2QEXS 2ERRA 1UP1A 1R8HA 2J0QD 2LYVA 4OZ0A 4PKDB 3BEGB 1WEXA 3B4MA 2DGOA 2J8AA 3G6ES 3NNCA 1RK8A 3LPYA 2KHCA 2MKKA 2DO4A 2E5JA 1WG1A 3Q2TC 3R1HA 2MY8A 4CIOA 2RRAA 3UCGA 1XN9A 3VAHA 2YKAA 3B4DA 2MZTA 5CYJA 4U67Q 4TU7A 4F26A 5DM7Q 4ZKAA 2OTJS 1WG5A 2D9PA 4WFBQ 3U1MA 1L3KA 4PR6A 2MHNA 2VODA 2MY7A 1X4DA 1FJ7A 2G4BA 4LJMA 2KRBA 3RW7A 1S79A 2CPIA 2KYXA 1FNXH 3BO2A 2J0SD 3CF5Q 3ULHA 2D9OA 3V4MA 1WELA 1M5PC 2LQ5A 2J76E 1YJNS 3VAFA 3PIOQ 3U1LA 3Q2SC 1X5PA 5IQQA 1VQPS 2DGVA 4BS2A 2KI2A 2RU3A 2RVJA 3NS6A 2CPYA 1YJWS 1FJEB 1K8AT 3MUMP 3MXHP 2OJ3A 3G8TA 4V19X 3US5A 5DDOC 1F9FA 4IO9Q 4C4WA 1M90T 2EK6A 1VQ5S 2X1FA 2KN4A 3VAKA 2I2YA 2KU7A 1X5OA 4QU6A 3MURP 1OIAA 2HGNA 2LEBA 1VBZA 4Y00A 3VAMA 2DH7A 2LXIA 2CPXA 3MOJB 1W2BR 2RRBA 3K0JA 2DIVA
chains in the Genus database with same CATH superfamily
1X4HA 2HBZB 5M2RA 4DCPB 2VBWA 3GFXA 4RR5A 4JI4F 1BQMB 1SC6A 6FDRA 1K1SA 2ZBCA 1YHQS 4USJC 1D8YA 1UZHA 1FHTA 3BSNA 2CJ9A 3P96A 2W4DA 5GAGU 2CPHA 4OX9F 2B8PA 2V50A 3GU0A 4O44A 3NGDA 3LP2A 1D9AA 4OV1A 3LWMA 4ED3A 1I94J 2VU5A 2ALZA 1JXVA 5HMZA 4OZ3A 1FX4A 3H4DA 4YP3A 3VHQA 4MIAA 5DZ6A 2N7CA 3IRXB 1RTIB 3JSBA 2RNEA 2PE8A 2RQCA 4PAAA 2DEIA 1NJWA 4IQXA 4HDGA 2BBEA 4O3NA 3BZQA 1SV5A 5KG1A 5JVGQ 4WU2A 4DDFA 4J9LA 2YX7A 3AD9C 2H5EA 2C3OA 2JOQA 2WOMA 2GVDA 1DJ0A 1WHXA 2CWKA 2GMLA 2HYIB 1NLKL 1CJUA 1VC5A 2AKWB 2VD3A 1S9GA 2VQFF 4LFCJ 3CCQS 1SB6A 3JAMU 3A8JA 3AA9A 3HX9A 2QC3A 2ZFHA 3H20A 1HA1A 2ILZA 2Q66A 4ZLPA 4Q43A 3JQMA 1RWNB 3JSMA 3RR7A 1Y5LB 4DQQA 1R31A 3C15B 2BQRA 1TL7A 5DRKA 1GMWA 1RTJA 2XZWA 3GV5B 1YJ7A 5LJ3Y 4E8UA 1YJ9S 1IJFB 3GQCA 1S0MA 1VC0A 1TU0B 2XB2D 2BDPA 2ZVSA 1I1GA 3WIUA 4Y0FA 1K44A 5H1SV 2OLWA 2W2NP 4EEYA 4N41A 4P52A 1OJ4A 1NDPA 2HURA 3EDQB 3D3BJ 4Q2LA 3PYEA 2V8DA 3IWXA 1U4BA 1Q0NA 1W26A 2ACMA 2NSBA 1CG2A 4YB5A 5GVQA 4BC7A 3VAIA 4DQSA 1X9MA 2RU9A 2N3OA 4OZ1A 2OUGA 4J91A 2IVFB 2CDQA 2WK4A 2DR8A 5IM0A 2FUG9 2ZITA 2VOOA 4KGMA 3PY8A 1JJCB 4RUAA 1I94F 3LA0A 4YEAA 1XR6A 2YKOA 5KT2A 4NYPA 2B9EA 2MLXA 3PW7A 2HWIA 3MCNA 2MGZA 3WDOA 2FHJD 2QA4S 2YPYA 3G8QA 3D6MB 2LU1A 2YWKA 2VFUA 3MUVP 3MR3A 3TUZC 1HBUA 4C7QA 2WSCC 1HD0A 2YX1A 3DMJA 5F8MA 5KT4A 5EWEA 3H4BA 3GV8B 2N4CA 1RAJA 3K2YA 1VQYA 5EHHA 2UV8G 4CDIA 1JLGA 1TELA 4ZLJA 3O2IA 2L9WA 2VB6A 4IYQA 4LF6J 3NNAA 4LSNA 1UWBB 3B82A 1SCJB 1CJVB 2LVWA 3DGPB 3ISZA 3NGTA 4DV1J 2OHDA 4IRCA 3P49B 4JI1F 2E5IA 1RT1B 2XNQA 2CQPA 3N0VA 4F25A 4C48A 3K5NA 5L39A 2PN6A 1IBMF 4HACB 4O4GA 1Y7PA 2ZHAA 1RP5A 4X64F 1IR1A 1RU2A 3IP0A 4TU9A 2DNPA 3ENWA 3R7SB 2QLBB 3A3OB 3BYPA 1YLXA 3OTEA 4P9SA 4KHPJ 1N33J 2KZZA 4LVOP 3TO8A 5CAAA 4ELTA 3SCLE 2K8GA 1HFEL 4LF9F 4LF4J 2PGCA 3CB4A 4ILRA 2IM2A 3Q0AA 2NUHA 4O4RA 2DGXA 4DR2J 7FDRA 3POTB 2EFGA 2VG5A 4F3MA 1N8RT 3Q89A 2RS8A 1TK0A 1FNMA 3RG6A 2MB0B 1PGZA 2AJ2A 1GXTA 1NZAA 4LFAF 1CBKA 2MXYA 4KH1B 2QZ8A 5E3AA 2BJDA 3K7RA 2V67A 4YY3F 2YNGA 4AL5A 4ERDA 4ZLNA 4K4VA 3OFGA 1S10A 1S1VB 2M70A 3CD0A 4LBPA 3W65A 3SQOP 3RB4A 2C2EA 2A2CA 2AMCB 3EICA 3G2XA 5KFTA 1UVJA 2FQQB 5LMUF 2QL9B 1RLCL 1T0TV 5HAOA 1GEHA 2B3TB 1CULA 3S01A 1HNVA 4ANCA 1XERA 2DY9A 2MZ1A 3SYZA 3UNYA 4ZOSA 3TI0A 4RW4A 3RBDA 4P71A 2Z2LA 1VQOS 2HFUA 4J5OA 3TWZA 2KVQE 4MFBA 2F8EX 2M9KA 3FBCA 3HHEA 3ZZOA 3CMES 4B3RJ 1FTCA 4I2QB 2B51A 2KXHA 3NL0A 4D3HA 2DNQA 3U02A 2NCKL 1GNKA 4C8YA 4HI1A 1VHFA 2I1RA 4XPEA 4JV5J 2DNMA 1RTZA 4UOGA 2NQPA 4RW8B 4FBTA 3PRVA 5L46A 2HFVA 3DXSX 1WSVA 2CVIA 2HKEA 1GMUA 2DKOB 3BB5A 4B3TF 4P2MA 2CYYA 1S4EA 4Y34A 1PJ6A 1NPPA 4LF5J 3OW2R 1RB0A 1WF2A 4O3RA 2E9ZA 4V19J 4JV0A 4NLTA 3OFFA 4A8QA 1HBNA 2BKPA 2V2QA 4DX6A 1HNZF 2WSFC 3WZ0A 3OSNA 2B6AB 4YB1P 1M1HA 1RJJA 4LSZB 3H5YA 1UVIA 1RKJA 3IBCB 2O01C 4CM2A 1DQ8A 1UA1A 1VBYA 3DRPB 3BN4A 2M2BA 3LW5C 1N56A 4LRAA 4QQBA 2ACYA 5I42A 2CQ1A 3KG1A 2K2PA 2JWNA 3KHGA 2YNGB 1RHQB 2PMHA 3FDSA 3O44A 4NCGA 5KFXA 3LPEA 1ZZFA 3M9MB 1IKWB 3CC7S 1EARA 1S1VA 2BOAA 2YWEA 5BR8F 2XCPA 3JSRA 4GO7X 2B4VA 3AJDA 1TV6A 2HNYA 2ZH5A 4JYAJ 4L72B 3MMBA 3OTDA 2BJ3A 3J7A1 2EBGA 3AH6A 3KUGA 4GMKA 4F0KA 4ZK7M 4DG1B 3IGNA 4U7CA 1KEKA 3ZTPA 1FWLA 3ENQA 5KFOA 1IBKF 1H2UX 2JFKA 3MWBA 4IFVB 1M5KC 4DR6J 5ETSA 3AFGA 2CUYA 3V5RA 1IXKA 1SI9A 1W2IA 2RJZA 3IO1A 4O23A 4PABA 2ZH8A 4ED7A 1R8PA 5KFEA 1T05B 3TA2A 4JI8F 3I4HX 1Q8BA 4L6V3 2K3KA 1UW9A 2OEJA 3HSZA 4NOHA 2J9DE 4KSEB 3ZZPA 5KFNA 4B9NA 1B64A 4ID5B 2OIHA 2OD4A 1D9DA 1U2CA 4ZHRA 4KPYA 1JWWA 7FD1A 4NE9C 3TVKA 5F41A 2DK2A 4DR3J 2UVWA 3UD5A 4A8WA 4Y2MA 1BXNA 2BABA 3NS5A 5D4NA 1F3VA 2IFXA 2XYHB 2Z2YB 3K57A 2C2RA 1U25A 5HJXA 2MJUA 1KWMA 1DRZA 2E9RX 2ASLA 2RRNA 5IWAF 3CVKA 2GO9A 2ZJRQ 1RWMB 2XSJB 4DX7A 1M5VC 2MQQA 5DO2A 5KT7A 2YY3A 5D78A 3UWTA 2FJVA 2GAGC 2OPRB 5A6WA 4JI6F 1X9WA 2DNNA 1N6QB 1FDBA 2P9GA 3SI8A 4RW6A 3VQTA 4BWMA 1VJWA 1ZM3A 5D4LA 1FFGB 3ZZRA 2JHEA 5HVHA 2QT7A 4NLGA 4OZ2A 4GC6A 4DMZA 1WC1A 2BQUA 1KSPA 5KFHA 3AAWB 3DLBA 1Y3JA 2IJRA 2V34A 3E8OA 4B9TA 3WHIA 2WVCA 3I0SA 3R2CJ 5K8PA 1B7YB 5HP1B 1JKHB 1H74A 2PFFB 3EMTA 1G3OA 1S1WB 4G1IA 4TLQA 1F1BB 1UWAA 3M30B 4QZVB 4YS2A 3M1VA 3MD3A 1SVDA 1I51B 2BANB 3EZ5A 3M8QB 5CYMA 3HFVA 4CLYA 3R27A 3VZHA 4R0JA 3R5AA 1JJ4A 2R7RA 3I0RB 2UP1A 1RBAA 3KLGB 2HHTA 2VUGA 4PXCA 1U8WA 1TAQA 4ZPCA 1RAIB 1DBDA 4K4SA 4K4ZA 2BKNA 1YITS 3S6EA 1QSLA 4I6WA 3HPOA 2GCFA 4HDHA 3F73A 3CCMS 1NMEB 2N4DA 2D1CA 2HGLA 3L4BC 3ZZTA 3THPA 3QRPA 3MMCA 1MROA 3MEDB 1HW9A 4NLUA 4HTJA 1D1UA 3OVBA 1JLCB 2L41A 3N9UC 1HWUA 3A3NB 2CNKB 2L48A 2QFIA 3KK3A 3CJSA 2W8LA 1VS3A 2MYFA 4I64A 2VG6A 2Q3PA 3NLCA 2EEYA 1F5CA 4FYWB 4OYZA 2MQPA 3DRSB 1N0VC 3JQJA 3PFOA 3QIPB 2IRUA 4NA3A 1TAUA 3HF5A 4IH5A 1S6PA 4ZVTB 2ZKUA 1SJ1A 2B9XA 4OYWA 5HQMA 4CM0A 1YSJA 2MQNA 3SQGB 4RW6B 5CABA 1RT2B 3BSAA 3QZ8A 3GCXP 3BO3A 2EXUA 2X1BA 2MJNA 2VDHA 2P9CA 4OHXA 1RI7A 1VYAA 2LQ8A 2FLPA 2G2ZA 3I6PA 3I0SB 1JNZB 3G87A 1ZPVA 2FZGB 2N7YA 4FN5A 4GVBA 4AFFA 2H3EB 3H98A 3NMRA 1IQTA 5AT1B 3I55S 2CQHA 4WTOB 3MM5A 4FF2A 2PMZD 3T1YJ 2RDIA 3HJFA 5CYMB 4L73A 3BPDA 5FD1A 1N88A 4TVAB 1NK6A 4ALZA 1F9EB 3CC4S 2OEKA 2ZBRA 3KK1B 5DDQC 4OYBA 3CTRA 4V1Ak 3MMAB 3KTQA 4M5KA 1N33F 1SIWB 3DDIA 5IT0A 1CULB 1X4FA 2BA9A 4ZS6A 3PX6A 2HHQA 3VWSA 4B9VA 5K8MA 2HVIA 2DNYA 1AROP 1TUWA 1FK9A 4LT6A 3CXCR 1T7PA 3HHDA 4OJGA 5DG9A 4MFBB 2E1AA 2KYZA 3G82A 2V4JB 3A13A 3CJQA 3NNHA 2GIFA 5HMWA 2E1CA 1RAGB 1NSKL 4R5PB 1MROB 1HIYA 4X62J 3QRRA 3TA0A 3FFIA 5A0YB 1U1OA 2L9DA 3AQOA 4DZDA 5MLCV 2FVSA 1C0UB 3ENAA 5IOLA 3KK3B 4UY8T 3HHNB 4DR3F 3W9IA 2VFSA 5IV3A 4A47A 1WF1A 1T03A 3LAMA 2DNKA 3HHLA 1H2VZ 1S49A 2FHJA 2RE1A 1KHWA 3DN9A 3HVAA 3GYGA 1KOHA 3HVTB 4ZJOA 3FJ2A 1HI0P 2UU9J 1XC9A 1RT2A 1T3NA 2DGTA 4LBIA 4I2QA 1RYSA 5KT3A 4MYUA 1G2EA 2CDRB 2YQ1A 3GR1A 4HKQA 5KFSA 3PACA 4QR0A 4A8XA 2V9WA 2QO3A 1SKRA 2IMWP 1G4CA 3IR5B 2IA0A 2ZJQQ 5I42B 4KT0C 4EBCA 1H6KX 4JP8A 2KG0A 1NJYA 1TL3B 2GHPA 5E3PA 1BMQB 4F4XA 2BX6A 1S9FA 2KHDA 2M8HA 5HK4A 5LXYA 2A10A 2R2UA 5KFYA 2HK2A 2V0NA 4P10A 3BM7A 2UZAA 1U45A 2HW3A 4IG3A 5AXNA 2DGWA 1S6QB 1RADB 4QJVA 4MIBA 4J7CA 2LYVA 5C42A 4OZ0A 4PKDB 3M6WA 4CRJA 2ZWPA 3H0PA 3L09A 3RUBL 5KOXA 5GAGI 3CDUA 5HANA 2J8AA 5THWA 4B02A 2VZ9A 2HWTA 5L1JA 4R5PA 4DQRA 3V4IA 4LF7F 1AZSA 4C8NA 4RW9B 3PW4A 4ER8A 3LPYA 4LREA 4ED8A 4B3TJ 1LV5A 2HNZB 2DYAA 1C0UA 1WG1A 3QPIA 3M6XA 2HK3A 2R7UA 2OPSA 1DTTB 2ZD1B 4M5HA 5IZHA 3OTOF 4NXMJ 4B3OA 5F8NA 2HAFA 4E0DA 2B9WA 4ZA1A 4X4SA 3OBIA 1EAYC 3WX8A 3MM9B 4ZP8A 2HHVA 4TU7A 4U6PA 4RNMA 4LSLA 4EO8A 4QWEA 1MW7A 1D9FA 3CJRA 3W5XA 1QTMA 2D9PA 3GFHA 2DTJA 2LQ9A 1T05A 1L3KA 4DEZA 4JI7J 2XLKA 2R8GA 4PR6A 5IXUA 2M5YA 1FRXA 4ICLA 3ZZUA 1DTQB 4OX8A 1FTRA 2UUAF 4ELVA 3BDEA 1PIEA 2NXNA 1BHNA 4ZJLA 4ZVGA 3V81A 1MSWD 1FJ7A 2FJEB 2JZ5A 4MKBA 2X51A 2KRBA 2ZZTA 2H9ZA 3CCWA 5DQGA 1JLFB 3C6TA 1UVLA 2CFXA 2GVZA 4ITSA 4RBTA 4ZVOB 4EO6A 2F40A 2QTWA 5A8RB 2V4QA 1FEHA 2CPIA 1J5EJ 1ZAXA 2VA2A 3MCMA 4WPAA 3MECA 3M2UB 1CJTA 2IM1A 1LWEA 3ULHA 4OHWA 1SC3B 4K5SA 2OPPA 4KO0A 1YJNS 4ANDA 4H4KA 3TUJC 1LW0B 3H90A 1T3OA 1IKYA 5ETVA 1N5SA 4A8FA 1ELOA 3NOCA 4ED0A 3Q2SC 3OJSA 2I0XA 4B3MJ 4URSA 4C8MA 1UKUA 3GB0A 4DR4F 4X4OA 4O3SA 4ECUA 4KRWA 3K58A 4X84A 2BRLA 5LL6d 3ZTQA 2RVJA 1HWKA 3HT0A 3SBMA 1F2HA 4A46A 1R8BA 3TA1A 2GMHA 3G6VA 2IRYA 4OZJA 2W9BA 1K8AT 4K7QA 3MXHP 1Q79A 3QAUA 2Y1JA 4NLXA 4NZ6A 3US5A 1C4AA 1V5VA 3OL9A 1HPZB 1F9FA 4IFYA 4I1TA 4IO9Q 4DV3F 2EK6A 2GQCA 3M8QA 2KN4A 5A8WB 1JQGA 1IBMJ 1R3NA 1RT4B 2OPQA 3QLHB 2UUTA 1LFWA 1HQUB 4DV4J 5KFCA 1X5OA 1HWIA 1T8EA 4N76A 4QU6A 1Q78A 1HNXF 2HHSA 3KLGA 2HNDB 4RWWA 4KH0B 2AHOB 2WHOA 2DH7A 3DRSA 4TN2A 1NJXA 2HG4A 1YBUA 5D0HA 4C0BA 3B6BA 1W2BR 3K5PA 3CJ3A 1NKEA 1RCOB 3SCKE 1OS5A 1RAEB 4B9LA 3N4WA 2C2OB 2R42A 2RT3A 4ZVHA 3RRKA 2RSQA 2V63A 2QLWA 8ATCB 2NXJA 4IOBA 2BE2B 1HMVB 3ZZYA 2GV1A 3N5FA 3QWUA 3GILA 1SJFA 3HP6A 1YJVA 2EKYA 2R8KA 1HBOB 1FCAA 2QSFA 1AW0A 2A6MA 1V9OA 3TJAA 1JXLA 4CH1A 1SH2A 2E44A 4A4JA 2B4PA 2XMJA 4R0EA 5AXKA 4DSLA 3M32B 2PT0A 2M0GB 3R5JB 4IO1A 4ES2A 3WC0A 2AU0A 1Q86T 4NCAA 3OR2B 3OXLA 2HVEA 2HBYB 3KHRA 1TMJA 4DR1J 1PYOB 3BF4A 3ISNC 3SCIE 4LMZA 1WWHA 4ZJQA 2CQCA 3OPKA 5ETQA 2GA7A 1CQNA 1RLDA 2DISA 3DXBA 5F9NA 5DDRC 4ZP7A 4Y28C 5ETPA 4D3GA 4UT4A 1HR0J 4NWBA 1QVGR 3LTOA 4Q7AA 3OL8A 2MTLA 2ZDPA 4ZPTR 3OHBA 2QYCA 3EM1A 4G3IA 3LOUA 4NLPA 2R7VA 1Q81T 1RWKB 2UV8A 4F7VA 5KTQA 1KQGB 1GK8A 1MN9A 5KG4A 1SC4B 4IKAA 3UW1A 1RT4A 2UVRA 2E29A 5L9NA 3PYGA 1OPIA 2R2TA 1UVNA 8AT1B 1DFDA 3FCHA 2BOPA 1EKSA 4LF8F 3HKZD 3FUYA 4A8KA 3PV8A 4LFCF 5E0OA 1CPZA 3BSCA 9ATCB 4DR5J 1RISA 3C14A 5DQIA 3IN5A 2BMBA 5HVGA 3MR2A 2K1RA 3O5TB 4PQUB 1S1TB 3HVTA 3R7BB 5C2CA 1Y5IB 1U1KA 4NI2A 1WNEA 4C0OC 3IWNC 6AT1B 4YUDA 1WDDA 4MKVA 4I7FA 1OYDA 2F4FA 2XI2A 3VVTA 5AXLA 1HI1A 1RT3B 3RW6A 1VIXA 3R5BA 3I96A 2G1DA 1B70B 4AQYF 1NKCA 1ZOTA 4P6QA 2DIUA 2DCUB 2QSWA 1DARA 4I6YA 3QWPA 1UFWA 4HYKA 3K17A 4M5JA 3BKFA 2EFPA 2DRAA 3N6LA 2Y1LB 3CO0P 4IQMA 3TZXA 2ROGA 5H9FK 4Q0BB 4TKTA 1F2GA 1Q5VA 2WBRA 1U47A 2Q43A 2IY5B 2E7VA 2QG9B 1RT7A 2E5HA 1SJRA 4FP9A 2KT2A 3O1LA 4RUCA 3TARA 2DPIA 2FLLA 4CCHA 2XO6A 3GG1A 1WEYA 4ES1A 5HVFA 3G6YA 2I6WA 1MU2A 4CH0S 1P1TA 1VQSA 5I3UB 2IAJB 3CCES 4C6AA 2FHKA 3TVYA 2ZH4A 1VQLS 2LECA 1S9GB 1Y00A 1VQ7S 2HMIA 2BEFA 5K14A 1N36J 3P6YC 1RHMB 2CVEA 2DR5A 4C3LA 3KFWX 1UMJA 2VC0A 4OJ1A 3PX4A 3OV7A 1ZAWA 3EGNA 3EXYA 2AYEA 2HS4A 3QBCA 2HHXA 2FHOB 3Q8YA 1P8GA 2DGUA 4CLFA 2WVFA 4OZ5A 1VGYA 1WACA 2HFSA 4EBDA 3J7YI 3NY0A 4DS4A 1U1MA 3J80U 2H1YA 4DX5A 3G86A 3TJ8A 1NB7A 1R0CB 1M5OC 5F3ZA 1X7VA 5D6GA 1I5OB 2CG8A 2EI5A 3BR8A 3NBPB 2WZ1A 4NI2B 5D4PA 4MKAA 3K8WA 4OYIA 1S1UB 5A6PA 5KG7A 5J2NA 3MMJA 5AXMA 2R8JA 2DNHA 4U8YA 4DUYJ 3V4IB 4DOZA 1DQ9A 1U1QA 2UXCJ 4CWBA 4OL8A 4QIVA 2V5HG 1WOSA 2UUWA 3ENVA 4RKUC 2EG1A 4DPUA 4OHYA 3BBFA 1REGX 3OTCA 1PC4A 3ZTOA 4GKKJ 4WZMA 3KLHB 2UXDJ 2E7WA 1WHWA 2KTQA 1XTZA 2C3PA 4QPTA 4KPCA 5D0EA 3PZPA 4MK9A 2YKMA 3GYNA 2MSTA 2AV5A 3D3CJ 4NLWA 1J5EF 2MZQA 2VF3A 1A0OB 2WW8A 4XK8C 4KV8B 4U7UK 1KQFB 2HFNA 4LRCA 4CO0A 3OJUA 2CJKA 3A4TA 3FGVA 1Q7YT 1H7XA 1O0PA 3TNVA 2AEMA 5C5JA 2Y0SD 2U2FA 2KG1A 3UI3A 2FY8A 4F4KA 4OI4A 1WHYA 3J7YU 4M5NA 3BDPA 4ZP9A 3PW0A 1XNRF 1S99A 4PXBA 4DR7F 2GZOA 2OKQA 2ZJPQ 2WB1D 3W8PA 2GVZB 2VG7B 3VV2B 5ADZA 2N82B 2XWXA 3H42A 1K0TA 2XC9A 5EN1A 2W9BB 5G4DA 2XLIA 4JI0F 1GTEA 1B0PA 1EKRA 3MTKA 1QUPA 3DLEB 2NS1B 1R89A 5LSRA 4FXDA 1HL6A 2BV3A 2QJ3A 3G8SA 3EE3A 5L1KA 3CGIA 2RQ4A 3CJ2A 3FMWA 3EGWB 1VIOA 4F67A 2P5VA 2XULA 2EKNA 4LRFA 2RKIA 4TYAA 3AD7C 3UE2A 4FYYB 2Y9HA 4X4TA 2DRDA 3D0IE 2AYGA 4DJBA 5IT4A 2HQFA 4NMLA 3TX8A 4C8OA 5HMYA 4C98A 4XIUA 2V69A 3GIRA 4LR9A 2HHPA 3SDEA 4YOEA 1GT8A 2J7WA 3MPWA 3BQ2A 2HIYA 2KZMA 3IXQA 1FESA 2FD2A 3EX7B 2XCAA 4FVMA 3R7NB 1B4SA 1Q5YA 3CMQA 2E1PA 3ILLA 1YRXA 4MK7A 4F4YA 2FHMA 4IUFA 3LP2B 2WSEC 3MHYA 3T9ZA 3BV8A 3VGTA 2X1AA 1CJKB 1XIQA 2F9JA 4BCAA 2OTLS 3AQPA 3OUYA 3ET6B 2AF6A 1X4EA 3IRXA 1RCXB 1NK8A 5E3CA 4P73A 3NCQA 1HHQA 4RPFA 3DNCA 1AYEA 2BE2A 1APSA 1PAUB 2VG7A 2APOA 1PKUA 3IR7B 1MN7A 2PEBA 3I5CA 4DV5F 2AT1B 2GMJA 1RAFB 3H5UA 1KFDA 4I0WA 3THTA 2DH9A 5EUHA 4LRDA 4CT9A 1NPKA 3CJTA 3PTWA 4NLOA 1UEUA 5DG7A 2MZSA 4QIEA 2DEJA 2VBYA 4KJIA 1AT1B 2ZUGA 1VQ6S 2IVYA 2CJYB 3K59A 4FPRA 3HD1A 4UW2A 1X0FA 3ITHB 1UPPA 2ZH3A 2DGQA 3B78A 1TL7B 1T95A 1WC6A 3H59A 4CP5A 4DPOA 5K8NA 3RAXA 2IYIA 3H2LA 4DG1A 2EPIA 3C14B 2VFTA 1HQEB 3KKFA 3P8BB 4F4WA 3HHLC 3BKTA 4RNHA 3AJ2A 4WP3A 1OQ3A 3UPFA 3QO9B 1NDLA 5LJ5Y 2HHWA 2VDIA 4DSEA 3LGNA 1WC3A 4X4PA 4Z7YA 2DNGA 5L1LA 4ETXA 2CPDA 2CJBA 5IFMA 1GMVA 4TQRA 3KJNB 4USWA 4YDXA 1S6UA 2XS5A 3D1HA 1IR0A 4DU7A 2GJ2A 3IAS9 4H4KC 5CYQB 4N56A 3RB0A 1VRUB 2XMKA 4NMXA 2DHAA 2CPJA 3OL6A 3ET6A 3R5GA 3MAQA 1KLMB 4MKYA 3TUPA 2WAQD 5RUBA 3GCWP 2YX4A 4J90A 4ZVPB 4XDCA 3BGRA 2J9EA 5KFZA 5A2QY 4U7UD 2E9TA 2OO4A 3KK2B 2MQ8A 1O51A 1KVKA 5KFPA 3MCOA 4ID5A 5I3QA 4QYZK 3WQPA 1JLGB 1KQKA 3QJLA 4Y3CA 1TKTB 2HHUA 2KJVA 2IAJA 3A8KA 3ZFVA 1Z2ZA 1VOMA 2AZ3A 1YJTA 4W98A 4TLRA 1BGXT 3MEGB 4NA2A 3FKBA 1CJVA 3DGPA 3GWCA 4CQ1A 1AB8A 1UJ6A 4K5RA 4WCEQ 4L75A 1U0HA 3NWRA 4I56A 2HHHF 1K0VA 2KFYA 4YR2A 1NUEA 1URNA 2DBBA 4DN0A 2QA4G 3ITHA 2F1FA 2QLXA 4P2XA 4USIA 3UNGC 3T5LA 2GQ2A 1S7HA 4X4VA 4HL9A 2OELA 2W2MP 4RBVA 3UCZP 1S0VA 5FLXU 3TOQA 3QSIA 1EP4A 2A3JA 4KQZA 2DVIA 4EYIB 4IRDA 5D77A 1TVRA 3FQKA 1VLYA 2H4YB 2IJNA 3OXFA 4N8OA 1SJQA 2XEXA 2CIMA 4N7TA 4A48A 4DSFA 2E5GA 1DLOA 1SKWA 3CJ0A 4Q2MA 3NGSA 5KG3A 5FLXY 1JXEA 4EU0A 4Y2CA 1TL5A 3FCWA 3PG9A 2IHR1 2XMWA 4HACA 1RWUA 4FNIA 4KHRA 5B0GA 3X1LB 1MG7A 2ROEA 1EX8A 3UR3C 4KGVB 3K5MA 2Z30B 1EB0A 1Z4UA 2XZDB 3FVYA 3GTYX 4OIXA 4TY9A 1RKIA 3I82A 3M1VB 3JAMY 4AXJA 4F8RA 3PW5A 2YKMB 1PO6A 2J8SA 1O8BA 1WTFA 4OZNA 3TQ1A 2ZNYA 2NZ4A 3BGUA 3DDNA 1S1UA 1H2TZ 3NRBA 4LIRA 1NJIT 1I6JA 3JS9A 1KNZA 2D41A 2XBPA 2C22A 2NUUG 1KOOA 3POTA 5B0CA 5FJ4A 3CW2C 4H4MB 3T41A 2HZVA 5L1IA 2ZOMA 2H5JB 5F0WA 4NXNF 2OSRA 1DAXA 1ZBTA 2CRLA 4ZPWR 1VQ4S 2J6UA 3MGJA 1RWVB 2ZBQA 3DRRA 4CLPA 3MMCB 1XNQF 1SJ3P 3R5DA 1X8DA 2HAIA 3JXOA 4KB7A 1RACB 2Y0BB 4ED5A 4WIQA 4QIGA 1JLCA 4CO3A 5G0RB 1EQMA 1N34J 2V8HA 4OV6A 3VQSA 3C6UA 4IRKA 2LDYA 1AFJA 4FF4A 3HSJA 4GVBB 4FDFA 5GMKa 4DN9A 4FYXB 2QFJA 2RF2B 2HRTA 4RU2A 3SV3A 4P75A 4M5IA 2MLZA 3G71S 4K4UA 4N8NA 4OHVA 2E1MC 3GE9A 7AT1B 2RDJA 3BBCA 3IS9A 4WFXA 1AUSL 1B99A 5MAOA 3M2VB 4XAKA 2H51B 3OR1A 1T9WA 2AJ1A 4M8LA 3DLGB 3VF0B 3Q8QB 2HQGA 3KXDA 4MH8A 1YIJS 3HI9A 2LP4A 2EK1A 2EWHA 3SCJE 2B6AA 1V3RA 3JYTB 1FE4A 3J7AN 4C8ZA 3LAKA 3DOKA 3K89A 1YRUA 2DCLA 3UN2A 5EDWA 1IBKJ 4OMFG 2ZZNA 2R7XA 4RUBA 3TANA 4PWUA 3IC1A 2OFGX 3IFEA 4P7VA 4P2SA 1SL0A 2AJ0A 1B7FA 2MEWA 1RUSA 4NCGB 4JYAF 1KQSR 1DURA 2BJ9A 3AB4B 5IT9U 1IM4A 5B0FA 4ZCMA 3DU5A 1M1KT 4HHUA 1FFWB 1UVMA 2XS7A 1NPRA 1OSDA 1TV6B 3E3XA 4WBFA 4RNNA 2KVIA 1D09B 1N5TA 2KM8C 3GJQB 3CO9A 4OJ3A 1H98A 2QEXS 3J7Z5 4RO0A 1NNDA 2XS2A 1CLFA 2HSEB 1Q1KA 4ZVFA 1CJKA 4Z37A 3GIJA 4M95A 4ANEA 3B4MA 3KG0A 1SH3A 1JLBA 3D5MA 4EBEA 1UETA 2KB2A 2YWGA 3QT8A 3DHWC 3CJKA 3D68A 4DCOB 3G6ES 1ZYQA 1IKVA 1GX5A 5IQ6A 1IKWA 1RK8A 4K4WA 1C1CB 1WSRA 3I87A 1LKZA 2MKKA 4UZBA 2Z57B 3RBEA 4DZ6A 3AOAA 1NHUA 3HHLD 4USHA 1FXDA 1TL3A 3Q2TC 2XHWA 2V8VA 3AXKA 4JI0J 4YB6A 1RT6A 3BGLA 3GFZA 4JV5F 2VPZB 3CJ5A 2WONA 1XN9A 2IDLA 2YKAA 3B4DA 2MZTA 2QE5A 1LEOA 3M8PB 4ID8A 5CYJA 4C2MA 4U67Q 1R8CA 3HJVA 2KKHA 5CD4H 5DM7Q 1FJGF 3DLGA 2D74B 1QLNA 2CZVC 4H54A 2KDOA 4F0HA 4B3RF 2PI4A 4ATNA 1FE0A 4DFJA 2W7AA 1HKAA 2ABYA 4A8YA 2ZOFA 3W2WB 3FSXA 4Q5VA 1NK4A 1HQEA 3CD7A 2MY7A 4QW8A 3GG0A 1TFYA 2R3VA 3KJFB 5M2PA 4J9KA 2AX0A 1SC1B 1XR7A 2B56A 2IYGA 2VICA 3H8YA 5C24B 3RW7A 5B08A 1S79A 2VC1A 1R6VA 3E01A 1F5BA 1WJ9A 4G1PA 2ZE2B 1JX4A 1FNXH 2POKA 5KOWA 3MM8B 1CQMA 4HH0A 2F65A 2D3ZA 2YXLA 3AY0A 1T9VA 2D9OA 4OX7A 1WELA 5KFLA 3V4MA 5HQ8A 4FNHA 1M90T 3ZXWA 2VJVA 1IWGA 1S1WA 4GKKF 3OTBA 3M30A 2LQ5A 4XPCA 2AJFE 2W2PP 2XYPB 4JOUA 5F8GA 3RBZA 4M63A 3VZIA 4GKJJ 3IWLA 2Y1RI 4I2PB 4EK2A 2HLUA 3PIOQ 4RJVA 2UXCF 3NAHA 4A8SA 3RTVA 3KHHA 1UA0A 4OYXA 2LLZA 1IKVB 2Y8YA 1VQPS 4RW9A 3VR1A 4LF9J 1BD6A 3GJRB 5U47A 4BS2A 2KI2A 2RU3A 4LVNP 2VBZA 1HNIB 2QRRA 1EIYB 4ZVRB 2K7KA 4FVCA 4PG6A 5ETMA 4KHPF 2UUCF 4C11A 3DYAA 2VV5A 1S6OA 4O3OA 4V19X 2V8PA 4O44B 1SQGA 3MEGA 1U26A 1RTHA 2RMLA 4KBIA 4NLSA 1BQNA 3QT6A 1GXLA 1XR5A 2GJFA 2J9CA 4LF1A 2IDEA 3ILIA 3BPSP 3RJMB 1TL1A 5JUMA 2I2YA 2CZ9A 4NASA 4DV1F 4CLKA 4GVLA 1XMOF 3Q8RB 3M2RA 1S76D 4PQAA 3F44A 2HGNA 5D4OA 2BYCA 2PA8D 2OGUA 2Z2MA 4CI0B 3CDBA 4J9OA 2C42A 1QTNB 4KR0B 3I31A 5HROA 3MOJB 2G13A 3PNIA 1ICEB 5J1PA 2MKYA 3L7UA 3WIVA 3K0JA 4PXDA 1H72C 1FDNA 1Y10A 4TY8B 1MWYA 1RWXB 3MPVA 2R9LA 1RAOA 1U1RA 1WOPA 3EGVA 3MEDA 1U0HB 2LCWA 2OMLA 2DRBA 4B3SF 4YR3A 2VOPA 1S57A 2V9KA 1FKPB 4I6AA 1R6YA 4YB7A 1MMNA 2MZJA 3AD8C 1NAQA 3M2UA 1S7IA 2GQQA 3NS7B 3RGIA 2VIHA 3BSOA 1LQ9A 1E6YB 3HMJG 3IG1A 1HPZA 1URRA 1U1NA 2XGPA 3PX0A 2PI5A 1UAWA 3DI6A 1VRTA 2ALYB 3HD2A 4K4XA 4CTAA 1LW0A 3CSKA 3OHAA 2NR0A 4AQYJ 2BUNA 2J0XA 3IMQJ 1BY9A 3M6VA 5LXRA 4DF8A 4DSJA 5KFWA 3V6DB 5H9FJ 2W7PA 1TUGB 3P5BP 4UZCA 4DV6F 1S5ZA 2BJ1A 4QYZJ 4IDKB 2HS0A 2LA4A 1TL4A 3MEEA 3CUNA 4EMDA 1N5QA 3BH6B 1W7WA 1QUVA 2XLJA 2PFDA 3VTIA 1QDUB 1F9HA 2XYGB 3OVSA 3FBEA 3KLEB 4LRBA 1KBRA 5C7PA 3G82B 4KC5A 2C2KB 1PYSB 1OQ6A 5CCMA 2JH3A 3DRRB 4KFBB 1K1QA 4Q44A 3OVAA 5J2PB 5B0BA 4K0KF 1TMMA 1AXQA 1YBTA 1FERA 4KYZA 2FTRA 3P5TL 2NZCA 4ECWA 3SIPB 1HQUA 3TR5A 4TQSA 3KK1A 3C6UB 3M8RA 1HARA 1YGYA 2ZVIA 5E3QA 4A8OA 4J9QA 3RB6A 3J81j 1X31C 4W4MA 2VQFJ 3JB9k 1ZS6A 1LFPA 1RHRB 2RF2A 3PHTA 3G6XA 4DL4A 1QAXA 3MM7A 1QAJA 2XSFA 3HFKA 1RWPB 3HHLB 3LALA 4HT5A 3C16A 3T5JA 3PW2A 2ADBA 1HR0F 1WI8A 4OI2A 3NG8A 4ZN1A 4KY3A 3DOLB 1VDHA 3Q8VA 4DQPA 2L3MA 3QFWA 2HBQB 4TY8A 4LSNB 4ZVSB 1O5JA 1VRQC 2BJ8A 1N54B 1CS4B 3KUEA 3GSDA 3PJ9A 4M5DB 3FFIB 5A0YA 3JYTA 4DR1F 1E6VB 1F3FA 2AEJA 3H7HB 3MI7X 5KG5A 1JLQB 4ED2A 5G0RA 4EZ6A 1VQMS 3NWGA 2H5IB 3OLBA 1R8AA 2GW8A 2XI3A 4ZPVR 4QWAA 1NSQA 5CHCB 1WI6A 2HQCA 2R8HA 2K06A 4OX9J 2NYHA 1MWQA 4C0HA 1QVFR 3A8EA 2AQ4A 1FDDA 3V6DA 2YVSA 4PUOB 1FO1A 3LWLA 1B0VA 1D3WA 2MDAA 1C0TA 4KHMA 1EZZB 4MTPA 2VG5B 3GIIA 3W7BA 1QY7A 5F8IA 1TFWA 3EVMA 3DU6A 4IG0B 1S1TA 2BW7A 3S1TA 2WW4A 3GIMA 5CZXA 3OXGA 4USUA 1QSSA 1Y9OA 2HLTA 2IMOA 3T1HJ 2X3DA 3CJKB 5K20B 2MSSA 2GFFA 3QMQA 1FX2A 3FRZA 3ILJA 2ASYA 6FD1A 1Q8IA 2DO0A 3JQKA 2B4OA 4J9MA 4FXVA 5F0UA 1KC8T 4NLDA 4DV3J 1P9YA 1TUVA 1V3SA 1Y0HA 1WG4A 2CQ2A 2AP6A 2DHSA 1TZ0A 4IG3B 5FDLA 2DR9A 2EFVA 1U1LA 5IT9Y 3KNAA 2PIIA 4B9UA 3F0NA 3LGHA 3QGHA 4S0MA 4AT1B 3EVOA 3KHLA 4PRFA 5JXSA 1TTHB 4DR4J 5F8JA 4JI2J 4UOFA 1D0EA 4M1KA 4B3MF 2KRRA 3H2UB 4QYRA 4RW7A 3TYTA 4Y65A 3UN5A 1JJHA 2Q6CA 3A8IA 3W60A 3CEDA 3IR6B 4DL0C 1MU2B 5HN0A 3MUTP 4GKJF 1JLQA 5D15A 1N4LA 2WCXA 4LR8A 3QSYB 1NJZA 3FNNA 5EGYA 1T02A 4UY85 4NYOA 3UD3P 1NRKA 3V81B 4WFNQ 2FYXA 1H38A 1UWBA 2GC8A 3MOZA 3MTJA 4H4OB 1X4BA 1N32F 2N3LA 3EDRB 1RT6B 1F5AA 4NEZA 2LKZA 3NGUA 4DSIA 2GO8A 4Q0BA 2CKWA 3VGVA 4CLTA 3MM9A 3CIZA 4O3QA 2FJDB 1PSDA 2CPZA 4CLWA 2DJWA 3MECB 3U27A 1RHKB 5KFRA 2H54B 1CJTB 3U1NA 4AUKA 2L08A 4F0MA 5KFJA 3Q22A 2DR7A 3JTNA 3CCVS 1RAHB 2RUGA 2MKHA 3TZYA 1UPMB 4WKYA 5AE3A 2UUAJ 1BWEA 2A1BA 4X4NA 3HCXA 4BDPA 3I5BA 2YWWA 2PMWA 1T9YA 2DB1A 2HMIB 4J9NA 1U48A 3DRXA 4URQU 1ZH5A 4AL7A 1RYRA 2VQEJ 4NLRA 2M7SA 4PWDB 5A8RA 3QIDA 5GAEI 1P9QC 2CQIA 1KLNA 4CNYA 4QPXA 4MIWA 3PRBA 1RWWB 2IM3A 3A3PB 3HKWA 4C11B 5JVHQ 2ASJA 1VQ8S 2VKZG 5KFMA 3OTOJ 4Y2KA 2V2KA 4NXMF 1KTVA 2Y1IA 2B0GA 2Z4PA 4IFYB 2M3DA 4QWBA 4DPYA 2MHEA 3RB3A 1S48A 1NHVA 3MPYA 1YBAA 2F9DA 2HZAA 5GAEU 3WC2A 3F41A 1U24A 2MQLA 3I9V9 5J2NB 3L7PA 2C3YA 3N28A 5D3GB 2CQGA 4PPZA 4PZVA 3M8ZA 3W66A 4LF7J 4QWDA 4DV7J 4KKOA 2W25A 1SXLA 1UCNA 1FKOB 1IUJA 4ILLA 3OSPA 2BZ2A 2ZWOA 3KUHA 1FRIA 3VVUA 3MR6A 4ZHRB 3BS9A 4R8UB 2OD6A 1J27A 2W2QP 1RTHB 3TAMB 2W8KA 1DQAA 2DHHA 4KV8A 4YQWA 1FKPA 2LXUA 3CNQP 1HHTP 1LK7A 3L95X 1QE1B 5LSLA 2QA2A 5SZTA 1S72S 3DLEA 3M2RB 4PYAA 1RA7A 3FQLA 4F50A 4HR2A 3I9ZA 1SKSA 3IRWP 3MDFA 3ELHA 2C2NA 4RZRA 1N5YB 2XWYA 3O3LA 1S12A 1Y3KA 4ZCLA 5HROB 3D4JA 2PEHA 2O1PA 2JVRA 3P3DA 1N6QA 2E66A 1GX6A 3T6JA 4HEA9 2UU9F 2HGMA 4PWDA 2NYIA 2QN6B 5LMNJ 5HI7A 3EYZA 1ACMB 1U0SA 3NAIA 5KFUA 3W5YA 2F3JA 3ETMA 4W90B 1NSPA 1WTBA 3KLEA 1ITPA 3ADAC 1NO8A 5KFGA 4CLSA 4C9DA 1JK9B 2QL7B 5E5NA 3BQ1A 3JTPA 3NOGA 4ZPDA 3OR2A 2LDIA 2BANA 3CE8A 3OFEA 3W9JA 2CAJA 3MFHA 3D6HB 3W62A 4DL7A 1OSCA 3C19A 4P74A 3CD5A 2QV6A 1W25A 2RKIB 1UFLA 4X62F 1XNQJ 4LFBF 1FRKA 5E41A 1FVQA 2OSQA 3I0RA 3MZIA 3SV4A 5HBMA 1TQLA 4OYAA 3TZZA 3WBZA 3FRYA 2K1RB 4IFVA 4PQUA 2MZRA 3RR8A 2MMYA 4Z7CA 2BW2A 1F60B 4PEOA 1VLOA 4QR2A 2NXUA 3D1OA 4AYBD 2VFRA 1VQ9S 2H48B 2XTJP 1Q95G 1G7CB 2YKQA 2ZBPA 1Z2LA 5SUHA 1N48A 4IR9A 3ETOA 2RB7A 3TAMA 2QMWA 4FXWA 8RUCA 4UUWA 3DHXA 2ROPA 2GHWA 3NGRA 3T1YF 1J5OA 1OY8A 2I38A 5KFDA 4G65A 3NGKA 2XY7A 5IC4B 4RNOA 3MEKA 3N6NA 3OQ2A 4Y2IA 3ZTRA 1XMQJ 4XO0A 2V4RA 4MAKA 2FPHX 4U96A 1BE4A 5A8KA 2MPUA 3FEYB 4IR1A 3HDSA 4QIFA 1IM6A 3V2UC 3BH7B 4ED4A 4ZLLA 1Q82T 2ZC4A 2VPWB 3MAAB 3SZ2A 4F2SA 2I8EA 3PJWA 3K5LA 2J6SA 2C3MA 1ROFA 2VHGA 4JI3J 2JFDA 1M0SA 2HFOA 1RT3A 3KMSA 2AGQA 1U49A 3DLLQ 1RZMA 2AJQA 4X4QA 2JJ4D 1E6VA 1WOOA 1CC7A 3G96A 5F9LA 2BE9B 2FY1A 2DHXA 3HVRA 3M4XA 4WFZA 3W3SA 4PG5A 2GX8A 3O8WA 3PR4A 2M52A 3C46A 2EFNA 3KOAA 2LEPA 4A8MP 1YG0A 2CZ4A 1LWCA 2YKNB 4Y2AA 4F4ZA 2LQJA 4ZPAA 4FF3A 4PUOA 5HP1A 3KNGA 2ZKTA 1M5HA 4E2FB 4EYHB 4QU7A 4N47A 1VRUA 1VK3A 4UQTA 1NM2A 5C25B 1FFSB 3LGMA 1KLMA 2DITA 3LQVA 4MYTA 2OTJS 3NBPA 4O3PA 3BJYA 2D3O1 4ZP6A 4WFYA 2B9YA 4JI3F 4PG4A 2DNLA 4I69A 5E3RA 1LWFA 5ITHA 3KK2A 2CA9A 3HLUA 4USVA 2M88A 3CCRS 3V6JA 3BQ0A 3H25A 1S77D 3KDOA 3D6FB 4OHZA 1JLAB 3H5SA 4GO5X 3AODA 3Q86A 5CA5A 2YH1A 1XMQF 2CJXB 5DGBA 2RDDA 2ILYA 3TJ9A 2YWHA 2MKIA 1ZPWX 4DFMA 1ZTWA 1XMBA 2CNOB 2G9OA 2L9NA 2ZH6A 3EPGA 1ZM9A 2GAHC 5D0RA 4DU8A 3PEJA 4Q8FA 1XBWA 1NCLA 2G0CA 3JSYA 1EP4B 3K5OA 3N01A 2RILA 2UVVA 4LQ3A 1IR2A 4DV0J 2QL5B 2BVZA 1CJUB 1HW8A 4L3NA 2U1AA 4ZCKA 3D67A 2DNOA 1N0UA 2CQ4A 2NXEA 4MMOA 3QJPA 4LFBJ 4H4OA 4WP8A 5J1NA 5K5MA 2Z2ZA 2I5JB 5KFVA 9RUBA 4BLGA 5BJRA 2KJWA 5JJBA 3T5KA 2FGCA 2DNRA 3KJVA 2C28A 3LP0B 3P45B 4ZN3A 3W61A 2D3UA 1JMTA 5DG8A 3I4PA 4WJBA 1FVSA 1NU4A 2SXLA 3FK4A 3MM5B 4DCJB 3PIPQ 2OH2A 2O67A 2PA3A 3ZNJ1 1VJQA 4J9PA 1RHJB 5C42B 3DLJA 1IJEB 2KFZA 3CDEA 2WTFA 4DV5J 3PYFA 5B09A 1VFJA 4MT1A 4J9UE 3NP5A 4Q45A 3A1YG 1HWLA 2GGPA 2WVBA 3M7VA 2HQ3A 5DM6Q 4ECYA 4U95A 1RBLA 4BBYA 2WVEA 3PM9A 4IOAQ 1HNWJ 3UFCX 2VH7A 4H4MA 2X3GA 1FK9B 1FKOA 1GAOA 4NZ0A 2YQ3A 2RHSB 4USTA 5A2QU 3Q8UA 3VAJA 4HH1A 3UDCA 3ZC4A 5K9FA 3SDEB 3AXMA 1K47A 1RT1A 1OMSA 2CPFA 3GZ7A 1U6FA 4CO5A 2DPJA 2MQOA 3GV7B 3D9BA 2WBMA 2ZC3A 3NXZA 4F2RA 5CCLA 4YMEA 1Y5NB 2QX0A 3HO1A 1QE1A 1UW4A 2ZNZA 4X65F 3FMBA 4PYDA 1FWPA 1YDLA 4TNOA 1UEVA 3PO5A 3J80Y 1WC5A 1UP1A 1R8HA 4PPDA 4AL6A 2J0QD 3PO4A 4ED1A 5T41A 1X0PA 5D8HB 3ZNUA 3BEGB 1WEXA 3QT7A 4C8LA 2ZDOA 3BGOP 3KLFB 4JI5J 2K7JA 2RD5C 3PXGa 2DGOA 1CC8A 1TKXA 3MM6B 4TXSA 4WP9A 3T6BA 2B5JA 1OYEA 3D6TB 4F3OA 1NK0A 4X66J 1UTAA 2KHCA 3NMAA 4DFPA 2DO4A 3LP0A 2E5JA 1BWVA 1SIZA 2F8MA 1HI8A 1MNEA 3D0GE 3EXCX 4OI6A 4EWTA 1Q53A 4WWSA 4BWJA 4ES3A 4DV2J 1IQZA 1LWEB 2QIFA 1S1XB 2RRAA 2IBKA 1H0HB 1XJWB 2W4PA 3O6QA 4J37A 4UF4A 1XQIA 4YR0A 3VAHA 3IS9B 1C2PA 2VQEF 3M2VA 1QJHA 1ZM2A 4L3KA 4U9RA 4ZKAA 4PG8A 5E2QA 3R97A 1WG5A 2GGPB 1SQEA 1RAAB 2H65B 4LBHA 3UDEA 3GPAA 4C3KA 1F0XA 4NL5A 5BYQA 4DXLA 2A6OA 3KMQA 2VODA 1H73A 3NCPA 2DY1A 2WRMA 3B8HA 1X4DA 3HVWA 3EPIA 3DM2A 3PEHA 4I68A 2W9AA 3QO9A 4N77A 1LNQA 1GTHA 5AJ3J 1KVIA 1PG5B 1BQMA 3IM8A 5LMUJ 4QOTA 1SL2A 3CDAA 4NRTA 3BO2A 4OYMA 2DD8S 2E1RA 2UXBF 5HJYA 5ETOA 4B3OB 2JL9A 2R7SA 2OAUA 1X60A 5CZVA 4LFAJ 1PC5A 2J76E 2BM1A 2C2ZB 1SH0A 4M5LA 4LSLB 1OPZA 3VAFA 4ECZA 2UUBJ 3M8YA 2GHVC 1IN0A 3U1LA 3CDWA 4HLBA 4DUYF 2BKOA 1YRTA 2COLA 3B54A 4DR2F 2B5JB 4JI2F 1SV5B 2ATCB 3CJ8A 5BYSA 3KLVA 2YQ0A 4HHJA 3T19A 3M8WA 1PJ5A 1DTQA 2DGVA 2Z8QA 5ETLA 2IBOA 1FRLA 1Z1ZA 3NS6A 5CQGA 1U2RA 2JC1A 3GYXB 3A12A 1TKTA 3M8SA 3MUMP 4FF1A 2AZ1A 4EZ9A 4ETZA 2OJ3A 4EUVA 5DDOC 2CWXA 3GJTB 2XGQA 1JLFA 1DY3A 3C6TB 5J2QA 4X64J 1YZ6A 3BN7A 3E51A 4C4WA 5A8KB 1HBMB 4FKYA 2JLEA 3AB2B 4RWXA 3M8PA 1SUQA 5DQHA 5KFBA 3VAKA 1VQ5S 2FZKB 3MAAA 5E7OB 4ILMA 4JI1J 1RABB 1NEEA 1HQ2A 3C15A 4OQJA 1U09A 1VHIA 1HBNB 2AEFA 3MURP 2ZH9A 1N36F 5HATA 4G1QA 5LM7E 5CD4A 4LF6F 2FLOA 4Y00A 1WD6A 2A18A 4FZVA 5ETTA 5GMDA 5L8RC 4QWCA 2LXIA 4GC7A 2BR0A 5H9EJ 1IKYB 4ZVQB 2NXCA 2RRBA 2CXEA 2R7WA 4K2JA 1T03B 2H4WB 3PJXA 3OL7A 2FVCA 3FEZA 3E01B 2HS3A 3L9ZA 3PYDA 5I4MA 2ADCA 1NK7A 4DSKA 1YKWA 5DLFA 2XMMA 2ZE2A 3VGSA 2FLNA 3RRHA 3N79A 4NCBA 3UDVA 1PCAA 4NLVA 3WX4A 5EWFA 2ZM6F 2CNLB 3MMBB 1U6BA 3MPUB 3R1LA 2HRUA 1RTJB 2P9EA 5AE2A 4B3SJ 2DT9A 1ZZNA 2A0FB 1NK9A 4ZIVA 4IOCQ 2YPZA 2MGZB 1X4CA 1A6LA 2O5DA 1Q8LA 4JV2A 1B3TA 1MWZA 1C1BB 2P2CB 3C66A 4ENOA 4QW9A 5ETRA 1NB2A 1QM9A 2AW0A 2XSJA 2ZBIA 1HBUB 1DLOB 3RBXA 1LWFB 4DI6A 1VMBA 1RBOB 1WEZA 2RQKA 2NPFA 1SPBP 4OFZA 1F6TA 5IM0B 4ZIWA 4DR5F 4KGKA 4ZDNA 4LF8J 2GS8A 4NA1A 1EETA 1Y11A 2WVDA 3AT1B 1SUQB 4WE1B 3C2PA 2RHQB 2CQBA 1R27B 1TL1B 1KP6A 4IH6A 2BJ7A 1L3TA 4O4GB 3HZGA 4WYWA 3UQSA 5L38A 1U1PA 4K0KJ 1U2FA 3M32A 4G1QB 5B7WA 1FD8A 5KFIA 1DZ5A 3DI6B 2A2DA 1LW2B 1UVKA 1IVZA 2OPRA 3TX0A 3AJ1A 2ZHOA 2MKJA 4WFAQ 2HVHA 1T9TA 2IRXA 5BXIA 3Q24A 3UDLA 2FJBB 1QAIA 3V6HA 1K9MT 1Q7LB 2F8HA 4DV6J 3SSSA 1Y4ZB 3RU0A 1CVJA 3HK2A 4XTTA 2YNHB 4RNFA 2CQDA 2FVQA 2YKPA 4J9VA 1JNRB 4M5MA 2HEKA 4P7TA 3AOBA 4Y6IA 4KIAA 3TW0A 1ZTTA 2D3OR 3EUNA 4OLPA 2Q79A 2FZCB 2J0WA 3VALA 3TUIC 4K8RA 2AIRB 1VBKA 4L76A 2ZM6J 1TK5A 3CT9A 4QCLA 4R25A 3SFGA 4DLGA 2FJWA 2JC0A 2Y3YA 1C1BA 1OO0B 2EFOA 2NSCA 1Q8KA 4WK1A 3R8YA 3W1YC 3OR1B 4ZMMA 3RAQA 4JI4J 1ULRA 2JSXA 3TEHB 1D8ZA 4B08A 2VG6B 1AUDA 3MM7B 1UL3A 1S4FA 1WORA 2IIHA 3P4UB 3R6GB 2DNZA 3D1QA 3QATA 2IA6A 1VQNS 1X4GA 2F63A 1UFKA 3FBFA 1H7WA 2C1EB 3DOLA 1V3ZA 3GR0A 4NYZA 2HVZA 3AHPA 5F8HA 4N5SA 4OX6A 3SQGA 5DETA 1JLBB 1WDTA 2BXJA 2G2YA 1Q16B 4NRUA 1HNXJ 4O0NA 1XMOJ 5T14A 4YHHF 2FJAB 2KM8B 5J2PA 1EETB 1WKKA 2HQIA 3TP2A 4WE1A 4RU9A 4UOCA 3QT5A 4EFAC 4F3QA 1HHSA 3D0HE 2NREA 3OT9A 4BHQA 5K8OA 4ECTA 1VCTA 2KO1A 3GMGA 3JTOA 1RWOB 3MR7A 4K59A 3T9NA 3R3TA 2KH9A 3W63A 4DUZJ 4KTQA 1FXLA 2QLJB 3IGVA 1RGVA 5ETNA 4ZVUB 1HNVB 3PCOB 3CC2S 3DFEA 4FS1A 2UUCJ 3QIPA 2XY5A 4HT7A 5KG6A 4DPTA 2XMAA 1S6PB 4C3MA 2W7OA 2DXDA 4NLQA 3EGZA 3KLFA 5HQLA 2JEJA 1TKXB 2YNFA 4OI0A 3J7ZT 4M5DA 2OP5A 5KG0A 4DPXA 1FKAF 3N5BA 4IG0A 5H9EK 2UUBF 4NX9A 1OY6A 3EZUA 2YWFA 2FVPA 2V8GA 3UVJA 2EC2A 2X7IA 3HM9A 2GNKA 4RW8A 2VL1A 2QMXA 1EHWA 3DM2B 5DJBA 5IC6B 3S7RA 4K2XA 1FJGJ 3CULA 2HZCA 2WONB 4QIWD 4WXOA 2V94A 1JLEA 4P2FA 3DKDA 2CADA 1IBLJ 2ZUAA 1AA1B 2X1FA 2FGOA 3BREA 5AJ3F 1VI7A 2KT5A 2KXNB 1FRJA 2G0IA 3GIKA 3DLHA 4DWIA 2MQMA 2O3DA 2HFZA 1X4AA 1MLAA 5FIIA 5BYRA 4ZITA 5IV4A 2AGPA 3ILOA 1I3OB 4JV1A 4YN3B 1ZETA 2VONA 5C2GA 2R8IA 3GONA 3AOCA 2P6TA 4JI7F 3QRQA 2JX2A 2LA6A 2ZH7A 3QGGA 1FD2A 1LK5A 1QAYA 2Z58B 3LANA 5GMEA 5J2MA 4WKRA 1IKXA 1GMWD 1RT5B 5HL7Q 5HLFA 3DGVA 2JLFA 1VC6A 1SJ4P 3BR9A 3ONQA 2G2OA 3QNWB 4CLZA 4Q8EA 1FXRA 2DR6A 4YFUA 3MM8A 3KLHA 3LUYA 2VA3A 4DV2F 3M6UA 5J1EB 1RDRA 3FZ2A 4FYVB 4NZ7A 5GAHU 2WB4A 3CCSS 3CCUS 1BQNB 2QYGA 2VJUA 1U8SA 1L3SA 1OY9A 2V68A 3CCZA 1IWAA 1NDCA 2IC3A 4X66F 2BM0A 3CMAS 2AYMA 4LR7A 3X3UA 4CO1A 3L3CA 3NEKA 3MF5A 3SSRA 3FC9A 2W01A 3SXLA 4JI5F 2D7SA 2HIQA 1L3VA 3FEXB 3U7JA 4X4RA 2RAQA 2MLYA 2V2ZA 3DC2A 4WIIA 5HMXA 3DLKB 4E98A 2RQMA 2OEMA 2IJFA 4AXIA 3HT3A 2QGFB 2F4VJ 2KXFA 3VAGA 4X65J 1SL1A 2ZHBA 2DH8A 4F36A 1AZSB 4KE5A 5J2QB 3DOMB 1UZDA 1NZ8A 4CYUB 1NKBA 2J5AA 2PC6A 1HBMA 2XHCA 3NKYA 3DCAA 2HNZA 1JJ2R 1JLEB 1FEEA 5EX0A 2ASDA 2Y8WA 2W9CB 1U7LA 1FRMA 2PO4A 3ICLA 1WC4A 3BO4A 3IG1B 1NH8A 1KDNA 1V6HA 1S6QA 2GIRA 2J7KA 1RSCA 2W4CA 4WK3A 4OI1A 1VISA 2IM0A 2D69A 2RUSA 3RYLA 2QLFB 2AYBA 1S97A 1K73T 2M4MA 2F7VA 3OD2A 3Q8SB 3HSDA 1AFIA 1DHMA 3GFYA 2YBVA 3IAM9 1TKZB 4G6VB 1PBAA 4CLUA 3MFIA 3QJJA 1ZM4A 1IKXB 1RT5A 2CJQA 4WXWA 5LOQA 1IBCB 5HLFB 1PYTA 2OFHX 3G9CA 2J6TA 1R0AB 1HWJA 1KS2A 3UR0A 1WF0A 3D7SB 2CQ3A 2R4FA 3D2WA 2AWZA 2M8DB 3VCDA 1DTTA 2JVOA 1LOUA 2LU2A 2B7BB 4TYBA 5F8LA 4TU8A 2BE7D 2KL8A 2Q1LA 1JKHA 4PXEA 5LSOA 5CXTA 1P27B 4LIWA 3PFEA 3FBBA 5L9XA 4KFBA 1X5SA 2OI2A 2NLWA 1VRTB 4ECVA 3CD6S 2ATLA 2EVZA 4RBUA 1SKUB 4CTAB 1N34F 3R2DJ 2JEIA 1NDKA 2CQ0A 3PHEA 1LXNA 1UEKA 2LEAA 1SBRA 5I3PA 3HZEA 3CCLS 1U02A 3HULA 1PBUA 1WUUA 3LO3A 3ZTSA 1TR0A 2FIUA 3BGRB 3MAHA 1HD1A 1WKLA 4KKOB 4NEYA 2V6AA 5D0GA 3ZZ0A 4IDKA 5KG2A 2KFNA 1PAEX 2HVDA 1M1GA 5GAHI 4NXNJ 3RZAA 4DV0F 1LW2A 4J9RA 2E5LF 3C16B 3PRDA 3OUYB 4EGLA 1L5UA 1KFSA 1C4CA 5DLGA 1HYSA 3QGPA 5CH7B 4R8UA 1GQEA 2XO7A 1U6ZA 4RLEA 2JRSA 3H40A 3FSYA 4DQIA 4HHHA 3T5HA 3DOMA 4CYUA 1KTQA 4PG7A 4K50A 1RHUB 4CO4A 3LF0A 1RU1A 1ZA1B 5ETKA 1YZ7A 2V2VA 3FZBA 3ZO7A 2IPOB 3I56S 2O66A 3D28A 4WTYA 3EVWA 4X4UA 4LUBA 2B8QA 5KAKA 2FC8A 1VR6A 3TQEA 1P6TA 2EFQA 4YDDB 1FA0A 3RAMA 3KJQB 1EQ0A 4Z2XA 1KR4A 3IBWA 1BC6A 1TVRB 2FDNA 4JBCA 1B0TA 4X2BA 4ECQA 1WC0A 3MMAA 1FJCA 1N52B 5E33A 5T7LB 2NPIA 2YNHA 1CS4A 3CIMA 3E2EA 1A9NB 1OWXA 1UJ4A 4DL3A 1RA6A 2ZEJA 3THVA 2W2OP 3ZZZA 1GFWB 4ZCIA 3J81Y 2C3UA 5EWGA 4GRSA 1HLWA 3MD1A 3HFZB 4UOHA 1S9EA 3PKYA 4CZCA 2RH3A 4W92B 4DL6A 1FT8A 3UO0A 5HSPA 5HO4A 3LP1A 1HMVA 1REVA 1TP7A 3OLAA 2AJ4A 2DHGA 4USMA 3C3LA 2W1BA 3BKUA 1KN6A 2VPXB 1NXIA 1J5OB 2LQBA 2HHHJ 4OZLA 1T11A 5FDLB 1T9UA 4JB8B 3GP9A 1H3DA 5JMNA 2HNDA 4MJKA 5CYQA 1C0TB 3GJSB 3UCUP 2MKSA 1YWXA 3TAPA 3RRGA 4ECSA 1X5TA 4B9MA 4UTGA 3KLIA 4I4BA 3CWJA 1R0BG 4RUHA 1M5SA 2FC9A 1YK9A 3KWMA 3MCSA 4DPWA 2ZH2A 3F56A 4DL5A 2V4JA 2F5GA 1FRHA 3L7OA 4M94A 2CPEA 3H2VE 4WZQA 4CO2A 1WHVA 4LF2A 3VGUA 4CNZA 3QAEA 5KT5A 5LT5A 1CSJA 4L74A 2VKRA 4WYLA 1KD1T 1KVJA 3UN3A 1YTYA 2EBEA 3UVJB 3UD4P 2PSZA 4FYDA 2YTCA 3GLJA 3EWGA 3FSIA 4BC9A 2R7QA 5KFQA 2XNRA 2CNNB 3Q23A 3JSMB 2YH0A 2YNIA 3T1AA 3S8SA 3R5CA 5DZ7A 3AA8A 1ZAVA 2AGOA 4DF4A 2HRYA 2UXBJ 3M9OB 1PJ7A 2RS2A 3W8GA 2GJIA 2YNFB 4RW7B 5AE1A 1YI2S 1NHKL 2WOMB 5DDPC 2VBXA 1XK8A 3G4SS 4JI6J 2W24A 2I9SA 2GVDB 3H5XA 3DOKB 2E5LJ 4DV4F 2Q6BA 1SQFA 3DRYA 4AE5A 2ZOGA 4F4AA 4CT8A 4F02A 4I7FB 3TAQA 2JEFA 2J9DA 1REVB 3I5AA 5IWAJ 2LMIA 4WF9Q 1LWCB 1GXUA 2YKNA 1S0OA 2C2MB 4CLLA 1A7GE 1RE1B 4RL1A 3SFUA 4URGA 3MR5A 1JLAA 2DGSA 4F04B 2DXEA 3CPWR 4K4TA 2AD9A 2P8IA 2EC0A 1R7IA 2HQDA 4FS2A 3I32A 2X1GA 1UJ5A 1VBXA 3PKMA 5J1EA 1TKDA 1YX2A 2XMTA 3KLIB 1GH8A 3IM9A 5LMNF 4IH7A 4O0IA 2JNJA 3W64A 1RT7B 3M9NB 3HHKA 4DLEA 4JI8J 1WKJA 3DMJB 5M2UA 2XM3A 1Q4RA 4B17A 2BQ3A 1RXOB 3D66A 5J2MB 3W2VB 5KFKA 3T3FA 3TRGA 3TZWA 4PCQA 1C1CA 2MKCA 2XMVA 4ICLB 3LH2S 3SMZA 4DR6F 1YVFA 1FNOA 2Z0GA 3DLKA 1BUXA 4OJHA 4UQGA 3Q8PB 2R2SA 4MK8A 4PWWA 3SSQA 3CCJS 3N6MA 1R43A 2OPSB 2ZD1A 5K14B 4DS5A 1VQKS 2HWHA 2HPUA 3HSGA 3IBFB 2JEGA 2EG2A 4ZVEA 2C2DA 2CG4A 3D54A 1YQHA 4KGXB 1XWLA 2YNIB 2ZH1A 1RTDB 5GADU 5BR8J 3HXMA 3BGFA 2IC3B 1G1XA 5B0AA 3SEOA 2W9CA 4I67A 5D3GA 3ISND 2F4VF 5DGAA 2ERRA 1YJUA 1MMLA 2JLGA 4OYPA 1TK8A 3EZOA 5I3UA 1N5YA 1QD1A 4P72A 2Z56B 4KGZB 5IS2A 1EJ7L 4FKXA 4OLOA 4DV7F 2IVMA 1HNZJ 3QGIA 3NNCA 1L3UA 3FCVA 2XY6A 2I5JA 5DS7A 4DFKA 5KFFA 3CCTA 2KT3A 4LQ9A 1QSYA 2FVRA 4DX8H 5A76A 3KJVB 1R0AA 4ELUA 4LF5F 1KRPA 4UUXA 4ZPBA 1BQXA 4NPOA 1N5VA 2P6SA 3QZ7A 1PILA 4XDDA 2B7CB 2MY8A 4U8VA 4CIOA 3KYLA 3R1HA 4WU3A 2XQCA 1FDAA 3UCGA 1ZA2B 2VASA 2QA1A 2OPPB 4KO0B 2HBRB 1KONA 1O6XA 4USKA 1MMDA 5EX3A 3TEGA 5A8WA 5B0DA 4F26A 4C8KA 2OPQB 3QLHA 4FPIA 1V5IB 1XEZA 3CJ4A 1LWXA 3W9HA 1RQ0A 1TKZA 4AD6A 3U1MA 4WFBQ 4KAIA 4DR7J 3W2VA 1FF2A 4QBUA 5HBMB 2RIJA 2MHNA 1XNRJ 3OFHA 1HNIA 2XZTB 3M05A 4EI2A 1HYSB 3BYRA 3DYAB 1FWKA 2CJAA 1S59A 3MM6A 2G4BA 4LJMA 3PR5B 4DBQA 1FI4A 1IBLF 1P1LA 4DHVA 4FBUA 1RTDA 2AX1A 2LFVA 4RX6A 2OMOA 4C97A 4QR1A 5B0EA 3QYYA 1T94A 2KYXA 5GADI 3PVXA 1NK5A 2J0SD 2ZZMA 3QQCD 1BLUA 2B43A 3TVZA 2B4UA 2R7TA 2G0JA 3CF5Q 3R6LB 1N32J 4YY3J 1M5PC 2UXDF 1S1XA 4NLYA 2G1HA 3K8VA 4HTIA 1NH7A 3J81U 4DL2A 3BBBA 4HVZA 4RW4B 1NBEB 4B9SA 5F3TA 1YJRA 2JDJA 4OI3A 1J2VA 3QFHA 4ECXA 3IA0A 1RTIA 4ECRA 2PDAA 1CEZA 1JB0C 1X5PA 2FB0A 3Q83A 1T9XA 3DDKA 5IQQA 4LF4F 2R7OA 1G6BA 1S0NA 3EJMA 3W2WA 3KDNA 3DRPA 2BRKA 4M5GA 1HBOA 2CPYA 4CH7A 1YJWS 2XMUA 1FJEB 2GIQA 2UVUA 2XG8A 4JUZA 2J7UA 5C24A 3W5ZA 3G8TA 1S9EB 2VPYB 2BACA 2R2RA 1E6YA 3KG4A 4K4YA 1HNWF 4DUZF 3LP1B 3NCRA 2BJEA 4HI2A 4ED6A 5KFAA 1KHVA 2HNYB 3R9LA 2E7XA 1LXJA 2KU7A 2VFVA 3GSIA 5KT6A 4YHHJ 4DUTA 3V6KA 4J9SA 2QMUB 3C8YA 3T1HF 2DXFA 1X9SA 1OIAA 2EW9A 5T7LA 2LEBA 1VBZA 1VK8A 3MEEB 3VAMA 2PD1A 2FJXA 1JIHA 5C25A 4OYOA 4I2PA 2LXFA 2CPXA 3PDNA 1NSAA 1KKHA 2K3IA 2DIVA 3MPDA
chains in the Genus database with same CATH topology
1X4HA 5M2RA 2VBWA 3GFXA 4JI4F 1BQMB 1SC6A 6FDRA 1K1SA 2ZBCA 1YHQS 4USJC 1D8YA 1FHTA 3BSNA 2CJ9A 3P96A 2W4DA 5GAGU 2CPHA 4OX9F 3LWMA 4ED3A 4O44A 3NGDA 3LP2A 1D9AA 4OV1A 2ALZA 5HMZA 3H4DA 4YP3A 4MIAA 2N7CA 3IRXB 1RTIB 3JSBA 2RNEA 2PE8A 2RQCA 1NJWA 4IQXA 4HDGA 2BBEA 4O3NA 3BZQA 1SV5A 5KG1A 5JVGQ 4WU2A 4DDFA 4J9LA 2YX7A 2H5EA 2C3OA 2JOQA 2WOMA 1DJ0A 1WHXA 2GMLA 2HYIB 1VC5A 2VD3A 1S9GA 2VQFF 3CCQS 1SB6A 3AA9A 3HX9A 2ZFHA 3H20A 1HA1A 2ILZA 2Q66A 4ZLPA 4Q43A 3JSMA 3RR7A 1Y5LB 4DQQA 1R31A 2BQRA 5DRKA 1RTJA 2XZWA 3GV5B 5LJ3Y 4E8UA 1YJ9S 1IJFB 3GQCA 1S0MA 1VC0A 2XB2D 2BDPA 2ZVSA 1I1GA 4Y0FA 4EEYA 4N41A 5H1SV 2OLWA 4Q2LA 1U4BA 2UVRA 2V8DA 3IWXA 4YB5A 4BC7A 2NSBA 1T03A 1CG2A 3VAIA 5GVQA 1X9MA 4DQSA 2RU9A 2N3OA 4OZ1A 2IVFB 2CDQA 2WK4A 2DR8A 5IM0A 2FUG9 2ZITA 2VOOA 4KGMA 3PY8A 4RUAA 1I94F 4YEAA 1XR6A 2YKOA 5KT2A 4NYPA 3PW7A 2HWIA 2MGZA 3WDOA 2FHJD 2QA4S 3G8QA 2LU1A 2YWKA 2VFUA 3MUVP 3MR3A 3TUZC 1HBUA 4C7QA 2YX1A 1HD0A 2WSCC 3DMJA 5F8MA 5KT4A 5EWEA 3H4BA 3GV8B 2N4CA 1RAJA 3K2YA 1VQYA 5EHHA 2UV8G 1JLGA 3O2IA 2L9WA 2VB6A 4IYQA 3NNAA 4LSNA 1UWBB 3B82A 3ISZA 2LVWA 3P49B 4IRCA 4JI1F 2E5IA 1RT1B 2XNQA 2CQPA 3N0VA 4F25A 3K5NA 5L39A 2PN6A 1IBMF 4O4GA 1Y7PA 2ZHAA 1RP5A 4X64F 4TU9A 2DNPA 3ENWA 3OTEA 2KZZA 4LVOP 3TO8A 4ELTA 3SCLE 2K8GA 1HFEL 4LF9F 2PGCA 3CB4A 4ILRA 2IM2A 3Q0AA 2NUHA 4O4RA 2DGXA 7FDRA 3POTB 2EFGA 2VG5A 4F3MA 1N8RT 2RS8A 1TK0A 1FNMA 2MB0B 1PGZA 1GXTA 1NZAA 4LFAF 2MXYA 2QZ8A 5E3AA 2BJDA 3K7RA 4YY3F 4ERDA 2YNGA 4AL5A 4K4VA 3OFGA 1S10A 1S1VB 2M70A 3CD0A 2C2EA 3RB4A 2A2CA 5KFTA 1UVJA 5LMUF 2B3TB 3S01A 1HNVA 1XERA 2MZ1A 3SYZA 3RBDA 4ZOSA 3TI0A 4RW4A 2Z2LA 1VQOS 4J5OA 4MFBA 3ZZOA 2F8EX 2M9KA 3HHEA 3CMES 1FTCA 4I2QB 2B51A 2KXHA 3NL0A 4D3HA 2DNQA 3U02A 1GNKA 4C8YA 4HI1A 1VHFA 2I1RA 4XPEA 2DNMA 2NQPA 4RW8B 3DXSX 2CVIA 3BB5A 4B3TF 2CYYA 4Y34A 3OW2R 1WF2A 4O3RA 2E9ZA 4V19J 4JV0A 4NLTA 3OFFA 4A8QA 1HBNA 1HNZF 2WSFC 3WZ0A 3OSNA 2B6AB 4YB1P 1UVIA 1RJJA 3H5YA 1RKJA 1UA1A 2O01C 1DQ8A 1VBYA 1N56A 3DRPB 3BN4A 2M2BA 3LW5C 4QQBA 2ACYA 5I42A 2CQ1A 3KG1A 2K2PA 2JWNA 3KHGA 2YNGB 3FDSA 2PMHA 3O44A 4NCGA 5KFXA 3M9MB 1ZZFA 1IKWB 3CC7S 1S1VA 2YWEA 5BR8F 2XCPA 3JSRA 4GO7X 2B4VA 1TV6A 2HNYA 2ZH5A 4L72B 3MMBA 3OTDA 3J7A1 2EBGA 3AH6A 4GMKA 4ZK7M 4DG1B 3IGNA 4U7CA 1KEKA 1IBKF 3ENQA 5KFOA 1M5KC 1H2UX 2JFKA 3MWBA 4IFVB 3V5RA 1IXKA 1SI9A 1W2IA 2RJZA 3IO1A 4O23A 4ED7A 2ZH8A 4FBUA 1R8PA 5KFEA 1T05B 3TA2A 4JI8F 3I4HX 1Q8BA 4L6V3 2K3KA 4NOHA 3ZZPA 2J9DE 4KSEB 5KFNA 1B64A 4ID5B 2OIHA 2OD4A 1D9DA 4ZHRA 4KPYA 1JWWA 7FD1A 3TVKA 5F41A 2DK2A 2UVWA 4A8WA 4Y2MA 2BABA 3NS5A 5D4NA 2IFXA 2C2RA 3K57A 1U25A 2MJUA 1DRZA 2E9RX 2ASLA 2RRNA 5IWAF 3CVKA 2GO9A 2ZJRQ 2XSJB 1M5VC 2MQQA 5DO2A 5KT7A 2YY3A 5D78A 3UWTA 2FJVA 2OPRB 5A6WA 4JI6F 1X9WA 2DNNA 1N6QB 1FDBA 2P9GA 3SI8A 4RW6A 3VQTA 4BWMA 1VJWA 1ZM3A 5D4LA 3ZZRA 4NLGA 2JHEA 2QT7A 4GC6A 4DMZA 2BQUA 1KSPA 5KFHA 3AAWB 3DLBA 1Y3JA 3E8OA 4B9TA 3I0SA 5K8PA 5HP1B 1JKHB 2PFFB 1G3OA 1S1WB 4G1IA 4TLQA 3M30B 3EZ5A 4QZVB 3M1VA 3MD3A 4A8SA 2BANB 3M8QB 5CYMA 3R27A 3VZHA 4R0JA 3R5AA 1JJ4A 2R7RA 3I0RB 2UP1A 3KLGB 2HHTA 2VUGA 4PXCA 1TAQA 4ZPCA 4K4ZA 1DBDA 4K4SA 1YITS 3S6EA 1QSLA 4I6WA 3HPOA 2GCFA 4HDHA 3F73A 3CCMS 2N4DA 2D1CA 2HGLA 3ZZTA 3THPA 3MMCA 1MROA 3MEDB 1HW9A 4NLUA 4HTJA 1D1UA 3OVBA 1JLCB 2L41A 3N9UC 1HWUA 2L48A 3KK3A 2W8LA 1VS3A 2MYFA 4I64A 2VG6A 2Q3PA 3NLCA 1F5CA 2MQPA 3DRSB 1N0VC 3PFOA 3QIPB 2IRUA 4NA3A 1TAUA 3HF5A 4IH5A 1S6PA 2ZKUA 1SJ1A 2B9XA 1YSJA 2MQNA 3SQGB 4RW6B 1RT2B 3BSAA 3QZ8A 3BO3A 2X1BA 2MJNA 2P9CA 4OHXA 1RI7A 2FLPA 3I6PA 3I0SB 1JNZB 1ZPVA 2N7YA 4FN5A 4AFFA 3NMRA 3H98A 1IQTA 3I55S 2CQHA 4FF2A 3MM5A 2PMZD 3HJFA 2RDIA 5CYMB 1NK6A 5FD1A 1N88A 4ALZA 3CC4S 3KK1B 5DDQC 3CTRA 1N33F 3MMAB 3KTQA 1SIWB 5IT0A 1X4FA 2BA9A 4ZS6A 3PX6A 2HHQA 3VWSA 4B9VA 5K8MA 2HVIA 2DNYA 1AROP 1FK9A 4LT6A 3CXCR 1T7PA 3HHDA 4OJGA 5DG9A 4MFBB 2E1AA 2KYZA 2V4JB 3NNHA 5HMWA 2E1CA 4R5PB 1MROB 3TA0A 3FFIA 5A0YB 1U1OA 2L9DA 3AQOA 5MLCV 2FVSA 1C0UB 3KK3B 4UY8T 3HHNB 4DR3F 2VFSA 4A47A 1WF1A 3LAMA 2DNKA 3HHLA 1H2VZ 1S49A 2FHJA 2RE1A 1KHWA 3DN9A 3HVAA 1KOHA 3HVTB 3FJ2A 1HI0P 1XC9A 1RT2A 1T3NA 2DGTA 1RYSA 4I2QA 5KT3A 4MYUA 1G2EA 3GR1A 4HKQA 5KFSA 3PACA 4QR0A 4A8XA 2V9WA 2QO3A 2IMWP 3IR5B 2IA0A 2ZJQQ 5I42B 4KT0C 4EBCA 1H6KX 2KG0A 1NJYA 1TL3B 2GHPA 5E3PA 4F4XA 1S9FA 2KHDA 2M8HA 5LXYA 2A10A 2R2UA 5KFYA 2V0NA 1U45A 3BM7A 2UZAA 2HW3A 4IG3A 5AXNA 2DGWA 1S6QB 4QJVA 4MIBA 2LYVA 5C42A 4OZ0A 4PKDB 3M6WA 3L09A 5KOXA 5GAGI 3CDUA 5THWA 2J8AA 4B02A 5L1JA 2VZ9A 2HWTA 4DQRA 4R5PA 3V4IA 4LF7F 4C8NA 3PW4A 4RW9B 3LPYA 4ED8A 1LV5A 2HNZB 1C0UA 1WG1A 3QPIA 3M6XA 2R7UA 2ZD1B 1DTTB 2OPSA 5IZHA 3OTOF 4B3OA 5F8NA 4E0DA 2B9WA 4ZA1A 4X4SA 3OBIA 3MM9B