2KM8C

Interdomain rrm packing contributes to rna recognition in the rna15, hrp1, anchor rna 3' processing ternary complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
167
structure length
167
Chain Sequence
b'KESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQHILDGKVIDPKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPRH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*UP*AP*UP*AP*UP*AP*UP*AP*AP*UP*AP*AP*U)-3'
publication title Novel Protein-Protein Contacts Facilitate mRNA 3'-Processing Signal Recognition by Rna15 and Hrp1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
total genus 24
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2km8C01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2km8C02
1U2FA 4UQTA 3UD4P 2CPIA 3FEXB 4P6QA 3CCMS 1A9NB 2RUGA 5LXYA 2CPYA 1DRZA 4W90B 3VAKA 4M5DB 5EN1A 4TU8A 5BJRA 3CXCR 2CPFA 2RVJA 2GHPA 1NJIT 1SJQA 1A7GE 2DH9A 2PE8A 2DIUA 3P5TL 5LXRA 2CJKA 2RS8A 4ERDA 3I56S 2D9PA 2X1BA 3CCLS 2LECA 2FY1A 1WF2A 1X4HA 4PKDB 3NS5A 3VAHA 1QVGR 3R1HA 1P1TA 3SXLA 2KRBA 2KM8B 3CULA 2JWNA 3R27A 4YOEA 2DNRA 3TO8A 2G0CA 3CCES 1D9AA 1WG4A 2HZCA 2F9DA 2FC8A 3G8TA 2DNYA 2M8HA 1KQSR 1M5KC 5MLCV 2L41A 1OPIA 3EGZA 4OZ1A 2EK6A 3S8SA 1WELA 4J5OA 3I55S 1YJ9S 1U1PA 2KFYA 2DGOA 3UCUP 1VQNS 3G6ES 2LXIA 2MYFA 2HGMA 2HVZA 4WF9Q 3MOJB 4C0OC 2OJ3A 3Q2TC 2DNHA 1Q81T 3IWNC 1NO8A 2HGNA 2N82B 1UP1A 2XS2A 1WEXA 3UCZP 2MHNA 2JRSA 2L9WA 3FEYB 3BO4A 1VC6A 2DGTA 2SXLA 3CCRS 1YI2S 3CMAS 2LA4A 3NNAA 3CUNA 3SDEA 5IFMA 2WBRA 2DO4A 3THTA 1DZ5A 1H2VZ 1FJEB 2MGZA 2YH1A 3TP2A 3UE2A 2MKIA 1YHQS 1WHVA 1W2BR 3ZZYA 2XNRA 1VQ5S 4QU6A 2E5IA 2XNQA 5DDQC 1SJ3P 3LPYA 1OWXA 2M0GB 4LJMA 2MZQA 3CCQS 2D3OR 1U6BA 1UAWA 1VBXA 1YJWS 2AYMA 5GAGU 1U1OA 2NZ4A 1DHMA 2XS7A 4CH1A 2D9OA 3MUVP 1VQMS 3G4SS 2DGXA 2V94A 4Y0FA 2LEBA 4IO9Q 3U1MA 2CQHA 3IRWP 2LEAA 2DNPA 1AUDA 1U1NA 1S72S 3R1LA 5IQQA 3MD1A 2KXNB 2MZSA 5IM0B 5DDPC 3VAJA 2CQPA 4FXVA 2ZJQQ 2CQDA 2DGQA 1VQ8S 4F26A 5GADU 1U1QA 5LSLA 1M1KT 2DH7A 1M5PC 1IQTA 2OSQA 1U1MA 5LSOA 1OIAA 1FXLA 3HI9A 4Y00A 3CF5Q 1WHYA 2G1DA 1WG5A 2MSTA 2M4MA 2MJNA 2MMYA 1K73T 3B4DA 1X0FA 4WCEQ 2M9KA 1KOOA 1X4AA 3S6EA 2ZJPQ 5DM7Q 3CMES 1X5PA 4BS2A 4CH0S 1KD1T 1UW4A 1XN9A 1WI8A 5HO4A 1S79A 3MD3A 2MKKA 2MPUA 3UCGA 1U1RA 1VQPS 4C7QA 3G71S 3ULHA 1Q82T 1X5SA 1YWXA 4QU7A 1OO0B 5ITHA 3CCUS 1PGZA 3LQVA 2CQ0A 2MKJA 2YKAA 1ZZNA 1YITS 2MQOA 2DHGA 4OZ0A 3S7RA 1WF0A 1X4FA 4CQ1A 4RU2A 3RW6A 3SMZA 5CYJA 2CQIA 4Z2XA 4W92B 1VQKS 2DNQA 1JJ4A 5LJ3Y 4WFAQ 2X1FA 2DNLA 1O0PA 2A3JA 1JMTA 4IOCQ 1WG1A 2KT5A 2MKHA 4YB1P 2DGVA 3MUTP 2DGUA 2BZ2A 4QQBA 1WWHA 2KG0A 1VQ4S 2CPDA 1F9FA 3CCVS 3DLLQ 2KN4A 2X1GA 2KM8C 3G9CA 2M8DB 1HL6A 1WTBA 2DGSA 3V4MA 3H2UB 2E44A 1ZZFA 3BO3A 1N8RT 2DK2A 2KHCA 2DB1A 2DNMA 4TLQA 2DHXA 1WHXA 2ERRA 4ZKAA 1URNA 2MKCA 2DNOA 2CQCA 2E5GA 1M5VC 2DO0A 5H1SV 5D78A 3CC2S 4V19X 2DISA 3DXBA 3NMRA 1FJCA 5D77A 1K9MT 2AYGA 2RQ4A 2MQNA 1BY9A 4WIIA 5IM0A 2KH9A 2KVIA 2AYBA 2NLWA 2MZJA 1VQOS 2ADBA 1X5OA 2MGZB 2N3OA 1VQ7S 3CC4S 1VQ9S 1HA1A 1Q86T 1RKJA 2I2YA 1NU4A 2FPHX 2U2FA 1KOHA 2MY7A 1DBDA 5HL7Q 2MQPA 4YUDA 3CCJS 1HD1A 1X4BA 3TYTA 2K3KA 1SJFA 3Q2SC 1JJ2R 2B0GA 3CD6S 2J0QD 2YWKA 3J7ZT 2MZTA 1FNXH 1X4DA 1L3KA 2CQ4A 2DHSA 1ZH5A 1YIJS 3HHNB 2CPJA 2KRRA 3S01A 2KXFA 5DM6Q 5GAHU 2MZRA 4UY8T 1G2EA 1WEYA 1H2TZ 2U1AA 1N88A 3CPWR 2RU3A 1SJRA 2G4BA 2XS5A 2LA6A 2KXHA 2LKZA 1WF1A 2OSRA 2MSSA 2CQBA 4F25A 3N9UC 2J8AA 2MQLA 3MI7X 5GMKa 3PIPQ 2XB2D 2LQ5A 1X4GA 1VC5A 2OTJS 2RRBA 1P27B 2M7SA 3VF0B 2VOOA 2PEHA 5DDOC 5JVGQ 3U1LA 1N52B 2QA4S 2MJUA 4LMZA 3P6YC 2LCWA 3MXHP 2RNEA 2MKSA 2MB0B 4ED5A 4TU9A 3ZZZA 1WI6A 2KG1A 3US5A 1B7FA 2JX2A 2MQMA 1UFWA 5CXTA 3VAFA 2KYXA 2EVZA 1CVJA 2RRAA 2K8GA 2CQGA 2GO9A 2F9JA 1X4CA 2J76E 2JVOA 2XSFA 2MQQA 3BEGB 2BOPA 2DGWA 3UD3P 1N54B 2E5HA 5GAEU 1M5OC 3VAMA 2OIHA 3NS6A 3H2VE 4PRFA 2MY8A 1WHWA 2MXYA 5CA5A 2KU7A 2M88A 3EX7B 1VBYA 4F02A 2CPEA 2X1AA 1H6KX 1R8PA 5FJ4A 4WKRA 3UWTA 4QPTA 3BO2A 1U1LA 5GVQA 1U1KA 2CPHA 4IUFA 3RW7A 2F3JA 1X5TA 2CQ2A 3EGNA 3OW2R 2ZJRQ 3K0JA 3MDFA 1HD0A 2E5JA 2FC9A 4C4WA 2M70A 2VODA 2UP1A 3G8SA 2O3DA 3P49B 2DH8A 2MZ1A 4WFBQ 1QVFR 2VONA 2YH0A 4WFNQ 3NNHA 2AD9A 2EK1A 1FT8A 2ADCA 2OTLS 3B4MA 2HYIB 3PIOQ 2DITA 2QFJA 2RQCA 2YTCA 5LJ5Y 3L3CA 5JVHQ 3VAGA 1QM9A 2DIVA 3CCSS 5DETA 1M90T 2DNNA 2AYEA 3THPA 4IOAQ 1Q7YT 3NNCA 2VOPA 3P3DA 3BS9A 3SDEB 2QEXS 2HGLA 2CPZA 4TU7A 3VALA 1PO6A 4EGLA 2CQ3A 2JVRA 4U67Q 1H2UX 2M52A 2Q79A 2KI2A 1FO1A 2J0SD 3JB9k 2LYVA 2L08A 2M2BA 3G96A 1VQ6S 1YTYA 2CPXA 3D2WA 4CIOA 2N3LA 1K8AT 3J7YU 1VQLS 1YJNS 1SXLA 1U6FA 1WEZA 2DHAA 2RS2A 1R8HA 2DNZA 4PR6A 4A8XA 2CQ1A 3CTRA 2N7CA 2FHOB 1RK8A 3VAIA 1FJ7A 4LIRA 2LMIA 1VBZA 1VC0A 5DDRC 3CC7S 4FXWA 2LXUA 3MURP 1JJHA 2DNKA 1SJ4P 2DNGA 2I38A 3MUMP 2RT3A 1KC8T 1X4EA 1FHTA 1D8ZA
chains in the Genus database with same CATH superfamily
1G4CA 4P6QA 5C25B 3DDKA 1A9NB 1NPPA 3OTBA 5EN1A 4CLSA 4F4ZA 4JV5J 3NOGA 3P5TL 3I5BA 4Y2IA 3MPVA 3M8ZA 5F8JA 1EKSA 4CZCA 4DFJA 4C2MA 1WF2A 4K50A 1CG2A 4DUZF 1VK3A 4UOHA 5BYRA 3PW5A 4DR4F 1Q95G 4USWA 1A6LA 2ROGA 1JJCB 1HW8A 4OHXA 3O2IA 5HVGA 2ZE2B 2R2SA 3PX4A 2WONB 3MWBA 4RW8B 4C8KA 3Q86A 4RNNA 1BMQB 3FCVA 3BJYA 3KJNB 3J81j 3PX0A 2ASDA 4DS4A 2ZBRA 2ABYA 3CCRS 2RDIA 3HSZA 2J9CA 1CJVB 3CW2C 5IFMA 3GV8B 5E41A 4DSEA 3DYAA 1LKZA 1BLUA 1TAQA 5AE3A 3Q8QB 4ZVUB 4HLBA 3MUVP 3U1MA 3AJ2A 3ZZTA 1VHIA 3R1LA 4Y2CA 3MD1A 2V8GA 1QTNB 3HHKA 1RWKB 2YWGA 3A12A 3EDRB 4ZN3A 4GC7A 5LSLA 1KWMA 1NZ8A 3M05A 5HATA 5A8RB 4TYAA 1FXLA 2J0XA 4F3OA 1S1XB 3CJSA 1J27A 3V6HA 2A18A 2ZZNA 3MM5B 5KAKA 1U0HA 4A8KA 4OX6A 1UW4A 1VISA 3OV7A 2HIQA 3FVYA 3R2DJ 1Q0NA 4B08A 2VBZA 3MAHA 3QIPB 1WORA 4QR0A 1NHKL 4M8LA 2PDAA 2BUNA 3DRRA 1RWUA 1HQEB 5LJ3Y 2CDQA 2A3JA 2D1CA 4J90A 3RBEA 2DGUA 3K5LA 3B6BA 4USIA 3DLEA 4HEA9 3TQEA 4LQ9A 4RU9A 1JLQA 1U4BA 3TZWA 3AFGA 3TI0A 4TY9A 3CCWA 4IR9A 2XULA 2Z57B 2DHXA 2BX6A 5EGYA 1NSQA 4J9MA 2ZBPA 4LUBA 1IKXA 1MSWD 3K2YA 4K4WA 4P73A 3KUHA 1WC3A 1B0VA 1ACMB 3W3SA 3AQOA 5GAEI 3CSKA 5KFZA 4MH8A 2NXNA 2W7AA 1UVLA 4O3QA 3PCOB 1XMOJ 2XY5A 4OI0A 2RB7A 8RUCA 1ROFA 4ED1A 2B5JB 4TVAB 4Q45A 2ASLA 1RT6B 4JI0F 1ZAWA 5HQLA 2HS3A 4DPWA 4L6V3 4YDXA 2YNFB 2KB2A 4ZHRA 3VQTA 3KHGA 2BE2B 1AUSL 4CLWA 1FJGF 5CYQB 2GQ2A 3MOZA 3W9IA 2R2UA 9RUBA 2ZNZA 5CXTA 1HBOB 2AHOB 2IRUA 4Q0BB 3QLHA 1MW7A 2C3YA 3NS6A 1LWCA 3JTNA 2V8HA 2Y8WA 1R8PA 4GC6A 5D6GA 1JWWA 2APOA 1FE0A 1OYEA 4BC7A 3ELHA 1X5TA 1DURA 2ZJRQ 3MECB 3GIJA 1H73A 2J7KA 1NUEA 3KLEB 5AXNA 1FWLA 4P52A 1HWIA 4GMKA 3CO0P 4TU7A 2CQ3A 2W2QP 1H2UX 2ACMA 5KG1A 4U96A 4NLDA 3TUJC 1UTAA 4KFBA 1E6YA 3WHIA 2JC0A 2NR0A 5KTQA 1L3VA 2IAJA 1NPRA 2N7CA 4NZ6A 2LMIA 1VBZA 2W2PP 3MURP 1JJHA 1SJ4P 4PXBA 3OR2B 2ZOGA 2KVQE 3SIPB 2FVSA 2CWXA 5EWEA 4RW6B 1T05B 2X3GA 3M6XA 4ZA1A 2CPFA 4CTAB 5EWFA 3CJ0A 5A76A 1SJQA 1I94J 2CJKA 5LXRA 4PWDB 4QCLA 2ZH5A 3ITHA 3WIVA 2H48B 4C8YA 2IDLA 1I5OB 1VLOA 3AXKA 4YR0A 2JWNA 4KB7A 2G0CA 3W9HA 2GW8A 3CIZA 2A6OA 1FRLA 2M8HA 2VA3A 3SSQA 4LT6A 3EGZA 5CZXA 1G6BA 2KFYA 3PO5A 2RKIB 2FZCB 2ZEJA 3DLGB 2E7XA 2FHMA 2CJAA 2FLNA 2VG7B 3MMCB 3GV5B 1WEXA 4QR1A 3DOLA 1VC6A 2FJXA 2Z2MA 4N76A 2OD6A 4IH5A 2DO4A 2MGZA 3O6QA 2YKMB 1R27B 2OH2A 2J6UA 2WSCC 4P9SA 3DLHA 2XYGB 1RTIB 3L7OA 3JS9A 4UY85 5C42B 3D4JA 4KT0C 3IR7B 5DGBA 4OZ2A 1IBMF 3N6LA 2D9OA 1N32F 2LEBA 4DR6J 4A47A 2CQHA 5AXLA 1LQ9A 3M2VB 1AUDA 2C2KB 1HNWJ 3Q8SB 3NRBA 2HHHF 3NAIA 4NYZA 1M5PC 1K0VA 3DHWC 3WZ0A 4FS1A 2AMCB 1LFWA 1Y5NB 1Y5IB 2CJXB 4USHA 3HI9A 2G2ZA 1YBTA 1K73T 2UZAA 3DHXA 2VF3A 2CZVC 4YDDB 1HPZA 3FQLA 3JYTA 2D74B 1MMDA 5T7LA 3DU6A 4M1KA 3W7BA 3NXZA 1UPMB 2W7OA 2UVWA 1SL2A 3SQOP 1YJRA 4GO7X 2UXDJ 2CQ0A 2MKJA 4P2SA 3V6KA 5KFSA 4KSEB 2LQBA 4IFVA 5H9EJ 4NX9A 2X1FA 2DNLA 3KK1B 3MZIA 4L73A 3UQSA 3TUPA 4DR1F 2M8DB 5ETKA 4ID8A 3WX8A 2MLZA 3B78A 2DNMA 1BQMA 2FIUA 2GMLA 2XZDB 1S76D 1URNA 3DRXA 2ROPA 5L1KA 5E3AA 1FJCA 1RTJB 3OFFA 4PQUB 2F7VA 5KT5A 4JV0A 2B4PA 1YSJA 1RAOA 1T03A 1X5OA 2GZOA 3QWUA 1VQ7S 4KTQA 3DOMB 3ZTPA 4RKUC 4H4KC 1B4SA 1C1CA 2MQPA 5K5MA 3CCJS 3M30B 1HD1A 1TVRB 1XQIA 1JJ2R 3CJ5A 3HHLB 2ACYA 1FE4A 1HFEL 2W2MP 3J7ZT 1Q53A 4DX7A 4J9SA 3LP2B 5DM6Q 1WEYA 1VIXA 2CNLB 4PEOA 1V3RA 3BQ1A 3GPAA 4ILMA 2MSSA 5B08A 3NBPA 3C6UA 1MMNA 1X4GA 1G3OA 3N6NA 2ZHBA 3GYGA 4WZQA 2VB6A 4NA1A 5HQ8A 4ED5A 3BZQA 3VAFA 2JFDA 3OFEA 3IRXA 3QIDA 4FVMA 1KLMB 3G6VA 4ZITA 5J1EA 2OIHA 3L09A 2XYHB 2AV5A 1TKTB 3I87A 4UF4A 4YY3F 2MXYA 1VBYA 1KTQA 3BKTA 1ZA1B 3A8JA 3TAPA 3GONA 2CYYA 1Q1KA 1WDTA 3C6TB 3K7RA 5RUBA 2YH0A 2R8JA 3QRQA 1FI4A 3EVOA 5HVHA 3PIOQ 3D1QA 4IQXA 3IWXA 1TKDA 2BW2A 2HNDB 3THPA 3SDEB 2UVUA 4IH6A 4NXMF 1TUGB 3OVBA 3W65A 5AXMA 1V9OA 3V4IB 3NLCA 1NJZA 4LR8A 3CTRA 3I0RA 3NY0A 2H5IB 4QOTA 1RK8A 4NZ7A 1CLFA 2VBWA 2DXFA 4MTPA 1RZMA 1ZAXA 4WK3A 1RUSA 3LP0A 1C1BA 2YNHB 3UDEA 1RTHA 4KQZA 4C0HA 4J7CA 2CPYA 1RDRA 1HNIB 2EFNA 3NCPA 3AY0A 3HVTA 3HULA 3KMSA 1VI7A 2ASJA 2VC1A 2HHXA 2FVRA 3CJQA 2HWIA 5IS2A 5IC4B 3LH2S 2BW7A 2FHKA 3NKYA 4OZLA 3UDVA 3FCWA 2FJBB 1T9WA 2RU9A 3KLGA 3AH6A 4YOEA 2FJEB 1GFWB 3J7A1 4ZK7M 1JLEA 2DNYA 3V6DB 2H9ZA 2IFXA 1M5KC 1N33F 2GVDB 2HAFA 4OHVA 1VYAA 3IBWA 1PYTA 4UUWA 4ZP7A 1VQNS 5F8GA 2HGMA 1UKUA 3MAAB 3UVJA 2OJ3A 4MFBB 1KQKA 3IWNC 4URSA 4RPFA 2XS2A 4EEYA 4TY8B 3UCZP 4K2JA 2DGTA 2LA4A 5F8IA 2VG5A 2RSQA 1LOUA 2YH1A 4ZP8A 1UVNA 2JLFA 1FXRA 1Y10A 5KOXA 1V5IB 4FPIA 1REVB 5KFGA 3DRSB 1XJWB 2Y3YA 2E1AA 1U6BA 4EK2A 4OI1A 3W62A 4Q8FA 5K14A 1O5JA 1AZSB 2GVZB 2XMVA 3GSDA 1DQ8A 3R7NB 4PABA 2EC2A 4DR3J 2AEJA 1VQ8S 2ZH7A 2FB0A 4M5DA 2AX1A 3Q22A 2HFOA 3UNGC 1KONA 2BKOA 3CMES 1BXNA 4I1TA 4CH0S 2HNZA 2J7UA 5HO4A 1DAXA 3D0GE 1RTDB 2BANB 4LVNP 5BYSA 4OHZA 2B56A 3A1YG 1HHSA 3I6PA 2E9RX 3O3LA 4KHMA 4UOCA 3QWPA 4F4KA 3Q8UA 7FDRA 3HPOA 4N77A 3ILLA 4PG5A 3GWCA 5KG5A 4DEZA 2MKHA 1HBNB 5F0UA 2EBEA 4K0KF 2KG0A 1PG5B 2PT0A 2YKNA 2X1GA 4I56A 3W60A 1S1TA 4KPCA 5MAOA 4AQYF 4LRCA 4KBIA 3ICLA 3GIIA 1LW0A 1SVDA 1HNVA 2HAIA 1WHXA 3D67A 5H1SV 2DT9A 3CC2S 1QE1B 4JYAF 3K58A 5I3QA 5AE1A 4AYBD 5K20B 2ALZA 4ZVGA 4LF4F 3TAMA 1J5OA 4NWBA 2CVIA 4Q43A 2DRDA 2FPHX 4GVBA 1LXNA 2VBXA 4J9QA 3CEDA 3SZ2A 2WVFA 1BWVA 3OR1A 4K2XA 1ZTTA 1JLBA 4MYUA 2VJVA 4I2QB 3LO3A 4I4BA 3CD6S 2QMWA 4J91A 2MHEA 5CABA 3EZUA 3L7UA 2Y0SD 1S1WB 1FRHA 1CS4A 1F3VA 4TQSA 2HFNA 2FY8A 4DV2J 5GMKa 2LQ5A 3BR8A 4KHPJ 2RRBA 3F0NA 3CDAA 2PEHA 1WNEA 2M3DA 1EETA 4RR5A 5A2QU 1S7HA 2VPYB 4DF4A 1YZ6A 2JX2A 4ANEA 1BC6A 1K1QA 3ZZ0A 4G6VB 1FKOB 2OPRA 4PYAA 3M8WA 3LWLA 2DGWA 3UD3P 4WFYA 2E9ZA 2LVWA 4URQU 3RBDA 2LQ8A 2MY8A 1B3TA 3MM9B 2F8MA 3R8YA 4R8UB 1H6KX 1V6HA 4QPTA 2W9BA 2VBYA 4DZDA 2EBGA 3LGHA 1HD0A 5CD4A 4RWWA 2UP1A 3R97A 1QVFR 3FMWA 3H40A 3W2WB 2HRUA 1MLAA 5JJBA 4ZLPA 2AEFA 2JVRA 1U2CA 5E5NA 1WSRA 5J2NB 5FDLA 1SCJB 1RCXB 4RBTA 3IP0A 4DV3F 5IWAF 2BM0A 4YN3B 1H74A 5HK4A 4WTYA 2KJVA 4LSLB 4X4PA 1GT8A 3U1NA 1IBKJ 3FEXB 3D0HE 5BR8J 2LP4A 1XEZA 1SC6A 5SUHA 4ID5B 3M8SA 2HQFA 3HHLC 1OSDA 1ZM2A 2F65A 5F9LA 1TZ0A 3AJ1A 2B9EA 4KGVB 1HQUA 1O8BA 2B6AA 2X1BA 3CCLS 2KO1A 2AWZA 3MEGA 4K5SA 1TL3A 4ECVA 1Y7PA 4PKDB 3QGGA 2VV5A 3MM8B 2XMUA 2XMTA 5D3GA 2OFGX 4B3TJ 1S6PB 3RR8A 2FC8A 1SKUB 3HT0A 2MTLA 2AZ1A 2P5VA 2HHPA 1Q5YA 3DMJA 3UCUP 3O8WA 2DEIA 1DLOB 4LF2A 3FCHA 3MOJB 3L9ZA 4WYWA 4J37A 3OFGA 3PVXA 4LFAJ 5IQ6A 3DOKB 2WK4A 1FDNA 3O44A 5FLXU 5T14A 2XNRA 5J2MB 1PBAA 2XNQA 4F3QA 3EZOA 1T9VA 2WOMA 2NREA 5AJ3F 2M0GB 3T19A 2AIRB 5KT4A 2Z4PA 2AQ4A 4OJHA 5HMZA 1S59A 2FJWA 3ET6B 2C2RA 3V81B 1N34J 4IO9Q 1M5SA 2DNPA 1F9HA 3P4UB 1CEZA 1S4EA 3H5XA 4JI5F 3AOAA 3SBMA 3GYXB 3AA9A 2FGOA 4F3MA 2GGPB 3PY8A 1IVZA 2H5EA 2J7WA 5B0FA 3RUBL 4RUBA 5A0YB 5HSPA 2G1DA 4NMLA 3LWMA 2P9EA 1N56A 2M4MA 4U7UK 1CPZA 3HMJG 3MPUB 4KKOA 4F0HA 5HN0A 1KTVA 2B7BB 1RXOB 3MD3A 2G1HA 5KOWA 4F2SA 1N5YA 2UVVA 4C11B 3X3UA 3IMQJ 4F4AA 1S0OA 4C97A 2QC3A 5KG7A 1VQKS 1IBLF 5A2QY 1R8AA 2OHDA 1X31C 1O0PA 2N4DA 2BJDA 4M5LA 4WP3A 5KG3A 2WSEC 2KN4A 2EKNA 2DHHA 2JC1A 4JI4J 1MWQA 1FX2A 3N5BA 3H2UB 4DV5J 2E44A 1Y5LB 1YJTA 4TKTA 5KFBA 2DK2A 2GNKA 1VRTA 2VQEF 3ZC4A 4KR0B 2IMWP 3RRGA 1GTHA 2V9WA 4ED8A 1IN0A 1F60B 4WXOA 3OTOF 2V4JA 5F0WA 1K9MT 3EVMA 4C3MA 3EE3A 3OSPA 1V5VA 4A48A 4LF9F 1FFWB 1XR6A 1T95A 4JI3F 3F41A 1NLKL 5ETNA 3DNCA 1L3KA 4YEAA 3K8VA 3V6JA 4ANCA 3KLFB 1RWWB 1NKEA 1FDAA 5HROA 2RQKA 1LWFA 2R7UA 3PIPQ 5KFHA 2JSXA 4I67A 4Y6IA 1WOOA 4AXIA 3ZZUA 2MKSA 4ZVPB 3BF4A 5CH7B 2F9JA 2BOPA 3OJUA 1Z1ZA 4OYAA 3T6JA 1NB2A 3VVTA 2C2ZB 1DQ9A 3PX6A 2BACA 2IM3A 4B3RJ 3IG1A 2B43A 3PFEA 4HT7A 3KXDA 1Z2ZA 3PXGa 1TK8A 4ZCIA 4G65A 3E01A 4C8ZA 5DG7A 2IBOA 3MTKA 3OW2R 1S9EA 1UZDA 3HSJA 3RB0A 3BQ0A 1IR0A 3MMAA 3Q89A 4OQJA 1S7IA 4ED3A 2EK1A 2OTLS 1ZAVA 4BLGA 1EARA 1HHQA 4QJVA 3L3CA 4ZVQB 1R0AB 1RWXB 2NYIA 2E1RA 4DV4J 3NNCA 1Y3KA 3JQKA 3ZNJ1 4O44B 4QWEA 3HKZD 4EGLA 1ZETA 4PUOA 2XHWA 1XR5A 5CYMB 2XGPA 3EUNA 2I9SA 3IA0A 3J7YU 1GMUA 4M5KA 3IR6B 5HBMA 1J5EJ 2XSJA 4DUYF 2CQ1A 4F36A 4IG0A 1OS5A 4X62J 2BMBA 1EAYC 3D6FB 3MUMP 4J9VA 3PR4A 2BDPA 4EZ6A 5E0OA 3LUYA 5J1NA 2FD2A 2R7VA 4CNYA 1SKRA 4CLZA 1GXUA 1CSJA 4FF4A 4QWCA 3UPFA 4DSFA 1VMBA 4M95A 3A8IA 3I56S 4K4SA 3Q83A 1U0HB 3KLHA 2ZD1B 5LMNF 3E2EA 1P1TA 1IKWA 4ZVRB 1RT5A 5G4DA 1KQSR 4ILRA 3AD9C 4OZ1A 4JV5F 4H4OA 3DRRB 2HQ3A 2WTFA 2HLTA 2BKNA 2IM2A 4C0OC 3H4DA 4C8NA 4C0BA 2JEIA 2EFPA 2L9WA 4YQWA 1YI2S 3DLEB 4MK8A 4EWTA 3FZBA 2IVMA 3PG9A 3THTA 1FJEB 3KLVA 2A10A 4I6WA 3ZZYA 2HVHA 2ZBCA 2ATLA 4F0MA 1S49A 2H51B 1U8SA 3ZTQA 2B8QA 3ILIA 1KN6A 3J81U 3VR1A 4DHVA 3PHTA 2KTQA 3G4SS 1AXQA 3IRWP 1IKXB 3DC2A 2KXNB 2ZOMA 1CJTA 2OPPB 1RAGB 2V2VA 3KWMA 4Y3CA 4FS2A 2XEXA 2K1RB 1ZBTA 3HHDA 3D6HB 1YZ7A 2Y1RI 1HHTP 1XN9A 3NGRA 2QLBB 4X84A 4C7QA 4HKQA 1RT2A 3OUYB 4JI2J 1X5SA 4W98A 1NSPA 3R6LB 1N4LA 3MGJA 2R7QA 4ZHRB 4DFPA 3MEDB 4JOUA 4K5RA 1T94A 1VR6A 2V8DA 1JMTA 1RB0A 3H5YA 1WG1A 3MCNA 1YRUA 3MM6A 5ETVA 3QLHB 3CCTA 3POTA 3NAHA 5C7PA 1WTBA 4OI2A 5GAHI 4I7FA 3V4MA 2VICA 1HLWA 3IBCB 2GCFA 3BO3A 5KFLA 2NUHA 3LPEA 2FGCA 1MN7A 1D3WA 2C3UA 4GKJJ 1IQZA 1GTEA 2RRNA 4AT1B 2VIHA 1PILA 2K7KA 2F8HA 3C2PA 2HS0A 1UWAA 3GFZA 3P5BP 5IM0A 2IA0A 2KH9A 3HM9A 1PYOB 3WQPA 2YQ1A 1EP4B 1RP5A 1RKJA 1RWVB 2BJ9A 5B0BA 3DFEA 2Z56B 2G2OA 4KFBB 1E6YB 2YX1A 1VFJA 2YWKA 1FNXH 2EG2A 2HW3A 2IAJB 4DSJA 3TJ8A 4L75A 4BWMA 1RWPB 2AP6A 4ZOSA 2DR7A 4LF5F 4OX9J 1MROA 3GTYX 5DQIA 3GU0A 1U45A 1SL1A 4DI6A 1FRIA 3RAMA 4CM2A 4A8WA 4Y34A 1YX2A 4CYUA 1K0TA 4UOGA 1REGX 5ETPA 1TKZB 4RW4A 2PMZD 3J80Y 3PNIA 3UDLA 1RAAB 2WCXA 3O5TB 1RBAA 4TU9A 2EI5A 1WI6A 1B7FA 1UFWA 1NKCA 5KFAA 2CQGA 1ZOTA 5C24A 1X60A 1X4CA 4NOHA 3BGRA 3IAS9 3H2VE 5E3PA 2GMHA 4USMA 1FTCA 2QL9B 4WKRA 1OY8A 4ECTA 4MK9A 2HURA 1GNKA 4LFBF 3D54A 2DR5A 2E9TA 1TAUA 1TUWA 2GIQA 3P49B 1P9YA 4WFBQ 4MJKA 3KJQB 4BCAA 2HYIB 3DOLB 4BWJA 1C0TA 5HMXA 2QFJA 2VPXB 5KG4A 2BKPA 5DETA 1M90T 4IOAQ 2VOPA 3MMJA 2QEXS 2W8LA 2HGLA 3VALA 3H42A 4I0WA 3W5ZA 2Q79A 3G86A 2ZVSA 2X3DA 3G96A 1YTYA 2R8GA 3J81Y 2KL8A 1FX4A 1WEZA 1NBEB 2UUTA 1XK8A 3QT8A 3HFKA 1OY6A 3OL7A 4E8UA 2J9EA 2VPWB 3QPIA 4FXWA 4JI6J 2YQ0A 4I2PA 2XMAA 4AL7A 1GH8A 1N0VC 3TA0A 2XM3A 1JQGA 3IM8A 1NH8A 2W24A 2YQ3A 3QGHA 4TU8A 1IKYA 3M8YA 2L3MA 3CDEA 2RS8A 5IV4A 1HPZB 7FD1A 4YHHJ 4CH7A 5GAGI 1UEUA 2P8IA 3JYTB 5T7LB 4RZRA 3CULA 3IXQA 4NLPA 5D0EA 4F8RA 2L41A 1NK9A 4Z37A 3BN7A 1I94F 1FVSA 2F4VJ 2B9YA 4IFVB 1QUVA 3JSBA 4DL2A 5HP1A 2HHTA 3PZPA 4DX6A 4ZPTR 3DXSX 3CMAS 1DZ5A 3M32B 2EWHA 3DDIA 4NXNF 2W9AA 4ECQA 4LIWA 4QU6A 3QSYB 1BQMB 4X4SA 1SJ3P 2ZM6J 4C98A 2RDJA 2VJUA 1RT3A 4M5IA 2F63A 4J9NA 3JSMA 4HI1A 4B9LA 2LEAA 3PO4A 1EKRA 5A6PA 2C2MB 2CXEA 5G0RA 1T03B 4IDKA 2CAJA 5E2QA 2X7IA 4LSNA 5D4LA 1U1QA 1SIWB 4DUZJ 1KVKA 1NEEA 1C1CB 4F0KA 2DCUB 1OQ6A 3VGUA 2CJQA 3NGDA 1R8BA 5AT1B 4CLLA 2Y8YA 3QFWA 1E6VB 1HYSA 1TKXB 4X4QA 4ZVOB 1HNWF 3T1HJ 5DGAA 1VQPS 5F8MA 4ZCLA 1Q82T 3M2UA 5M2UA 4IH7A 3QRPA 1YWXA 1OO0B 3QBCA 1DTQA 3RBXA 2MQOA 1WF0A 3NBPB 3RW6A 4Z2XA 1XERA 3BDEA 4HACA 5IT9U 1RACB 1G7CB 2V5HG 1XNRJ 1WD6A 1S0MA 2V2ZA 4QQBA 5L39A 1VQ4S 3E8OA 2CPDA 3DLLQ 2BVZA 3UFCX 3CMQA 3HD1A 2UXDF 1RHUB 2PA3A 2PEBA 3O1LA 1O51A 1U0SA 2Q3PA 4IQMA 3KTQA 1RLCL 1HW9A 1HARA 4P10A 2V34A 5M2RA 2ERRA 5ETMA 4ZKAA 3U02A 2HHVA 1BHNA 3GMGA 4ECXA 1AT1B 1UCNA 4JI8F 4ZJLA 5IOLA 1BY9A 4WIIA 4DG1A 2QSFA 2EFVA 4TN2A 4LBPA 5C25A 5C5JA 4ED7A 1S6OA 2DXEA 4ILLA 1RAJA 2CQ4A 1HQ2A 5I3UB 1AYEA 3I0RB 3KHRA 4NLSA 2BXJA 1H2TZ 1UZHA 3SFGA 3KUGA 3IN5A 2RMLA 1GK8A 2EFQA 2MQLA 2XQCA 3C8YA 2WVDA 1RTHB 1QSSA 2M7SA 2OI2A 2NYHA 4JB8B 3I4PA 3HVTB 4MIBA 4PG4A 2BE9B 1QD1A 2MB0B 3ZZZA 1F5BA 2BJ1A 2NXEA 3T41A 3NGKA 4TLRA 2E5HA 2P6TA 1I1GA 2F1FA 5CA5A 1M1GA 1IXKA 1GX6A 5D4OA 1JLEB 1N36J 4H4KA 4FXDA 3HHLD 2F3JA 2EEYA 4QW8A 4O4RA 3QAEA 1SPBP 3UVJB 2AD9A 2ADCA 3EDQB 4O3PA 2I5JA 2BABA 1YGYA 1Q7YT 3ZTSA 2C22A 2IM0A 4EU0A 5CHCB 4JI0J 1WKJA 3JQMA 5A8RA 1VQ6S 4KH0B 1X7VA 2GMJA 3HCXA 5DQGA 2DR6A 1FJGJ 2XO6A 3GLJA 3GG0A 3MM5A 5K14B 3DCAA 2JFKA 5DDRC 2BQ3A 1WKKA 4MYTA 4OHWA 2QN6B 2NQPA 3KDNA 2OGUA 4DPOA 3QIPA 4NEYA 2LU2A 4M5DB 4NCGA 4FF2A 1NJIT 3MR3A 2VFUA 1HQEA 5F8HA 5LOQA 3P45B 4DQQA 2B51A 5B09A 3MHYA 1IKVA 4NA3A 3RR7A 4HH1A 3Q8RB 4KGKA 5MLCV 4FNIA 5GADI 2ZVIA 2W4PA 2ZNYA 3T5LA 3LOUA 4OYOA 1EB0A 5JMNA 4FPRA 3HSGA 5BXIA 4DR2F 2P6SA 2YKNB 3CD0A 1S1VA 4JI1J 1S1TB 3NEKA 1C2PA 4O4GA 3MEEA 1LW0B 2J9DE 2XLJA 3ILOA 3LPYA 1PAUB 3H59A 1YG0A 3NG8A 3D9BA 2V2QA 2J6SA 4KY3A 3GP9A 3FK4A 2XS7A 3H90A 1P9QC 4ECUA 2JEJA 2MZSA 1RT6A 4NPOA 3B8HA 2QLFB 3M7VA 4DPXA 2XWXA 1I3OB 3TAMB 3KHLA 1FD8A 1T9YA 2WW8A 2DH7A 3AJDA 3PJXA 2YNFA 4GVBB 1IQTA 3OR1B 4Z7YA 1S5ZA 4QIWD 1JLBB 3KKFA 3I5CA 2MSTA 3BSAA 3QAUA 5U47A 4WKYA 3KJVA 2FHJD 3UI3A 3IGNA 2YKPA 4BS2A 1JIHA 1UWBA 5J2PA 3W5YA 3UCGA 1CS4B 4DR3F 2NZCA 3ULHA 2QJ3A 3D1HA 2OAUA 4B9UA 4NZ0A 1YVFA 2MDAA 2GHWA 1DQAA 2RD5C 1EETB 1MMLA 4PG7A 2CG8A 4Q5VA 1VJQA 1F9FA 3CDBA 1TV6A 1PC4A 1RAEB 2GA7A 3KLEA 4WK1A 1IBMJ 1ZM9A 4NRTA 4DPTA 2W9BB 5DZ7A 1AW0A 1NDLA 1RGVA 2AT1B 2MKCA 2CQCA 1MWZA 2J8SA 2C2EA 4MAKA 1VQSA 3TZXA 1R7IA 2QA2A 3BV8A 4OZJA 2NLWA 4DX5A 1K47A 4UW2A 2I2YA 2CNOB 1DBDA 1XNQJ 1IJEB 4RW6A 3LW5C 2YNGB 4QIFA 2B0GA 5FDLB 5JUMA 2HKEA 3HVAA 4YB6A 1FDBA 3PJWA 2HBZB 2RDDA 4CI0B 1F9EB 4LR7A 2KRRA 2MZRA 1P8GA 1OY9A 2CQBA 4MT1A 4DR1J 3BPDA 4PXCA 2XB2D 3WDOA 4P2XA 3GR0A 2BR0A 1OJ4A 1X8DA 2R7OA 2HZVA 2I0XA 2CA9A 1Y3JA 2K2PA 1SV5A 2RNEA 1S4FA 4OLPA 1HQUB 2MQMA 3DLGA 2B6AB 1S12A 1H3DA 1PIEA 3MEGB 2DYAA 2EW9A 4DV2F 4JV1A 2P9CA 3F73A 5D3GB 4KHPF 1UVMA 3ZO7A 2W2OP 2DXDA 2HFSA 1IR1A 3DMJB 5E3CA 4WE1B 3K0JA 2YKOA 2ZZMA 4ICLA 4C4WA 2WW4A 4F4WA 2O3DA 2MZ1A 5KFOA 2ZHAA 1WKLA 4QZVB 3B4MA 5T41A 2VH7A 5LJ5Y 3M2VA 1F0XA 2LQJA 4RNMA 3H5UA 3CCSS 3P3DA 4NLRA 4ECSA 2J0SD 3JB9k 5B0AA 3PYEA 4O3NA 2G13A 4Y28C 2WOMB 1R8CA 1F5CA 1K8AT 2YNIB 8ATCB 2BOAA 4PR6A 4NLWA 4PXDA 1RT1A 4ZPWR 4A8XA 5K8MA 3HP6A 1XR7A 3H8YA 1C0UA 2BBEA 2DNGA 1M5HA 4L76A 2RT3A 1KC8T 1X4EA 4LFCF 1LWEA 2ZH2A 2IJRA 4ZPDA 4B3MJ 2OMOA 1FDDA 1WC0A 4ZMMA 5K8NA 1A7GE 4P74A 4KKOB 1PJ5A 3NS5A 3QZ8A 2KM8B 2ZDPA 4NLUA 1N5YB 4ER8A 1VDHA 5L46A 3G8TA 1KFSA 3DI6A 4A8FA 4K59A 2AZ3A 2OKQA 2DGOA 1FKPA 5C2GA 4WF9Q 2VDHA 1Q81T 2D3UA 4O3RA 1U48A 2HGNA 2MLXA 4X4UA 5HLFB 4ITSA 4P72A 3SI8A 2PSZA 4B3TF 3W64A 5ADZA 2ZHOA 4ZDNA 1RBOB 3TANA 3OBIA 2R3VA 1EQ0A 1TUVA 3OL9A 3CE8A 2MKIA 3DOMA 2CJ9A 1TK5A 4EO8A 3HFVA 3AT1B 2EPIA 4UZCA 2FUG9 4OYZA 4TQRA 1VRTB 3KNGA 1TVRA 4UT4A 2FVQA 4LJMA 4FP9A 2AYMA 2NZ4A 1XBWA 1BQNB 1K44A 3W2VA 2B7CB 3H25A 1GXTA 5DLFA 1M1KT 4B3SF 1S77D 3R5GA 1F5AA 1U1MA 3AA8A 1L3SA 2COLA 2IA6A 3MMBA 2DRAA 1SC3B 2R7WA 3P96A 1N34F 1D9FA 1N33J 3C16B 1S79A 4TYBA 2A6MA 1XMQJ 3W8GA 5ITHA 3H20A 2XMWA 2YKAA 1RAHB 1ZZNA 1LWFB 2YX7A 2VUGA 1TL7B 4DV7J 3LALA 4CT8A 4WFAQ 5DO2A 4ZIWA 4K4YA 2AGOA 3C6TA 3MUTP 5HJYA 3CCVS 1GX5A 2KKHA 2GQQA 2H65B 3DDNA 1RISA 4N5SA 3AOBA 3IG1B 4IFYA 4BDPA 3UO0A 2DB1A 3SQGA 4B9NA 3FFIB 3KOAA 1FCAA 2HLUA 2O66A 3V4IA 2DNOA 5EUHA 3E01B 2VFVA 1FESA 2DO0A 3GJTB 3S1TA 1S9EB 3MTJA 1TQLA 3MMAB 1WC1A 2V9KA 3TWZA 4JI4F 1NK7A 2XG8A 4ECRA 5KFDA 4DV5F 4RUAA 3R7BB 2KVIA 2N3OA 5HI7A 1R43A 3WX4A 3C19A 1Q86T 3R9LA 3TYTA 2DRBA 1HNIA 1RT7A 2KYZA 2Y1IA 4DL6A 1X4DA 4LF1A 5HBMB 1YIJS 4DPUA 3R2CJ 4RBVA 3KYLA 4IG0B 4ZPCA 4U7UD 4HYKA 1SUQB 4K0KJ 2J8AA 3CT9A 1NKBA 2BYCA 4U9RA 3TA1A 3C3LA 2LCWA 2RJZA 1HI8A 4IRKA 2ZC4A 1L3UA 4ZLJA 2D3ZA 2LQ9A 2K8GA 4X4OA 3KLHB 4TY8A 2QFIA 1M5OC 3W66A 1FEHA 4PRFA 4RLEA 4FBTA 1RT5B 4DV0F 3DKDA 2ZC3A 4RW7B 3K5MA 1VOMA 3PEHA 3VGSA 5L38A 4LF4J 1MU2A 3FGVA 4CLPA 4B9MA 3MDFA 2M70A 3L95X 4IG3B 2HK2A 3TX8A 2VASA 1RCOB 3A3NB 2GVZA 1JXLA 3RGIA 2OLWA 1UJ5A 3BGFA 2OD4A 1RJJA 1UA0A 3NOCA 1T9UA 3OSNA 1JXVA 1AFIA 4DS5A 2J6TA 3KG4A 3BKUA 1VRQC 2ALYB 3TAQA 4NI2A 1LW2A 1Y9OA 1WC5A 4LIRA 3RB4A 4DV4F 1ZPVA 2DNKA 3HDSA 2XZWA 1RTDA 2Z0GA 1FHTA 1T11A 2ZH8A 3FDSA 1T3NA 4E98A 4KRWA 2WVEA 1ELOA 4YB5A 2R8KA 4F7VA 3PKMA 4WZMA 2CVEA 4EYIB 2UU9F 2DIUA 3M9MB 3MM7A 1EQMA 2FJAB 2V2KA 4X4VA 4X62F 2C2DA 1VJWA 2QX0A 1T7PA 3RAXA 5KFUA 2HRTA 4H54A 4PAAA 2HMIA 1RT4A 4RNOA 2DEJA 2A1BA 5ETTA 2RH3A 4PYDA 2W2NP 4GVLA 2ZH6A 3EICA 3RRKA 2AJ1A 4LR9A 3T9ZA 1S0VA 2HVZA 4J9UE 1TL1B 2QGFB 4USKA 3THVA 3BGOP 3N4WA 1QE1A 4N7TA 1OQ3A 3NWGA 3MM6B 4A4JA 1FXDA 3NNAA 3I5AA 3POTB 4KIAA 4USUA 2OPSA 5IZHA 1M0SA 4QPXA 4L3NA 5K8PA 5KFKA 3M1VA 2VA2A 3D1OA 1FD2A 2NPFA 4DCJB 1H98A 2VQFJ 3D5MA 3GR1A 1EX8A 4O23A 1F3FA 1IJFB 4HTJA 3MR6A 3JSRA 5IM0B 2CQPA 5IXUA 2DGQA 2GAHC 4H4MA 1RWMB 2L48A 5I3PA 4DQIA 3CJKA 3B4DA 1X0FA 4EUVA 5DM7Q 1FEEA 4OZNA 4DF8A 1I51B 4FZVA 1U1RA 5IC6B 3BYPA 2XLIA 4CLTA 1MROB 4OI4A 2HNYA 4QU7A 5M2PA 1WJ9A 5EX3A 3AXMA 2IRYA 3MM9A 4OYMA 2FTRA 4CQ1A 2R9LA 4CYUB 2F8EX 4F04B 4RW4B 2GIRA 4I68A 4IOCQ 1WDDA 2DGVA 4ELUA 1GMWD 1NPKA 4GO5X 4JI2F 1NK4A 5C24B 4O0IA 3M6UA 2KM8C 3LF0A 2PFDA 4DR5F 2CKWA 4DV1J 4JI5J 4DV6J 1UL3A 1CC8A 2GS8A 4OX7A 1HBMB 4LRAA 3BH7B 3CDUA 1WTFA 3R6GB 3QMQA 5D77A 2JEGA 1JNRB 5CD4H 2C28A 1C0TB 4P7VA 2ADBA 2VC0A 4C3KA 2GQCA 2BJ8A 2WHOA 3BN4A 1KSPA 2U2FA 4GKJF 1Q8LA 3ISND 1X4BA 2FDNA 2DY1A 1TL5A 4HI2A 2NCKL 4OZ5A 2IVFB 4QWAA 2ZWPA 3GZ7A 3IWLA 4F50A 5J2QA 5KFXA 3SEOA 2R2TA 2U1AA 3PW4A 1HI0P 3L4BC 2XS5A 2XC9A 3MM8A 3UN3A 3UN5A 4I2PB 2B4OA 1A0OB 4XDDA 2HEKA 2MJUA 3IGVA 1HNXF 4GKKJ 4ZLLA 1RHRB 5F3ZA 2VQEJ 1KKHA 3TOQA 3KNAA 1S6QA 5GAEU 5DZ6A 2HS4A 5KT6A 1FRXA 3AD7C 2M88A 1YQHA 1X9WA 3DOKA 5FJ4A 3N28A 1U1LA 4FF1A 2PA8D 5J2MA 2F40A 4IUFA 4FYDA 4LF9J 1KQGB 1S97A 2XY7A 2VODA 1RAFB 2R7XA 4EBEA 3ET6A 4LVOP 5HP1B 4ETZA 2E7VA 3T5JA 4WFZA 3LTOA 4DCPB 3N0VA 1VS3A 4FKXA 2ILYA 1CJUB 2D3O1 3ENQA 3QATA 4J9OA 1NDKA 4AUKA 2RF2A 1NHVA 3N79A 3EVWA 2DHAA 2DNZA 1FNMA 1NNDA 1RT3B 3OT9A 2G2YA 3JSMB 4CRJA 1RA6A 1P1LA 3CC7S 2OEMA 2QIFA 2I38A 5G0RB 4LSNB 2NUUG 3UD4P 2CPIA 2VG6B 3PRDA 1DRZA 5HMYA 4M5JA 6FDRA 4DR7F 1PJ6A 5LSRA 4ZCKA 2AJQA 4OMFG 2LU1A 1Q79A 2DH9A 4I69A 3MCSA 1HYSB 3GIMA 4XIUA 2LECA 1FWKA 4IRCA 2OPQA 4W4MA 4LF6F 1TR0A 3BGLA 2WZ1A 2G0IA 3M2UB 1UW9A 1JLGA 1VHFA 1RSCA 1DTQB 1ULRA 4NLYA 4V19J 1UEVA 3S8SA 4J5OA 4WU3A 4XPEA 4NA2A 1EHWA 3MR5A 2X51A 4FDFA 2ZKTA 3Q2TC 1KHWA 2HHSA 1U26A 2HQGA 4WJBA 3AODA 1T3OA 3GFYA 1JLCA 1H2VZ 3H2LA 2IPOB 1DARA 3UE2A 1YHQS 1KHVA 4ED6A 6AT1B 2QZ8A 5L9XA 5DDQC 1H38A 1FTRA 4DL5A 2DJWA 2N4CA 4QIVA 2IYGA 1YJWS 3TVKA 1TFYA 4TNOA 3EYZA 4U6PA 5L8RC 1V3ZA 2IMOA 3OXGA 2IRXA 5IQQA 2HQIA 4DG1B 2EG1A 3DGPA 3OLAA 3LGMA 5LMNJ 3BGUA 1ITPA 4FYYB 2CRLA 1WHYA 3EPGA 4YB7A 1UPPA 3GJQB 2ZJPQ 2V63A 1KD1T 3DN9A 2O1PA 1WI8A 2FJDB 3BSCA 3OD2A 2MKKA 3WC0A 1J2VA 3LQVA 2LLZA 2LDYA 2NS1B 2XMMA 3TA2A 3BSOA 3OLBA 3HVWA 2PIIA 3MR2A 3C46A 2DPIA 1CBKA 4MKBA 2KT5A 3T1HF 4YB1P 4RO0A 2YY3A 2UUCJ 2K3IA 4RUCA 3UD5A 1FA0A 1R6VA 2BQUA 2W9CA 1B99A 1HL6A 4KGZB 1ZM4A 1R0AA 3EM1A 1FWPA 2VHGA 1JX4A 4O44A 3JQJA 2HHWA 4PPZA 3W1YC 4HDHA 3FBEA 3VZIA 5CQGA 5CYMA 1Q4RA 3KJFB 1HR0J 1XNRF 2ZH3A 4CDIA 2DISA 3E3XA 2MQNA 2OO4A 1BD6A 1B7YB 1NHUA 4QIGA 2AYBA 1VQOS 2I5JB 1XTZA 3NWRA 5I4MA 1RHQB 4LF7J 3KLIA 3T1YF 2XGQA 4AFFA 1DTTB 2DTJA 3Q2SC 1UJ6A 4XPCA 2UV8A 3GQCA 2DHSA 1Q8BA 3S01A 5IT0A 4FYWB 3C15A 3PRBA 3TJ9A 5E7OB 2ZD1A 2BM1A 2XYPB 4G1QA 4X4RA 4A8OA 2V0NA 4HHHA 1VC5A 4URGA 3L7PA 1RABB 4NCGB 3U1LA 4FYVB 2KG1A 3CJ4A 2QTWA 4L74A 2RRAA 1JLAA 1QUPA 3NGUA 2XI2A 3QO9A 2KZMA 1N54B 2YWHA 4CLKA 1GMVA 1IKVB 5KFPA 2KU7A 5THWA 3M8QB 2POKA 2KHDA 3RU0A 1FVQA 2VFSA 2VU5A 3KMQA 5GVQA 2ATCB 5KG0A 5HJXA 3HFZB 2CQ2A 4UUXA 2MQ8A 1S9FA 3G8SA 1H7WA 4QBUA 1AA1B 1GMWA 1QM9A 1PKUA 1S1VB 2DPJA 1N36F 1PSDA 3FSIA 4O4GB 1PO6A 2OPPA 1HBUB 3MEEB 4LF5J 1FO1A 4PWUA 3KK3B 4ELVA 4M5HA 3UR3C 4DSKA 1W7WA 2K1RA 5CCLA 5LMUF 2L9DA 2H4YB 3GJSB 5E33A 2LXFA 5D4NA 2HFUA 3OUYA 1U2FA 5D0HA 2BE7D 4UQTA 5LXYA 2UXBJ 4JI7J 3NL0A 2XMJA 2VFTA 4QYZJ 3MEDA 3T6BA 4NLTA 1B70B 1S9GA 1ZTWA 4FBUA 2ZH1A 2HK3A 1N5TA 3PDNA 4P7TA 1WSVA 3KJVB 4LFBJ 2BEFA 3N01A 2C3OA 1UWBB 5J2PB 4OIXA 3P8BB 2HWHA 5CZVA 3KDOA 2UUWA 5D15A 2B9WA 5KFYA 1OPIA 5B0EA 1U1PA 3TARA 3G6ES 3CGIA 2MYFA 5ETRA 4DL0C 4AD6A 3M8RA 4ECZA 2DNHA 1NO8A 4LQ3A 1UP1A 4LF8J 3MAQA 2L9NA 2XMKA 1SKSA 2J9DA 3BO4A 1TV6B 4X65J 4PPDA 1JKHB 2V8VA 3MCOA 3CUNA 2NXCA 2WBRA 5GMDA 4I64A 3MFIA 1JLFB 1EP4A 1D09B 5IV3A 4DOZA 2ZITA 3KUEA 2EC0A 1OWXA 3ZNUA 2CZ9A 2D3OR 1ZYQA 2ZBQA 3K5PA 3DM2A 2DGXA 3CDWA 3PV8A 4JI1F 2KFNA 1U6ZA 1N6QB 3VAJA 2QO3A 3TQ1A 1S0NA 2UUBF 1X9SA 1TFWA 7AT1B 1JNZB 3IO1A 4MKAA 2OSQA 3AQPA 5LSOA 1N48A 1ZA2B 4X66J 1WG5A 2PMHA 5K8OA 4OV6A 1TKZA 3QYYA 1KOOA 3U7JA 4L3KA 3JAMU 4Y2MA 1KVJA 2WVCA 3QSIA 2ROEA 3I9V9 1VGYA 2C2OB 1FF2A 3SMZA 3DRPA 4K8RA 4W92B 5KFQA 4NLXA 4X64J 1U47A 1TMJA 4NXNJ 4KH1B 2CNKB 1Y00A 1SV5B 2OEJA 2N7YA 3VGTA 1VRUA 2HQCA 5H9FK 1ICEB 3G9CA 2GX8A 2AW0A 1P6TA 3KK2A 2XY6A 3MEKA 4Y2KA 4TLQA 2PGCA 4E0DA 4ICLB 4F67A 3OHAA 5KFVA 4WTOB 2EKYA 4JP8A 5FLXY 1CJKA 4Q2LA 3DYAB 1HA1A 2I8EA 1NU4A 2NSCA 5I42A 2IYIA 1NSAA 1NCLA 1HMVA 4Y65A 1B64A 1T9TA 3TEHB 3ISZA 2UXCF 1T0TV 4KYZA 5E3RA 4A46A 1RT1B 1HWKA 3HHNB 3IFEA 3Q8YA 1UEKA 2I1RA 1SH3A 4V1Ak 2KXHA 4DN9A 2HIYA 1C0UB 3ZTRA 1IWGA 1XNQF 4G3IA 5HAOA 2GC8A 2R8HA 3BQ2A 3N9UC 3FUYA 1FERA 4J9LA 1LWEB 2UV8G 3I31A 3FC9A 3SCLE 2PI4A 3IBFB 2VOOA 5JVGQ 4NL5A 3TX0A 3G6XA 3US5A 1W26A 3X1LB 1UMJA 3KG0A 1CVJA 1Z2LA 2JVOA 3IS9A 4OYBA 5E3QA 4PCQA 4EZ9A 2Y1JA 3ZZOA 4JI8J 4KPYA 3EX7B 3PYDA 2WVBA 3M32A 2VKRA 4CM0A 1D8YA 1Y11A 1QAXA 3CJ2A 2Q6CA 3DI6B 1U1KA 3BH6B 1UVJA 3DLJA 3G82A 2V4QA 4NEZA 1FKPB 2E5JA 3PACA 2FC9A 1IM4A 2VONA 4WFNQ 1FT8A 2I6WA 3K17A 2QT7A 1X0PA 1JLQB 2AYEA 1QSLA 3C14A 4B3OA 4K4VA 3JTOA 2M2BA 2WB1D 2CPXA 3RB6A 2RAQA 1CC7A 3OHBA 3FRZA 1R8HA 2RHSB 2Q6BA 4CP5A 1E6VA 1QLNA 1TKXA 4MIWA 2R8IA 3VAIA 1FJ7A 1D0EA 2FLPA 2LXUA 4CO4A 2HVDA 2LDIA 4O3SA 3W2VB 1D8ZA 2UUAJ 2VFRA 1LFPA 2HRYA 3QNWB 2ZZTA 3VZHA 3H0PA 4KGXB 4MK7A 2GHPA 3MMBB 4XK8C 1RLDA 5DS7A 2G9OA 3JAMY 3D66A 1X4HA 2KDOA 2ZKUA 2E5LJ 2B9XA 3R1HA 2KRBA 3C66A 2PC6A 4M94A 2DNRA 2BRKA 3HF5A 4B3MF 2AJ2A 2QA1A 1XC9A 5B0GA 5EX0A 2XHCA 3I55S 4WP9A 1SC1B 4HR2A 2CG4A 5DRKA 3BBBA 3BREA 3I0SA 3Q8PB 2JRSA 2BQRA 1SJ1A 1LWCB 2PFFB 3AOCA 3Q24A 4DL4A 5KFRA 4FVCA 4I6YA 4ZPAA 4J9RA 4HTIA 4IFYB 5A8WA 2HVIA 3SQGB 4MKVA 2AJ0A 4DXLA 3FKBA 3MR7A 2CJYB 1F1BB 1SBRA 5DQHA 3D6TB 5A8KA 1XWLA 4GRSA 4CH1A 3ZZRA 1VQMS 1Q5VA 5I3UA 4ZJOA 4ZVEA 3QT7A 3LP1A 1N5SA 4KO0A 1ZS6A 1S72S 4QWBA 5DDPC 1RA7A 3HHEA 3F44A 4U95A 2ZJQQ 4O0NA 3ENAA 4YR3A 1U02A 1OIAA 2BRLA 2YWEA 4Y00A 3CF5Q 3I96A 4KV8A 2MJNA 3CCZA 1RT7B 4WCEQ 4OYPA 4NCAA 1X4AA 3K5OA 3S6EA 4Q44A 2GAGC 1X5PA 2RE1A 1NH7A 1OMSA 3ENVA 3R5DA 1F2GA 4R5PA 1C4CA 2RILA 3PW0A 3ZZPA 1XMOF 4DR2J 4NLGA 3MPWA 2D69A 1YITS 3IC1A 2RQMA 1X4FA 3BPSP 3EGVA 5CAAA 4G1IA 2QL5B 3U27A 3M8PA 2DNQA 1JJ4A 4WWSA 4DLEA 1FNOA 3ITHB 4F2RA 1U7LA 1XMQF 1CULA 2ZFHA 1UFLA 4RJVA 1GEHA 4DV7F 2OELA 1N8RT 2AX0A 3G87A 1XIQA 1S1UA 1MU2B 2QE5A 2HPUA 1Z4UA 3TW0A 1WC6A 3GFHA 3ZXWA 3AB2B 3WBZA 3N5FA 4YP3A 5LL6d 3A8KA 2JLEA 3JTPA 2C1EB 4QW9A 2MGZB 3R5JB 3SFUA 5HL7Q 3LGNA 3I32A 4OHYA 2H5JB 5HANA 1PC5A 4Q2MA 4U7CA 3DLKA 4EO6A 2JOQA 1HNZJ 2ZBIA 4NI2B 1LW2B 3SV4A 2KXFA 4F4YA 4ES1A 1S57A 5B0DA 2LA6A 2LKZA 5ETOA 4LRDA 2IC3A 1ZM3A 4DX8H 2BJ7A 1P27B 3VF0B 4U8VA 4DJBA 4RNFA 4LBIA 4RW9A 1VBKA 3GIRA 1N52B 2DVIA 1KDNA 2RIJA 3FNNA 4K4XA 3J7YI 4XO0A 1YBUA 3ILJA 4ZN1A 3MM7B 4AXJA 3PR5B 4IO1A 3VAMA 3R3TA 2HFZA 2IDEA 2HMIB 1RT4B 4F02A 3TZYA 2QLJB 2H1YA 4AE5A 4OL8A 4I6AA 1FFSB 2WSFC 3A4TA 4ES3A 3K89A 4J9PA 2QG9B 2WAQD 1AB8A 2JZ5A 2DIVA 4C48A 2DD8S 2OPSB 4NYOA 2AEMA 2M52A 3M1VB 4ZVHA 2LYVA 3KG1A 4LRBA 1R3NA 4TXSA 3EPIA 4ED4A 4C3LA 3MCMA 3ETMA 4CIOA 1RTZA 3A3PB 1VQLS 1YJNS 1U6FA 1H0HB 2FHOB 1FRKA 2JDJA 4D3HA 3QJJA 2PN6A 4F4XA 1EZZB 3PYFA 4DR4J 1YLXA 1RHKB 1RI7A 1Q78A 3HD2A 4H4MB 3PEJA 3TUZC 2Z30B 3VAKA 4KE5A 3ZFVA 4DR6F 3CXCR 3Q0AA 5B7WA 1TELA 2LFVA 3CJKB 2ZDOA 1LK5A 2V69A 4ERDA 4ES2A 2H54B 3HT3A 3EXYA 1JXEA 3Q8VA 3D0IE 3GILA 1YRXA 3VAHA 3RTVA 2CJBA 1H72C 5HVFA 1GXLA 3C6UB 1YRTA 2HNYB 4J9KA 1WG4A 9ATCB 3CD5A 4DSLA 3D6MB 2EK6A 3UW1A 3HKWA 3SCIE 1C4AA 2OUGA 3M2RA 3IRXB 3VGVA 1QTMA 3Q23A 5J1EB 3KHHA 1KFDA 3NP5A 3SCJE 4DFKA 3GE9A 5CCMA 1WUUA 3QZ7A 4DFMA 1ZPWX 1NAQA 4CO3A 1QAJA 4B9TA 4WP8A 4LFCJ 1AFJA 2YNGA 4JV2A 2PO4A 1FK9A 1UJ4A 1VBXA 1U1OA 1UA1A 2W8KA 1B0PA 5KFMA 2HQDA 2QL7B 2HHUA 2CQDA 1NMEB 4FF3A 3ONQA 1RHMB 5L1JA 2VQFF 4NCBA 1FRMA 4CLFA 4OZ3A 4WIQA 4DL7A 2B8PA 4P75A 3PRVA 2D7SA 2M9KA 1NXIA 2ZH4A 5J2QB 3TJAA 5F9NA 3CD7A 3G71S 3CJ8A 4OI6A 3HJFA 3EGWB 3LP0B 3PW7A 1C1BB 3UR0A 2AJ4A 4DDFA 5D0RA 2ZE2A 2CQIA 2W1BA 2WONA 4QYRA 5GMEA 1HKAA 4RW8A 2C42A 4WE1A 2HG4A 4OJ3A 3OFHA 1Q7LB 2IHR1 3KLGB 1S6QB 4HH0A 2GV1A 1CJVA 4D3GA 2C3PA 1H7XA 5DG8A 5LM7E 3UN2A 1JK9B 3ISNC 1UFKA 2KHCA 3AD8C 5JXSA 1M5VC 1HIYA 5F41A 4B3SJ 8AT1B 3SV3A 3BR9A 2YNIA 3T3FA 3DXBA 3NMRA 5A6WA 2CWKA 4BC9A 4CO5A 2AYGA 3R5AA 5EWGA 2VG5B 4R0JA 2NXUA 1VQ9S 2QLXA 4EYHB 4N56A 4DV1F 3R7SB 1KOHA 4DV6F 4PXEA 4CCHA 1SI9A 2E66A 3FRYA 3VQSA 1BWEA 1S1XA 1WC4A 3BBCA 3SSSA 2RF2B 4ZVSB 1Y4ZB 1RADB 2MZTA 2FVCA 1CQNA 3HK2A 4Y2AA 2GIFA 5GAHU 3SSRA 3WIUA 3TR5A 5DLGA 4YR2A 3OL8A 3G6YA 4A8SA 1SIZA 3MI7X 5KFFA 4FKYA 1G1XA 3VHQA 3TVYA 4DMZA 1SB6A 3VTIA 3JSYA 3B54A 2HFVA 2C2NA 3BBFA 3V5RA 2HNZB 2YWWA 4MIAA 4QWDA 2Y0BB 2EVZA 4YMEA 2OPQB 3DGVA 3OXFA 5HLFA 5KT2A 2B3TB 3K8WA 2VKZG 1JLGB 3OTEA 5IT9Y 2CPHA 4A8MP 4GKKF 2Y1LB 1NK0A 1MN9A 4CT9A 4DN0A 2JH3A 3DRYA 4YS2A 2DH8A 2DY9A 3NNHA 1XMBA 4K7QA 1BQNA 3GCXP 2DITA 2IVYA 3EWGA 1JLCB 1HNVB 1LXJA 3AAWB 4KAIA 3D68A 5SZTA 1SXLA 3BKFA 2IY5B 4HHJA 2B5JA 3C16A 1NZAA 3BM7A 3NCQA 3RG6A 4HL9A 1J5OB 1WOPA 2EXUA 1SKWA 2YPZA 1R0CB 3DGPB 1LWXA 2A2CA 2FZGB 2BE2A 3J7AN 3QT6A 4MKYA 1RU2A 1TL7A 5CYQA 5BJRA 4LSZB 4DV0J 3D28A 1KBRA 2J5AA 1HBOA 2D9PA 4ZCMA 4HVZA 1YJUA 4JUZA 4Q0BA 2FY1A 3BYRA 3FQKA 2J0WA 4Q7AA 3HZEA 2F9DA 1SH0A 4U8YA 1OPZA 1YJ9S 4EMDA 3M9NB 1RU1A 3FFIA 2P2CB 2LXIA 3MECA 3G8QA 1VK8A 2V8PA 4DWIA 2OPRB 2N82B 2QMUB 1RWNB 3FEYB 1N32J 3FSXA 3OTCA 1TK0A 2W9CB 1KR4A 1YBAA 1BQXA 2HHHJ 4X4TA 3GB0A 1I6JA 5FIIA 1QJHA 3F56A 2PI5A 3OVSA 5GAGU 1DHMA 4B9SA 4Y0FA 3R5CA 4C6AA 3ADAC 3QJPA 1TU0B 4QR2A 2UU9J 2QV6A 3OR2A 1CQMA 3T5HA 4USTA 1HWJA 1NM2A 2YX4A 2JNJA 1SUQA 1AROP 4ZJQA 3KLIB 1T05A 4ZPBA 3RJMB 3E51A 4CTAA 3EXCX 4XAKA 5KFJA 4USJC 3OVAA 4PWDA 2GO8A 2DBBA 3J80U 3HXMA 1U25A 1RYSA 3NMAA 2MPUA 3C15B 4DPYA 4Q8EA 2MKYA 4N41A 1PJ7A 1PGZA 4PWWA 1U8WA 2W4CA 4G1QB 4FYXB 2R7RA 3FBBA 2R4FA 4RU2A 5CYJA 5F8LA 1LEOA 4RW7A 3QGPA 1NSKL 2RKIA 2XLKA 3A13A 4ELTA 1D1UA 2VG7A 3MMCA 3M9OB 4IR1A 1TL3B 4IG3A 3D7SB 3ENWA 2O67A 1JLAB 2Z2ZA 1RE1B 2FQQB 3QO9B 3GSIA 3EJMA 1UETA 2YKMA 3NGSA 1QAYA 4CLUA 1SC4B 3NS7B 2V4RA 1RTIA 4M5MA 2E5GA 1U2RA 2ILZA 5C42A 3D3BJ 1TMMA 2UUCF 5D78A 2DR9A 3HJVA 4C9DA 3TUIC 3M6WA 2WRMA 1T8EA 1KVIA 4RL1A 3CC4S 2XI3A 3H5SA 4OI3A 4YUDA 1HR0F 4NASA 3W63A 1SJFA 1LNQA 1NJXA 1BGXT 4ZPVR 2J0QD 2AGPA 1U24A 4WU2A 3RB3A 2CPJA 4K4UA 4UY8T 1G2EA 4LF7F 3CNQP 5EHHA 1WF1A 2OSRA 1RBLA 4YY3J 4LREA 3KK1A 4LMZA 4DR5J 3MXHP 1QAIA 1S9GB 5L1IA 4OJGA 1IBKF 2KYXA 4C8MA 1TL1A 2G0JA 1DY3A 4IOBA 2CUYA 4NRUA 5BR8F 4WYLA 4ZLNA 4A8QA 4UQGA 1SH2A 3W8PA 4NXMJ 3RW7A 3JXOA 2B4UA 3EGNA 1VCTA 4XDCA 1RTJA 4PQUA 3HLUA 3GYNA 3LANA 2XTJP 2HHQA 2QLWA 2YBVA 3BSNA 2RQCA 2YTCA 5JVHQ 2PMWA 5F3TA 5H9FJ 5ETQA 3PHEA 3M30A 2M5YA 2KI2A 3QT5A 2AKWB 3LAKA 1NB7A 3D2WA 1YJVA 3HHLA 5DJBA 5BYQA 4B02A 2RS2A 5EDWA 2ZOFA 2V4JB 4LFAF 1MNEA 4R25A 3LP2A 3DM2B 1NDCA 1F6TA 1HNXJ 2A2DA 2ZWOA 2FLOA 5H9EK 4RX6A 1KRPA 4CO2A 3CCMS 4X2BA 4NLOA 4W90B 3OJSA 1IBCB 4L72B 3H4BA 2ASYA 4OYWA 3VCDA 2RVJA 2ZH9A 4ALZA 2PE8A 1PAEX 1GAOA 3PW2A 4B17A 3HVRA 4WXWA 2YXLA 1V3SA 1KLMA 2K06A 3NGTA 1NRKA 2F4FA 4AL5A 3SXLA 1TKTA 5HROB 4O3OA 3R27A 1NK5A 3FBFA 3CCES 4PG8A 2UXBF 4JI7F 2CADA 5D8HB 1L5UA 2QYGA 2HSEB 3DRPB 2QRRA 2W25A 2IBKA 1HBMA 2MEWA 4RBUA 1VRUB 2O5DA 4ANDA 2SXLA 2HNDA 2VPZB 3SDEA 4QIEA 2GHVC 4ECWA 2DKOB 4KGMA 3TP2A 2RUSA 1W2BR 3KK2B 5KT3A 3PTWA 3NCRA 5B0CA 2XZTB 2E5IA 2NSBA 1OSCA 3LA0A 1PYSB 2FYXA 2IIHA 2MZQA 3CCQS 2ZUGA 3R5BA 2IJNA 1UAWA 4LF8F 3TZZA 1MWYA 4DR7J 2V94A 4X65F 4WBFA 3I82A 5IT4A 1U1NA 3KFWX 4ZP9A 3G2XA 1JB0C 1CJKB 5KG2A 3SYZA 5GADU 2WB4A 2YNHA 4LF6J 4PUOB 5I42B 1N5QA 2HBRB 3TEGA 3RBZA 5AE2A 1S10A 2HVEA 1YK9A 1HMVB 2HWTA 1Q8IA 3DU5A 4NLQA 1F2HA 2XSJB 1R89A 4ED0A 5ETSA 3VV2B 2KFZA 3HSDA 2CFXA 4C8OA 3HO1A 1Q8KA 4DL3A 2LEPA 4UTGA 5HQMA 3RYLA 3I4HX 1OYDA 1SQFA 1U09A 3V6DA 4AQYJ 5D0GA 2DHGA 4XTTA 3S7RA 4AL6A 2GVDA 3PM9A 4X66F 2YWFA 4EI2A 2F5GA 4DBQA 2Q66A 5ETLA 5KFWA 3FZ2A 3T5KA 1EIYB 3QJLA 1LK7A 2Q43A 3MAAA 2FHJA 4MFBA 1RHJB 3T1AA 2IJFA 5KFCA 1IM6A 1WWHA 1TTHB 1IKWB 4JYAJ 3IS9B 4M5GA 2A0FB 3OXLA 1T9XA 2XBPA 3AHPA 1D9DA 4P2FA 1CJUA 4H4OB 1REVA 4X64F 1VLYA 3DRSA 5KFNA 1IWAA 2W7PA 3J7Z5 3G82B 5DG9A 3FMBA 1R6YA 4NE9C 4CWBA 4V19X 3CJRA 4USVA 4B3RF 3K59A 3HZGA 1AZSA 1U49A 4KC5A 1RAIB 3AB4B 4FNHA 3CWJA 3IAM9 2MY7A 2V50A 2Z8QA 3C14B 3B82A 4B3OB 2KZZA 2VG6A 2K3KA 2V68A 1KNZA 1EJ7L 2YKQA 4KHRA 2AU0A 4HT5A 4CNZA 4LBHA 2BV3A 2BANA 1N88A 3CPWR 1UVKA 1CJTB 4F25A 2BJEA 2QA4G 1J5EF 5DDOC 4NYPA 2QA4S 4G1PA 3P6YC 1O6XA 1HBNA 2V6AA 4NMXA 4ATNA 2GO9A 1YKWA 1IUJA 3VVUA 2J76E 2MQQA 3BEGB 1RT2B 2Z2LA 1QY7A 4OLOA 2KT3A 2V67A 2X1AA 4BHQA 2O01C 3UWTA 5KFTA 3TRGA 1NDPA 5AXKA 3WC2A 2CIMA 4DQPA 3T1YJ 3OPKA 3DLBA 2HZAA 2PD1A 3I0SB 4DV3J 4ZS6A 5IWAJ 3GG1A 4I7FB 3QQCD 2CZ4A 3EMTA 1NJYA 1KP6A 1NJWA 2OP5A 4U67Q 2RHQB 4OFZA 1W25A 5D4PA 5A8WB 3IR5B 3BB5A 4I2QA 3PFOA 3I9ZA 1WACA 5A8KB 1S99A 1S1WA 3FSYA 3UNYA 1RQ0A 3LP1B 2R7TA 1KS2A 4KO0B 1FKAF 4LRFA 4N8NA 5C2CA 4E2FB 1NK8A 1R0BG 5LT5A 3MF5A 1URRA 4HDGA 1LV5A 4DCOB 1GQEA 4ETXA 2RUGA 4N8OA 4R0EA 3UDCA 4HHUA 4KV8B 2JHEA 2HBYB 1YJ7A 2R7SA 5KT7A 1FKOA 2VL1A 2Z2YB 3QGIA 2DR8A 3H98A 1QVGR 4R5PB 2UUAF 6FD1A 4IRDA 4DQSA 5L1LA 3T9NA 3TO8A 1D9AA 2HZCA 4R8UA 4UZBA 1RYRA 2DCLA 2HBQB 3TVZA 2ZUAA 5KG6A 2E1CA 3CB4A 4WPAA 1WELA 3FJ2A 3M8PB 1FRJA 1DFDA 2E29A 5AJ3J 3PYGA 2E5LF 4CLYA 3D3CJ 2Z58B 3QRRA 2MHNA 1CULB 4DUTA 2E1MC 3BGRB 3GJRB 4PQAA 3W2WA 1UVIA 2P9GA 3IM9A 1YDLA 5LMUJ 1KLNA 1X9MA 4RWXA 1WHVA 1VQ5S 1N5VA 2FLLA 1NK6A 4PZVA 5J2NA 1S1UB 1DTTA 2GFFA 2FZKB 4ENOA 4M63A 1RKIA 2AGQA 3HX9A 5FD1A 4MMOA 4LSLA 4P2MA 4FXVA 3TNVA 4F26A 2NXJA 3CO9A 3EZ5A 4S0MA 1VIOA 4ZVFA 2EFGA 3PKYA 4ID5A 3MFHA 4X4NA 2BA9A 2MMYA 2AJFE 1IBLJ 5F8NA 5J1PA 3DLKB 4CO1A 1SQGA 1PCAA 1IR2A 2JEFA 4C8LA 4DU7A 5KFIA 4WFXA 1S6PA 1FFGB 2VD3A 3CCUS 2IC3B 2VZ9A 4RUHA 3M8QA 4OZ0A 2XCAA 1Y0HA 2JL9A 1IKYB 1DLOA 4RW9B 3A3OB 5L9NA 3CJTA 4OX9F 2JJ4D 3LAMA 5HMWA 4ECYA 2VDIA 4KJIA 4CO0A 1B0TA 2BZ2A 4EBCA 5K9FA 1BE4A 2K7JA 4UOFA 3RAQA 3OTOJ 2KJWA 2EFOA 3W9JA 4DU8A 2DGSA 2E1PA 1ZZFA 2QYCA 3OL6A 2XCPA 4DZ6A 1HBUA 3FBCA 3V2UC 3K5NA 2NPIA 2UUBJ 5KFEA 3K57A 3GV7B 4ED2A 1QSYA 3KK3A 1S48A 1APSA 2CNNB 2UVRA 1Q16B 3V81A 3GIKA 3QFHA 4JI3J 2QSWA 1KEKA 1TL4A 2RQ4A 2FVPA 3CVKA 2GJFA 3RRHA 2MZJA 4JBCA 2GGPA 3CJ3A 2YVSA 3FEZA 4NLVA 4DLGA 2YPYA 5A0YA 4B9VA 1L3TA 3VWSA 2QMXA 2C3MA 1K1SA 2MLYA 2WBMA 4K4TA 4P71A 2BJ3A 1ZH5A 3PJ9A 4N47A 4A8YA 2RU3A 1SJRA 4IDKB 4OYXA 2G4BA 4OJ1A 4C11A 4FN5A 2IM1A 2H3EB 4DSIA 2OTJS 4RNHA 1PBUA 4ZIVA 2OFHX 2R42A 1HNZF 3M4XA 3W5XA 3N6MA 4JI6F 1SL0A 1DJ0A 1VQYA 2XSFA 4ZP6A 2XWYA 1M1HA 4OYIA 2KT2A 2OMLA 1WHWA 4IKAA 4OX8A 1JKHA 4EBDA 2CPEA 3BDPA 4HACB 3BO2A 1W2IA 2Q1LA 1JLFA 3H7HB 4K4ZA 2AF6A 1HI1A 3OQ2A 1WOSA 4YHHF 3GFXA 3OTDA 2OEKA 1QDUB 2E7WA 3M2RB 3GCWP 2GJ2A 2UXCJ 4DUYJ 1MG7A 1R31A 1SQEA 3VAGA 1T02A 1HWLA 2DNNA 2F4VF 3BS9A 1N6QA 2FJVA 1TP7A 2CPZA 2GJIA 4BBYA 4QYZK 3CIMA 2L08A 1S6UA 1RWOB 3W61A 4IYQA 3ZTOA 2B4VA 2Y9HA 2N3LA 4Z7CA 4ZVTB 3MPDA 2XO7A 2JLGA 1FK9B 4PG6A 3MPYA 3M6VA 2W01A 4EFAC 4DQRA 4YFUA 3ETOA 2D41A 3SCKE 2W4DA 2CDRB 4OV1A 1KQFB 3RZAA 1VC0A 3KLFA 2R2RA 1BUXA 3A8EA 4M5NA 2H4WB 1HWUA 1N0UA 2ZM6F
chains in the Genus database with same CATH topology
2ZH8A 3FDSA 3PR4A 2BDPA 1T3NA 4EZ6A 1RI7A 4E98A 1Q78A 4P6QA 5E0OA 4H4MB 3LUYA 4KRWA 3DDKA 5J1NA 5C25B 1A9NB 2FD2A 3PEJA 1ELOA 4YB5A 3TUZC 2R7VA 4CNYA 1SKRA 3OTBA 3VAKA 5EN1A 4KE5A 3ZFVA 1GXUA 1CSJA 2R8KA 4DR6F 4FF4A 4QWCA 3PKMA 3CXCR 3UPFA 4DSFA 1VMBA 2CVEA 4M95A 3Q0AA 4WZMA 4F4ZA 5B7WA 4EYIB 3CJKB 2ZDOA 3P5TL 3I5BA 2DIUA 4Y2IA 1LK5A 2UU9F 3MPVA 4ERDA 4ES2A 3M9MB 3I56S 4K4SA 5F8JA 3HT3A 3MM7A 4CZCA 2FJAB 3KLHA 2V2KA 4DFJA 4X4VA 4X62F 2C2DA 2ZD1B 3EXYA 1JXEA 1VJWA 1WF2A 4C2MA 3Q2TC 3D0IE 1CG2A 1YRXA 1VK3A 3GILA 4DUZF 5LMNF 3VAHA 3E2EA 5BYRA 3PW5A 3RTVA 2CJBA 1P1TA 1T7PA 4DR4F 3RAXA 5KFUA 1IKWA 1GXLA 4H54A 2HMIA 1RT5A 1A6LA 1RT4A 3C6UB 1YRTA 2HNYB 5G4DA 4J9KA 1WG4A 2ROGA 1HW8A 4RNOA 1KQSR 4OHXA 3O2IA 3CD5A 4DSLA 2ZE2B 2A1BA 4ILRA 2R2SA 2RH3A 4OZ1A 4JV5F 2EK6A 3UW1A 4H4OA 2ZH6A 3PX4A 2WONB 3DRRB 3MWBA 3HKWA 3RRKA 3SCIE 2AJ1A 4RW8B 3T9ZA 1S0VA 2HQ3A 1C4AA 2HLTA 2WTFA 4C8KA 2HVZA 4RNNA 2IM2A 4C0OC 1TL1B 3M2RA 3IRXB 3THVA 3H4DA 3BJYA 3N4WA 1QE1A 4C8NA 1QTMA 4C0BA 2JEIA 1OQ3A 3Q23A 5J1EB 3PX0A 2EFPA 4DS4A 2ASDA 2L9WA 3NWGA 3MM6B 3KHHA 4YQWA 4A4JA 2ABYA 1KFDA 3NP5A 1FXDA 3SCJE 3CCRS 4DFKA 1YI2S 3DLEB 3NNAA 3I5AA 3POTB 4MK8A 2RDIA 4EWTA 2J9CA 4KIAA 3FZBA 2OPSA 2IVMA 3GE9A 5CCMA 5IFMA 5IZHA 3THTA 1FJEB 1M0SA 4QPXA 3GV8B 4L3NA 5K8PA 3KLVA 5E41A 4DWIA 5KFKA 4DSEA 2A10A 3DYAA 1LKZA 4I6WA 3ZZYA 3M1VA 2ZBCA 2VA2A 2HVHA 3QZ7A 3D1OA 4DFMA 1ZPWX 1NAQA 4CO3A 1FD2A 2NPFA 1QAJA 2ATLA 1BLUA 1S49A 4B9TA 1TAQA 1U8SA 1H98A 5AE3A 1KN6A 3Q8QB 1AFJA 2YNGA 4JV2A 2PO4A 1FK9A 1UJ4A 3VR1A 4DHVA 1VBXA 3D5MA 3GR1A 2KTQA 1U1OA 1UA1A 4HLBA 3MUVP 4O23A 3G4SS 1AXQA 3U1MA 3IRWP 1IKXB 2W8KA 1IJFB 3AJ2A 4HTJA 3MR6A 3ZZTA 3JSRA 1B0PA 3R1LA 4Y2CA 3DC2A 3MD1A 2KXNB 2V8GA 5IM0B 5KFMA 2CQPA 3HHKA 2ZOMA 5IXUA 2OPPB 2YWGA 2HHUA 2CQDA 2DGQA 4GC7A 4H4MA 3ONQA 5LSLA 4FF3A 5L1JA 3KWMA 3M05A 2VQFF 5A8RB 2L48A 4NCBA 1FRMA 5I3PA 4TYAA 1FXLA 4DL7A 4Y3CA 4FS2A 2J0XA 4F3OA 1S1XB 2XEXA 3V6HA 4DQIA 3CJKA 3B4DA 1X0FA 2K1RB 2A18A 2D7SA 1ZBTA 2M9KA 3HHDA 4EUVA 5DM7Q 2ZZNA 2Y1RI 3MM5B 1FEEA 5KAKA 2ZH4A 1HHTP 4A8KA 4OX6A 5J2QB 1UW4A 1XN9A 4OZNA 5F9NA 3CD7A 4DF8A 4FZVA 1U1RA 4X84A 3OV7A 2HIQA 3FVYA 4C7QA 3G71S 2XLIA 4HKQA 1RT2A 3OUYB 1MROB 4OI6A 3HJFA 3EGWB 1X5SA 4OI4A 2HNYA 3LP0B 3PW7A 4B08A 4QU7A 1C1BB 5M2PA 3UR0A 2AJ4A 5EX3A 1N4LA 2VBZA 3MGJA 4DDFA 3MAHA 2IRYA 3MM9A 3QIPB 2ZE2A 2FTRA 2R7QA 4ZHRB 4CQ1A 4DFPA 4QR0A 2CQIA 3MEDB 4JOUA 4K5RA 2R9LA 1T94A 4M8LA 2PDAA 2WONA 4QYRA 2BUNA 3DRRA 1RWUA 1HQEB 4RW8A 2F8EX 5LJ3Y 2CDQA 4RW4B 2GIRA 2V8DA 2C42A 4I68A 2A3JA 1JMTA 4IOCQ 3H5YA 1WG1A 4WE1A 2D1CA 2HG4A 4OJ3A 3OFHA 3RBEA 2DGVA 1Q7LB 2DGUA 4ELUA 1YRUA 3MM6A 3K5LA 1NK4A 4GO5X 4JI2F 5C24B 4USIA 2IHR1 4O0IA 3M6UA 3QLHB 2KM8C 1S6QB 3CCTA 3KLGB 3DLEA 3POTA 4HH0A 4HEA9 3NAHA 1N0UA 4LQ9A 1WTBA 4OI2A 4D3GA 5GAHI 2C3PA 1H7XA 5DG8A 4I7FA 3V4MA 4RU9A 1JLQA 1U4BA 2GCFA 3TI0A 3LF0A 4TY9A 3BO3A 3CCWA 5KFLA 1JK9B 2NUHA 3ISNC 4DR5F 2FGCA 4IR9A 2KHCA 2CKWA 1D3WA 2XULA 2C3UA 2DHXA 1UL3A 5JXSA 1CC8A 4OX7A 5EGYA 1M5VC 1HBMB 5F41A 1IQZA 3SV3A 1GTEA 2RRNA 3BR9A 2YNIA 1PILA 4J9MA 3T3FA 2K7KA 3CDUA 1WTFA 3DXBA 3NMRA 4LUBA 5A6WA 1IKXA 3QMQA 2F8HA 5D77A 2JEGA 1JNRB 3K2YA 4BC9A 3C2PA 4CO5A 2AYGA 4K4WA 2HS0A 1MSWD 5CD4H 3R5AA 2C28A 5EWGA 3GFZA 1B0VA 2VG5B 5IM0A 2IA0A 1C0TB 4R0JA 2NXUA 4P7VA 2KH9A 2ADBA 2VC0A 3HM9A 4C3KA 2GQCA 3W3SA 3AQOA 1VQ9S 5GAEI 3CSKA 1EP4B 1RP5A 2QLXA 2WHOA 3BN4A 4MH8A 5KFZA 4N56A 4DV1F 4EYHB 1KSPA 2U2FA 1KOHA 4DV6F 4PXEA 4CCHA 2W7AA 5B0BA 4GKJF 1Q8LA 1SI9A 2E66A 3FRYA 3DFEA 3VQSA 1BWEA 1UVLA 3ISND 1X4BA 2FDNA 1S1XA 4O3QA 3SSSA 1TL5A 4HI2A 2XY5A 4OZ5A 2IVFB 4OI0A 2RB7A 2RF2B 4KFBB 1E6YB 2YX1A 1VFJA 1Y4ZB 2YWKA 4QWAA 3GZ7A 2MZTA 2EG2A 1FNXH 3IWLA 2HW3A 2FVCA 2IAJB 4F50A 1CQNA 4DSJA 1ROFA 5J2QA 4BWMA 4ED1A 2B5JB 3HK2A 4Y2AA 2AP6A 5GAHU 4ZOSA 3SSRA 4Q45A 5KFXA 3SEOA 2DR7A 2ASLA 2R2TA 1RT6B 2U1AA 3PW4A 4LF5F 1HI0P 1MROA 4JI0F 2XS5A 2XC9A 3TR5A 1ZAWA 3MM8A 2HS3A 5DLGA 4L6V3 5DQIA 4YDXA 2YNFB 4YR2A 4I2PB 3OL8A 3G6YA 4A8SA 1SIZA 1U45A 1SL1A 2B4OA 3MI7X 5KFFA 2KB2A 4ZHRA 3VQTA 3KHGA 1G1XA 3TVYA 2BE2B 4DMZA 1FRIA 3RAMA 4A8WA 1SB6A 4Y34A 1K0TA 1FJGF 3VTIA 4XDDA 1TKZB 4RW4A 3JSYA 2PMZD 3J80Y 3PNIA 3UDLA 5CYQB 2GQ2A 2MJUA 3IGVA 2WCXA 3MOZA 3O5TB 1HNXF 4TU9A 2EI5A 1WI6A 1B7FA 5F3ZA 3V5RA 2HNZB 2R2UA 4MIAA 1UFWA 4QWDA 2ZNZA 1NKCA 5CXTA 1HBOB 5KFAA 2EVZA 2CQGA 2IRUA 3TOQA 1ZOTA 5C24A 4YMEA 4Q0BB 1X4CA 3KNAA 3QLHA 1S6QA 2OPQB 4NOHA 1MW7A 2C3YA 5GAEU 3OXFA 3NS6A 3BGRA 3IAS9 2HS4A 3H2VE 5HLFA 5E3PA 5KT6A 2GMHA 1LWCA 1FTCA 3JTNA 1FRXA 2M88A 2V8HA 5KT2A 1YQHA 2B3TB 3K8WA 2VKZG 1JLGB 3DOKA 1X9WA 1R8PA 5FJ4A 4WKRA 4GC6A 3OTEA 5D6GA 5IT9Y 4ECTA <