2KMSA

Combined high- and low-resolution techniques reveal compact structure in central portion of factor h despite long inter-modular linkers
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
115
structure length
115
Chain Sequence
TCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement factor H
publication title The Central Portion of Factor H (Modules 10-15) Is Compact and Contains a Structurally Deviant CCP Module
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 19
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2kmsA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2kmsA02
1QO6A 4LOTA 1GKNA 3OXUD 1TPGA 2RKZA 3O8EB 1GPZA 1U5MA 4J38B 3ERBA 1HFHA 1HFIA 2IZ3A 4YNXA 1OK1A 3R62A 3T5OA 4B2RA 1G4FA 1QGBA 3RJ3D 1Q3XA 4PZ5A 2JRAA 2XWBF 3SW0X 3ZRZA 4DJZA 2RLQA 2EHFA 4ZH1D 3INBC 4AYDA 4ONTD 2W81A 1NWVA 2CG6A 5FO8C 2WIIC 4CSYA 3L89M 2QY0A 2O39C 2A55A 1H2PP 2MCYA 2CG7A 2JGXA 2RKYA 2V8EA 3ZD2A 4F4OC 2W80A 5I0QB 4WJG2 1VVCA 1UOTP 1ZJKA 5HYTB 3GOVA 3TVJA 4JHSA 4AYEA 3EJHA 1GKGA 1LY2A 1OK3A 2UWNA 2YBYA 1TPNA 4AYIA 2G7IA 3CALA 4B2SA 4A5WB 1H03P 2BZMA 5HYPA 2B5ID 2IZ4A 4LOSA 2JGWA 3M7PA 1H04P 3NFPI 4AYMA 1MD8A 1O9AA 1OJYA 3OEDC 1MD7A 2EC3A 2CKUA 1TPMA 3OP8A 1QUBA 1HCCA 3KXVA 2RL0A 1H2QP 2YRAA 2XWJI 4C16A 3KZJA 1GHQB 4KKDA 1E5GA 4K12A 3MQLA 4FXGG 1OJWA 3GXEA 1OJVA 2XRDA 4MUCA 2ERJA 2RLPA 1Z92B 4IGDA 2KRIA 5HZPB 1OK2A 1SRZA 3ZD1A 1SS2A 3IX0A 5HYUB 1C1ZA 1CKLA 2LOJA 2XQWC 1E88A 1PPQA 2MCZA 1ELVA 2XRBA 1E8BA 5JPMG 1G4GA 1FBRA 1VVDA 3IU3I 1OK9A 2KMSA
chains in the Genus database with same CATH superfamily
1QO6A 4LOTA 4N7EA 1GKNA 3OXUD 1TPGA 2RKZA 3O8EB 1GPZA 5DN5A 1U5MA 4J38B 3ERBA 2Y8TA 1HFHA 1HFIA 2IZ3A 4YNXA 3WSXA 1OK1A 3R62A 4BWCA 3T5OA 4B2RA 3ZLDA 1G4FA 1QGBA 3RJ3D 2X2ZA 1Q3XA 3VWOA 4PZ5A 2JRAA 2XWBF 2Y8RA 3SW0X 3ZRZA 4DJZA 2RLQA 2EHFA 4ZH1D 3INBC 4AYDA 4ONTD 2W81A 2Y8SA 1NWVA 4APLA 3FGRA 4MSLA 2CG6A 5FO8C 2WIIC 4CSYA 3L89M 2QY0A 2O39C 2A55A 1H2PP 2MCYA 2CG7A 2JGXA 2RKYA 2V8EA 3ZD2A 4F4OC 3CI0J 2W80A 5I0QB 4WJG2 1VVCA 1UOTP 1ZJKA 5HYTB 3GOVA 3TVJA 4JHSA 4AYEA 3EJHA 1GKGA 1LY2A 1OK3A 2UWNA 2YBYA 1TPNA 4AYIA 2G7IA 3FGTA 3CALA 4YIZA 4A5WB 4B2SA 1H03P 2BZMA 2ZYCA 2B5ID 2IZ4A 5HYPA 4LOSA 2JGWA 3M7PA 1H04P 3NFPI 4AYMA 1MD8A 1O9AA 1OJYA 3OEDC 3F6KA 1MD7A 2EC3A 2CKUA 1TPMA 3OP8A 3NJAA 1QUBA 1HCCA 3KXVA 2RL0A 3ZLEA 1H2QP 2YRAA 2XWJI 4C16A 3KZJA 1GHQB 4KKDA 2I2LA 1E5GA 4K12A 3MQLA 4FXGG 1OJWA 3GXEA 1OJVA 2XRDA 4MUCA 2ERJA 2RLPA 1Z92B 4IGDA 3WSYA 2KRIA 5HZPB 1OK2A 1SRZA 3ZD1A 1SS2A 3IX0A 5HYUB 1C1ZA 4PO7A 1CKLA 2LOJA 2XQWC 1E88A 1PPQA 5DN4A 2MCZA 1ELVA 2XRBA 1E8BA 5JPMG 1G4GA 1FBRA 3K3TA 1VVDA 3IU3I 1RLHA 1OK9A 2KMSA
chains in the Genus database with same CATH topology
1QO6A 4LOTA 1GKNA 3OXUD 1TPGA 2RKZA 3O8EB 1GPZA 1U5MA 4J38B 3ERBA 1HFHA 1HFIA 2IZ3A 4YNXA 1OK1A 3R62A 3T5OA 4B2RA 1G4FA 1QGBA 3RJ3D 1Q3XA 4PZ5A 2JRAA 2XWBF 3SW0X 3ZRZA 4DJZA 2RLQA 2EHFA 4ZH1D 3INBC 4AYDA 4ONTD 2W81A 1NWVA 2CG6A 5FO8C 2WIIC 4CSYA 3L89M 2QY0A 2O39C 2A55A 1H2PP 2MCYA 2CG7A 2JGXA 2RKYA 2V8EA 3ZD2A 4F4OC 2W80A 5I0QB 4WJG2 1VVCA 1UOTP 1ZJKA 5HYTB 3GOVA 3TVJA 4JHSA 4AYEA 3EJHA 1GKGA 1LY2A 1OK3A 2UWNA 2YBYA 1TPNA 4AYIA 2G7IA 3CALA 4B2SA 4A5WB 1H03P 2BZMA 5HYPA 2B5ID 2IZ4A 4LOSA 2JGWA 3M7PA 1H04P 3NFPI 4AYMA 1MD8A 1O9AA 1OJYA 3OEDC 1MD7A 2EC3A 2CKUA 1TPMA 3OP8A 1QUBA 1HCCA 3KXVA 2RL0A 1H2QP 2YRAA 2XWJI 4C16A 3KZJA 1GHQB 4KKDA 1E5GA 4K12A 3MQLA 4FXGG 1OJWA 3GXEA 1OJVA 2XRDA 4MUCA 2ERJA 2RLPA 1Z92B 4IGDA 2KRIA 5HZPB 1OK2A 1SRZA 3ZD1A 1SS2A 3IX0A 5HYUB 1C1ZA 1CKLA 2LOJA 2XQWC 1E88A 1PPQA 2MCZA 1ELVA 2XRBA 1E8BA 5JPMG 1G4GA 1FBRA 1VVDA 3IU3I 1OK9A 2KMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QO6 A;  4LOT A;  1GKN A;  3OXU D;  1TPG A;  2RKZ A;  3O8E B;  1GPZ A;  1U5M A;  4J38 B;  3ERB A;  1HFH A;  1HFI A;  2IZ3 A;  4YNX A;  1OK1 A;  3R62 A;  3T5O A;  4B2R A;  1G4F A;  1QGB A;  3RJ3 D;  1Q3X A;  4PZ5 A;  2JRA A;  2XWB F;  3SW0 X;  3ZRZ A;  4DJZ A;  2RLQ A;  2EHF A;  4ZH1 D;  3INB C;  4AYD A;  4ONT D;  2W81 A;  1NWV A;  2CG6 A;  5FO8 C;  2WII C;  4CSY A;  3L89 M;  2QY0 A;  2O39 C;  2A55 A;  1H2P P;  2MCY A;  2CG7 A;  2JGX A;  2RKY A;  2V8E A;  3ZD2 A;  4F4O C;  2W80 A;  5I0Q B;  4WJG 2;  1VVC A;  1UOT P;  1ZJK A;  5HYT B;  3GOV A;  3TVJ A;  4JHS A;  4AYE A;  3EJH A;  1GKG A;  1LY2 A;  1OK3 A;  2UWN A;  2YBY A;  1TPN A;  4AYI A;  2G7I A;  3CAL A;  4B2S A;  4A5W B;  1H03 P;  2BZM A;  5HYP A;  2B5I D;  2IZ4 A;  4LOS A;  2JGW A;  3M7P A;  1H04 P;  3NFP I;  4AYM A;  1MD8 A;  1O9A A;  1OJY A;  3OED C;  1MD7 A;  2EC3 A;  2CKU A;  1TPM A;  3OP8 A;  1QUB A;  1HCC A;  3KXV A;  2RL0 A;  1H2Q P;  2YRA A;  2XWJ I;  4C16 A;  3KZJ A;  1GHQ B;  4KKD A;  1E5G A;  4K12 A;  3MQL A;  4FXG G;  1OJW A;  3GXE A;  1OJV A;  2XRD A;  4MUC A;  2ERJ A;  2RLP A;  1Z92 B;  4IGD A;  2KRI A;  5HZP B;  1OK2 A;  1SRZ A;  3ZD1 A;  1SS2 A;  3IX0 A;  5HYU B;  1C1Z A;  1CKL A;  2LOJ A;  2XQW C;  1E88 A;  1PPQ A;  2MCZ A;  1ELV A;  2XRB A;  1E8B A;  5JPM G;  1G4G A;  1FBR A;  1VVD A;  3IU3 I;  1OK9 A;  2KMS A; 
#chains in the Genus database with same CATH topology
 1QO6 A;  4LOT A;  4N7E A;  1GKN A;  3OXU D;  1TPG A;  2RKZ A;  3O8E B;  1GPZ A;  5DN5 A;  1U5M A;  4J38 B;  3ERB A;  2Y8T A;  1HFH A;  1HFI A;  2IZ3 A;  4YNX A;  3WSX A;  1OK1 A;  3R62 A;  4BWC A;  3T5O A;  4B2R A;  3ZLD A;  1G4F A;  1QGB A;  3RJ3 D;  2X2Z A;  1Q3X A;  3VWO A;  4PZ5 A;  2JRA A;  2XWB F;  2Y8R A;  3SW0 X;  3ZRZ A;  4DJZ A;  2RLQ A;  2EHF A;  4ZH1 D;  3INB C;  4AYD A;  4ONT D;  2W81 A;  2Y8S A;  1NWV A;  4APL A;  3FGR A;  4MSL A;  2CG6 A;  5FO8 C;  2WII C;  4CSY A;  3L89 M;  2QY0 A;  2O39 C;  2A55 A;  1H2P P;  2MCY A;  2CG7 A;  2JGX A;  2RKY A;  2V8E A;  3ZD2 A;  4F4O C;  3CI0 J;  2W80 A;  5I0Q B;  4WJG 2;  1VVC A;  1UOT P;  1ZJK A;  5HYT B;  3GOV A;  3TVJ A;  4JHS A;  4AYE A;  3EJH A;  1GKG A;  1LY2 A;  1OK3 A;  2UWN A;  2YBY A;  1TPN A;  4AYI A;  2G7I A;  3FGT A;  3CAL A;  4YIZ A;  4A5W B;  4B2S A;  1H03 P;  2BZM A;  2ZYC A;  2B5I D;  2IZ4 A;  5HYP A;  4LOS A;  2JGW A;  3M7P A;  1H04 P;  3NFP I;  4AYM A;  1MD8 A;  1O9A A;  1OJY A;  3OED C;  3F6K A;  1MD7 A;  2EC3 A;  2CKU A;  1TPM A;  3OP8 A;  3NJA A;  1QUB A;  1HCC A;  3KXV A;  2RL0 A;  3ZLE A;  1H2Q P;  2YRA A;  2XWJ I;  4C16 A;  3KZJ A;  1GHQ B;  4KKD A;  2I2L A;  1E5G A;  4K12 A;  3MQL A;  4FXG G;  1OJW A;  3GXE A;  1OJV A;  2XRD A;  4MUC A;  2ERJ A;  2RLP A;  1Z92 B;  4IGD A;  3WSY A;  2KRI A;  5HZP B;  1OK2 A;  1SRZ A;  3ZD1 A;  1SS2 A;  3IX0 A;  5HYU B;  1C1Z A;  4PO7 A;  1CKL A;  2LOJ A;  2XQW C;  1E88 A;  1PPQ A;  5DN4 A;  2MCZ A;  1ELV A;  2XRB A;  1E8B A;  5JPM G;  1G4G A;  1FBR A;  3K3T A;  1VVD A;  3IU3 I;  1RLH A;  1OK9 A;  2KMS A; 
#chains in the Genus database with same CATH homology
 1QO6 A;  4LOT A;  1GKN A;  3OXU D;  1TPG A;  2RKZ A;  3O8E B;  1GPZ A;  1U5M A;  4J38 B;  3ERB A;  1HFH A;  1HFI A;  2IZ3 A;  4YNX A;  1OK1 A;  3R62 A;  3T5O A;  4B2R A;  1G4F A;  1QGB A;  3RJ3 D;  1Q3X A;  4PZ5 A;  2JRA A;  2XWB F;  3SW0 X;  3ZRZ A;  4DJZ A;  2RLQ A;  2EHF A;  4ZH1 D;  3INB C;  4AYD A;  4ONT D;  2W81 A;  1NWV A;  2CG6 A;  5FO8 C;  2WII C;  4CSY A;  3L89 M;  2QY0 A;  2O39 C;  2A55 A;  1H2P P;  2MCY A;  2CG7 A;  2JGX A;  2RKY A;  2V8E A;  3ZD2 A;  4F4O C;  2W80 A;  5I0Q B;  4WJG 2;  1VVC A;  1UOT P;  1ZJK A;  5HYT B;  3GOV A;  3TVJ A;  4JHS A;  4AYE A;  3EJH A;  1GKG A;  1LY2 A;  1OK3 A;  2UWN A;  2YBY A;  1TPN A;  4AYI A;  2G7I A;  3CAL A;  4B2S A;  4A5W B;  1H03 P;  2BZM A;  5HYP A;  2B5I D;  2IZ4 A;  4LOS A;  2JGW A;  3M7P A;  1H04 P;  3NFP I;  4AYM A;  1MD8 A;  1O9A A;  1OJY A;  3OED C;  1MD7 A;  2EC3 A;  2CKU A;  1TPM A;  3OP8 A;  1QUB A;  1HCC A;  3KXV A;  2RL0 A;  1H2Q P;  2YRA A;  2XWJ I;  4C16 A;  3KZJ A;  1GHQ B;  4KKD A;  1E5G A;  4K12 A;  3MQL A;  4FXG G;  1OJW A;  3GXE A;  1OJV A;  2XRD A;  4MUC A;  2ERJ A;  2RLP A;  1Z92 B;  4IGD A;  2KRI A;  5HZP B;  1OK2 A;  1SRZ A;  3ZD1 A;  1SS2 A;  3IX0 A;  5HYU B;  1C1Z A;  1CKL A;  2LOJ A;  2XQW C;  1E88 A;  1PPQ A;  2MCZ A;  1ELV A;  2XRB A;  1E8B A;  5JPM G;  1G4G A;  1FBR A;  1VVD A;  3IU3 I;  1OK9 A;  2KMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...