2KMVA

Solution structure of the nucleotide binding domain of the human menkes protein in the atp-free form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
185
structure length
185
Chain Sequence
b'SFTMHGTPVVNQVKVLTESNRISHHKILAIVGTAESNSEHPLGTAITKYCKQELDTETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELCGLIAIADT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Copper-transporting ATPase 1
publication title The binding mode of ATP revealed by the solution structure of the N-domain of human ATP7A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 35
structure length 185
sequence length 185
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2009-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2kmvA01
4XE5A 5AW6A 4HYTA 1Q3IA 1T5SA 5AW2A 2KMVA 1XP5A 3SKXA 1SVJA 2A29A 2A00A 4J2TA 1MO7A 3AR5A 4UU1A 3AR6A 2ZBEA 1VFPA 5AW5A 3RFUA 5AVUA 3AR3A 3J7TA 2IYEA 2C8KA 4YCMA 2EAUA 3N8GA 1U7QA 4NABA 5AVWA 4RESA 3NAMA 3TLMA 4BEWA 3WGUA 5AVQA 2ZBGA 3AR9A 2YJ4A 2YJ5A 3A3YA 4UMVA 3NANA 2YJ6A 3A1DA 3AR7A 4H1WA 3W5CA 2ZXEA 3BA6A 4RETA 3AR8A 5AVZA 5AW0A 5AVXA 3FGOA 2AGVA 1MO8A 2KMXA 3A1CA 2EARA 2C8LA 2C88A 5AW3A 3AR4A 2BY4A 3N5KA 3GWIA 3NALA 3W5DA 5AW1A 5AW9A 4BEVA 1T5TA 3WGVA 2ARFA 4YCNA 5AW7A 4YCLA 2O9JA 5A3QA 2DQSA 2ZBDA 1WPGA 5AW8A 2YFYA 3KDPA 1IWOA 3B9RA 5A3SA 4KYTA 5AVRA 4XOUA 5A3RA 2OA0A 1SU4A 5AVYA 3W5BA 3AR2A 4BYGA 3B8EA 5AVVA 5AVTA 4Y3UA 2C9MA 2ZBFA 3W5AA 3FPBA 3FPSA 3SKYA 2B8EA 5AW4A 3B9BA 4BBJA 2YJ3A 3A1EA 4UU0A 5AVSA 2EATA
chains in the Genus database with same CATH superfamily
4XE5A 5AW6A 4HYTA 1Q3IA 1T5SA 5AW2A 2KMVA 1XP5A 3SKXA 1SVJA 2A29A 2A00A 4J2TA 1MO7A 3AR5A 4UU1A 3AR6A 2ZBEA 1VFPA 5AW5A 3RFUA 5AVUA 3AR3A 3J7TA 2IYEA 2C8KA 4YCMA 2EAUA 3N8GA 1U7QA 4NABA 5AVWA 4RESA 3NAMA 3TLMA 4BEWA 3WGUA 5AVQA 2ZBGA 3AR9A 2YJ4A 2YJ5A 3A3YA 4UMVA 3NANA 2YJ6A 3A1DA 3AR7A 4H1WA 3W5CA 2ZXEA 3BA6A 4RETA 3AR8A 5AVZA 5AW0A 5AVXA 3FGOA 2AGVA 1MO8A 2KMXA 3A1CA 2EARA 2C8LA 2C88A 5AW3A 3AR4A 2BY4A 3N5KA 3GWIA 3NALA 3W5DA 5AW1A 5AW9A 4BEVA 1T5TA 3WGVA 2ARFA 4YCNA 5AW7A 4YCLA 2O9JA 5A3QA 2DQSA 2ZBDA 1WPGA 5AW8A 2YFYA 3KDPA 1IWOA 3B9RA 5A3SA 4KYTA 5AVRA 4XOUA 5A3RA 2OA0A 1SU4A 5AVYA 3W5BA 3AR2A 4BYGA 3B8EA 5AVVA 5AVTA 4Y3UA 2C9MA 2ZBFA 3W5AA 3FPBA 3FPSA 3SKYA 2B8EA 5AW4A 3B9BA 4BBJA 2YJ3A 3A1EA 4UU0A 5AVSA 2EATA
chains in the Genus database with same CATH topology
4XE5A 5AW6A 4HYTA 1Q3IA 1T5SA 5AW2A 2KMVA 1XP5A 3SKXA 1SVJA 2A29A 2A00A 4J2TA 1MO7A 3AR5A 4UU1A 3AR6A 2ZBEA 1VFPA 5AW5A 3RFUA 5AVUA 3AR3A 3J7TA 2IYEA 2C8KA 4YCMA 2EAUA 3N8GA 1U7QA 4NABA 5AVWA 4RESA 3NAMA 3TLMA 4BEWA 3WGUA 5AVQA 2ZBGA 3AR9A 2YJ4A 2YJ5A 3A3YA 4UMVA 3NANA 2YJ6A 3A1DA 3AR7A 4H1WA 3W5CA 2ZXEA 3BA6A 4RETA 3AR8A 5AVZA 5AW0A 5AVXA 3FGOA 2AGVA 1MO8A 2KMXA 3A1CA 2EARA 2C8LA 2C88A 5AW3A 3AR4A 2BY4A 3N5KA 3GWIA 3NALA 3W5DA 5AW1A 5AW9A 4BEVA 1T5TA 3WGVA 2ARFA 4YCNA 5AW7A 4YCLA 2O9JA 5A3QA 2DQSA 2ZBDA 1WPGA 5AW8A 2YFYA 3KDPA 1IWOA 3B9RA 5A3SA 4KYTA 5AVRA 4XOUA 5A3RA 2OA0A 1SU4A 5AVYA 3W5BA 3AR2A 4BYGA 3B8EA 5AVVA 5AVTA 4Y3UA 2C9MA 2ZBFA 3W5AA 3FPBA 3FPSA 3SKYA 2B8EA 5AW4A 3B9BA 4BBJA 2YJ3A 3A1EA 4UU0A 5AVSA 2EATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XE5 A;  5AW6 A;  4HYT A;  1Q3I A;  1T5S A;  5AW2 A;  2KMV A;  1XP5 A;  3SKX A;  1SVJ A;  2A29 A;  2A00 A;  4J2T A;  1MO7 A;  3AR5 A;  4UU1 A;  3AR6 A;  2ZBE A;  1VFP A;  5AW5 A;  3RFU A;  5AVU A;  3AR3 A;  3J7T A;  2IYE A;  2C8K A;  4YCM A;  2EAU A;  3N8G A;  1U7Q A;  4NAB A;  5AVW A;  4RES A;  3NAM A;  3TLM A;  4BEW A;  3WGU A;  5AVQ A;  2ZBG A;  3AR9 A;  2YJ4 A;  2YJ5 A;  3A3Y A;  4UMV A;  3NAN A;  2YJ6 A;  3A1D A;  3AR7 A;  4H1W A;  3W5C A;  2ZXE A;  3BA6 A;  4RET A;  3AR8 A;  5AVZ A;  5AW0 A;  5AVX A;  3FGO A;  2AGV A;  1MO8 A;  2KMX A;  3A1C A;  2EAR A;  2C8L A;  2C88 A;  5AW3 A;  3AR4 A;  2BY4 A;  3N5K A;  3GWI A;  3NAL A;  3W5D A;  5AW1 A;  5AW9 A;  4BEV A;  1T5T A;  3WGV A;  2ARF A;  4YCN A;  5AW7 A;  4YCL A;  2O9J A;  5A3Q A;  2DQS A;  2ZBD A;  1WPG A;  5AW8 A;  2YFY A;  3KDP A;  1IWO A;  3B9R A;  5A3S A;  4KYT A;  5AVR A;  4XOU A;  5A3R A;  2OA0 A;  1SU4 A;  5AVY A;  3W5B A;  3AR2 A;  4BYG A;  3B8E A;  5AVV A;  5AVT A;  4Y3U A;  2C9M A;  2ZBF A;  3W5A A;  3FPB A;  3FPS A;  3SKY A;  2B8E A;  5AW4 A;  3B9B A;  4BBJ A;  2YJ3 A;  3A1E A;  4UU0 A;  5AVS A;  2EAT A; 
#chains in the Genus database with same CATH topology
 4XE5 A;  5AW6 A;  4HYT A;  1Q3I A;  1T5S A;  5AW2 A;  2KMV A;  1XP5 A;  3SKX A;  1SVJ A;  2A29 A;  2A00 A;  4J2T A;  1MO7 A;  3AR5 A;  4UU1 A;  3AR6 A;  2ZBE A;  1VFP A;  5AW5 A;  3RFU A;  5AVU A;  3AR3 A;  3J7T A;  2IYE A;  2C8K A;  4YCM A;  2EAU A;  3N8G A;  1U7Q A;  4NAB A;  5AVW A;  4RES A;  3NAM A;  3TLM A;  4BEW A;  3WGU A;  5AVQ A;  2ZBG A;  3AR9 A;  2YJ4 A;  2YJ5 A;  3A3Y A;  4UMV A;  3NAN A;  2YJ6 A;  3A1D A;  3AR7 A;  4H1W A;  3W5C A;  2ZXE A;  3BA6 A;  4RET A;  3AR8 A;  5AVZ A;  5AW0 A;  5AVX A;  3FGO A;  2AGV A;  1MO8 A;  2KMX A;  3A1C A;  2EAR A;  2C8L A;  2C88 A;  5AW3 A;  3AR4 A;  2BY4 A;  3N5K A;  3GWI A;  3NAL A;  3W5D A;  5AW1 A;  5AW9 A;  4BEV A;  1T5T A;  3WGV A;  2ARF A;  4YCN A;  5AW7 A;  4YCL A;  2O9J A;  5A3Q A;  2DQS A;  2ZBD A;  1WPG A;  5AW8 A;  2YFY A;  3KDP A;  1IWO A;  3B9R A;  5A3S A;  4KYT A;  5AVR A;  4XOU A;  5A3R A;  2OA0 A;  1SU4 A;  5AVY A;  3W5B A;  3AR2 A;  4BYG A;  3B8E A;  5AVV A;  5AVT A;  4Y3U A;  2C9M A;  2ZBF A;  3W5A A;  3FPB A;  3FPS A;  3SKY A;  2B8E A;  5AW4 A;  3B9B A;  4BBJ A;  2YJ3 A;  3A1E A;  4UU0 A;  5AVS A;  2EAT A; 
#chains in the Genus database with same CATH homology
 4XE5 A;  5AW6 A;  4HYT A;  1Q3I A;  1T5S A;  5AW2 A;  2KMV A;  1XP5 A;  3SKX A;  1SVJ A;  2A29 A;  2A00 A;  4J2T A;  1MO7 A;  3AR5 A;  4UU1 A;  3AR6 A;  2ZBE A;  1VFP A;  5AW5 A;  3RFU A;  5AVU A;  3AR3 A;  3J7T A;  2IYE A;  2C8K A;  4YCM A;  2EAU A;  3N8G A;  1U7Q A;  4NAB A;  5AVW A;  4RES A;  3NAM A;  3TLM A;  4BEW A;  3WGU A;  5AVQ A;  2ZBG A;  3AR9 A;  2YJ4 A;  2YJ5 A;  3A3Y A;  4UMV A;  3NAN A;  2YJ6 A;  3A1D A;  3AR7 A;  4H1W A;  3W5C A;  2ZXE A;  3BA6 A;  4RET A;  3AR8 A;  5AVZ A;  5AW0 A;  5AVX A;  3FGO A;  2AGV A;  1MO8 A;  2KMX A;  3A1C A;  2EAR A;  2C8L A;  2C88 A;  5AW3 A;  3AR4 A;  2BY4 A;  3N5K A;  3GWI A;  3NAL A;  3W5D A;  5AW1 A;  5AW9 A;  4BEV A;  1T5T A;  3WGV A;  2ARF A;  4YCN A;  5AW7 A;  4YCL A;  2O9J A;  5A3Q A;  2DQS A;  2ZBD A;  1WPG A;  5AW8 A;  2YFY A;  3KDP A;  1IWO A;  3B9R A;  5A3S A;  4KYT A;  5AVR A;  4XOU A;  5A3R A;  2OA0 A;  1SU4 A;  5AVY A;  3W5B A;  3AR2 A;  4BYG A;  3B8E A;  5AVV A;  5AVT A;  4Y3U A;  2C9M A;  2ZBF A;  3W5A A;  3FPB A;  3FPS A;  3SKY A;  2B8E A;  5AW4 A;  3B9B A;  4BBJ A;  2YJ3 A;  3A1E A;  4UU0 A;  5AVS A;  2EAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...