2KMXA

Solution structure of the nucleotide binding domain of the human menkes protein in the atp-bound form
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
185
structure length
185
Chain Sequence
SFTMHGTPVVNQVKVLTESNRISHHKILAIVGTAESNSEHPLGTAITKYCKQELDTETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELCGLIAIADT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The binding mode of ATP revealed by the solution structure of the N-domain of human ATP7A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
total genus 39
structure length 185
sequence length 185
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2009-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2kmxA00
2DQSA 1SVJA 3W5BA 5A3RA 5AW6A 3BA6A 4UMVA 2ZBDA 4UU1A 4H1WA 3W5AA 3FPBA 2EATA 2C8KA 2YJ5A 3WGUA 5AVZA 2ZBEA 4BBJA 3AR2A 3NAMA 5AVVA 5AVYA 1T5SA 3W5CA 5AVWA 2B8EA 2YFYA 4RESA 3NALA 2KMXA 2C88A 3KDPA 5AW9A 4Y3UA 1MO7A 3GWIA 2C8LA 2IYEA 3A1DA 4UU0A 5AVXA 5AW7A 3AR9A 5AVUA 1XP5A 5A3QA 4BYGA 1U7QA 2EAUA 4HYTA 4XE5A 1SU4A 3FPSA 3A1CA 3AR6A 5AW5A 4KYTA 1T5TA 3N8GA 3AR5A 5AW3A 3AR4A 3SKXA 3NANA 4YCNA 3A1EA 4YCLA 3N5KA 1VFPA 2YJ4A 4BEWA 2AGVA 3W5DA 3RFUA 3WGVA 5AW8A 2OA0A 4NABA 3TLMA 5AVRA 2ZBFA 4YCMA 3B8EA 3AR8A 1MO8A 2YJ6A 5A3SA 3J7TA 4XOUA 3B9RA 3FGOA 2KMVA 2O9JA 3AR7A 3AR3A 3SKYA 5AW4A 1WPGA 2ZBGA 2A00A 4J2TA 2A29A 5AW0A 5AVSA 2ARFA 3A3YA 5AW2A 1Q3IA 5AW1A 3B9BA 2YJ3A 2C9MA 2ZXEA 2BY4A 5AVTA 1IWOA 2EARA 4RETA 4BEVA 5AVQA
chains in the Genus database with same CATH superfamily
2DQSA 1SVJA 3W5BA 5A3RA 5AW6A 3BA6A 4UMVA 2ZBDA 4UU1A 4H1WA 3W5AA 3FPBA 2EATA 2C8KA 2YJ5A 3WGUA 5AVZA 2ZBEA 4BBJA 3AR2A 3NAMA 5AVVA 5AVYA 1T5SA 3W5CA 5AVWA 2B8EA 2YFYA 4RESA 3NALA 2KMXA 2C88A 3KDPA 5AW9A 4Y3UA 1MO7A 3GWIA 2C8LA 2IYEA 3A1DA 4UU0A 5AVXA 5AW7A 3AR9A 5AVUA 1XP5A 5A3QA 4BYGA 1U7QA 2EAUA 4HYTA 4XE5A 1SU4A 3FPSA 3A1CA 3AR6A 5AW5A 4KYTA 1T5TA 3N8GA 3AR5A 5AW3A 3AR4A 3SKXA 3NANA 4YCNA 3A1EA 4YCLA 3N5KA 1VFPA 2YJ4A 4BEWA 2AGVA 3W5DA 3RFUA 3WGVA 5AW8A 2OA0A 4NABA 3TLMA 5AVRA 2ZBFA 4YCMA 3B8EA 3AR8A 1MO8A 2YJ6A 5A3SA 3J7TA 4XOUA 3B9RA 3FGOA 2KMVA 2O9JA 3AR7A 3AR3A 3SKYA 5AW4A 1WPGA 2ZBGA 2A00A 4J2TA 2A29A 5AW0A 5AVSA 2ARFA 3A3YA 5AW2A 1Q3IA 5AW1A 3B9BA 2YJ3A 2C9MA 2ZXEA 2BY4A 5AVTA 1IWOA 2EARA 4RETA 4BEVA 5AVQA
chains in the Genus database with same CATH topology
2DQSA 1SVJA 3W5BA 5A3RA 5AW6A 3BA6A 4UMVA 2ZBDA 4UU1A 4H1WA 3W5AA 3FPBA 2EATA 2C8KA 2YJ5A 3WGUA 5AVZA 2ZBEA 4BBJA 3AR2A 3NAMA 5AVVA 5AVYA 1T5SA 3W5CA 5AVWA 2B8EA 2YFYA 4RESA 3NALA 2KMXA 2C88A 3KDPA 5AW9A 4Y3UA 1MO7A 3GWIA 2C8LA 2IYEA 3A1DA 4UU0A 5AVXA 5AW7A 3AR9A 5AVUA 1XP5A 5A3QA 4BYGA 1U7QA 2EAUA 4HYTA 4XE5A 1SU4A 3FPSA 3A1CA 3AR6A 5AW5A 4KYTA 1T5TA 3N8GA 3AR5A 5AW3A 3AR4A 3SKXA 3NANA 4YCNA 3A1EA 4YCLA 3N5KA 1VFPA 2YJ4A 4BEWA 2AGVA 3W5DA 3RFUA 3WGVA 5AW8A 2OA0A 4NABA 3TLMA 5AVRA 2ZBFA 4YCMA 3B8EA 3AR8A 1MO8A 2YJ6A 5A3SA 3J7TA 4XOUA 3B9RA 3FGOA 2KMVA 2O9JA 3AR7A 3AR3A 3SKYA 5AW4A 1WPGA 2ZBGA 2A00A 4J2TA 2A29A 5AW0A 5AVSA 2ARFA 3A3YA 5AW2A 1Q3IA 5AW1A 3B9BA 2YJ3A 2C9MA 2ZXEA 2BY4A 5AVTA 1IWOA 2EARA 4RETA 4BEVA 5AVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DQS A;  1SVJ A;  3W5B A;  5A3R A;  5AW6 A;  3BA6 A;  4UMV A;  2ZBD A;  4UU1 A;  4H1W A;  3W5A A;  3FPB A;  2EAT A;  2C8K A;  2YJ5 A;  3WGU A;  5AVZ A;  2ZBE A;  4BBJ A;  3AR2 A;  3NAM A;  5AVV A;  5AVY A;  1T5S A;  3W5C A;  5AVW A;  2B8E A;  2YFY A;  4RES A;  3NAL A;  2KMX A;  2C88 A;  3KDP A;  5AW9 A;  4Y3U A;  1MO7 A;  3GWI A;  2C8L A;  2IYE A;  3A1D A;  4UU0 A;  5AVX A;  5AW7 A;  3AR9 A;  5AVU A;  1XP5 A;  5A3Q A;  4BYG A;  1U7Q A;  2EAU A;  4HYT A;  4XE5 A;  1SU4 A;  3FPS A;  3A1C A;  3AR6 A;  5AW5 A;  4KYT A;  1T5T A;  3N8G A;  3AR5 A;  5AW3 A;  3AR4 A;  3SKX A;  3NAN A;  4YCN A;  3A1E A;  4YCL A;  3N5K A;  1VFP A;  2YJ4 A;  4BEW A;  2AGV A;  3W5D A;  3RFU A;  3WGV A;  5AW8 A;  2OA0 A;  4NAB A;  3TLM A;  5AVR A;  2ZBF A;  4YCM A;  3B8E A;  3AR8 A;  1MO8 A;  2YJ6 A;  5A3S A;  3J7T A;  4XOU A;  3B9R A;  3FGO A;  2KMV A;  2O9J A;  3AR7 A;  3AR3 A;  3SKY A;  5AW4 A;  1WPG A;  2ZBG A;  2A00 A;  4J2T A;  2A29 A;  5AW0 A;  5AVS A;  2ARF A;  3A3Y A;  5AW2 A;  1Q3I A;  5AW1 A;  3B9B A;  2YJ3 A;  2C9M A;  2ZXE A;  2BY4 A;  5AVT A;  1IWO A;  2EAR A;  4RET A;  4BEV A;  5AVQ A; 
#chains in the Genus database with same CATH topology
 2DQS A;  1SVJ A;  3W5B A;  5A3R A;  5AW6 A;  3BA6 A;  4UMV A;  2ZBD A;  4UU1 A;  4H1W A;  3W5A A;  3FPB A;  2EAT A;  2C8K A;  2YJ5 A;  3WGU A;  5AVZ A;  2ZBE A;  4BBJ A;  3AR2 A;  3NAM A;  5AVV A;  5AVY A;  1T5S A;  3W5C A;  5AVW A;  2B8E A;  2YFY A;  4RES A;  3NAL A;  2KMX A;  2C88 A;  3KDP A;  5AW9 A;  4Y3U A;  1MO7 A;  3GWI A;  2C8L A;  2IYE A;  3A1D A;  4UU0 A;  5AVX A;  5AW7 A;  3AR9 A;  5AVU A;  1XP5 A;  5A3Q A;  4BYG A;  1U7Q A;  2EAU A;  4HYT A;  4XE5 A;  1SU4 A;  3FPS A;  3A1C A;  3AR6 A;  5AW5 A;  4KYT A;  1T5T A;  3N8G A;  3AR5 A;  5AW3 A;  3AR4 A;  3SKX A;  3NAN A;  4YCN A;  3A1E A;  4YCL A;  3N5K A;  1VFP A;  2YJ4 A;  4BEW A;  2AGV A;  3W5D A;  3RFU A;  3WGV A;  5AW8 A;  2OA0 A;  4NAB A;  3TLM A;  5AVR A;  2ZBF A;  4YCM A;  3B8E A;  3AR8 A;  1MO8 A;  2YJ6 A;  5A3S A;  3J7T A;  4XOU A;  3B9R A;  3FGO A;  2KMV A;  2O9J A;  3AR7 A;  3AR3 A;  3SKY A;  5AW4 A;  1WPG A;  2ZBG A;  2A00 A;  4J2T A;  2A29 A;  5AW0 A;  5AVS A;  2ARF A;  3A3Y A;  5AW2 A;  1Q3I A;  5AW1 A;  3B9B A;  2YJ3 A;  2C9M A;  2ZXE A;  2BY4 A;  5AVT A;  1IWO A;  2EAR A;  4RET A;  4BEV A;  5AVQ A; 
#chains in the Genus database with same CATH homology
 2DQS A;  1SVJ A;  3W5B A;  5A3R A;  5AW6 A;  3BA6 A;  4UMV A;  2ZBD A;  4UU1 A;  4H1W A;  3W5A A;  3FPB A;  2EAT A;  2C8K A;  2YJ5 A;  3WGU A;  5AVZ A;  2ZBE A;  4BBJ A;  3AR2 A;  3NAM A;  5AVV A;  5AVY A;  1T5S A;  3W5C A;  5AVW A;  2B8E A;  2YFY A;  4RES A;  3NAL A;  2KMX A;  2C88 A;  3KDP A;  5AW9 A;  4Y3U A;  1MO7 A;  3GWI A;  2C8L A;  2IYE A;  3A1D A;  4UU0 A;  5AVX A;  5AW7 A;  3AR9 A;  5AVU A;  1XP5 A;  5A3Q A;  4BYG A;  1U7Q A;  2EAU A;  4HYT A;  4XE5 A;  1SU4 A;  3FPS A;  3A1C A;  3AR6 A;  5AW5 A;  4KYT A;  1T5T A;  3N8G A;  3AR5 A;  5AW3 A;  3AR4 A;  3SKX A;  3NAN A;  4YCN A;  3A1E A;  4YCL A;  3N5K A;  1VFP A;  2YJ4 A;  4BEW A;  2AGV A;  3W5D A;  3RFU A;  3WGV A;  5AW8 A;  2OA0 A;  4NAB A;  3TLM A;  5AVR A;  2ZBF A;  4YCM A;  3B8E A;  3AR8 A;  1MO8 A;  2YJ6 A;  5A3S A;  3J7T A;  4XOU A;  3B9R A;  3FGO A;  2KMV A;  2O9J A;  3AR7 A;  3AR3 A;  3SKY A;  5AW4 A;  1WPG A;  2ZBG A;  2A00 A;  4J2T A;  2A29 A;  5AW0 A;  5AVS A;  2ARF A;  3A3Y A;  5AW2 A;  1Q3I A;  5AW1 A;  3B9B A;  2YJ3 A;  2C9M A;  2ZXE A;  2BY4 A;  5AVT A;  1IWO A;  2EAR A;  4RET A;  4BEV A;  5AVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...