2KMXA

Solution structure of the nucleotide binding domain of the human menkes protein in the atp-bound form
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
185
structure length
185
Chain Sequence
b'SFTMHGTPVVNQVKVLTESNRISHHKILAIVGTAESNSEHPLGTAITKYCKQELDTETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELCGLIAIADT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Copper-transporting ATPase 1
publication title The binding mode of ATP revealed by the solution structure of the N-domain of human ATP7A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 39
structure length 185
sequence length 185
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2009-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2kmxA00
2C8LA 3B9BA 1IWOA 5AVZA 5AW3A 5AW7A 5AVVA 4RESA 3FPSA 2YJ3A 5AVTA 2YFYA 1SU4A 2ZXEA 3B8EA 5AW8A 2C88A 3WGUA 3SKYA 5A3RA 3BA6A 1SVJA 4BEWA 5AVUA 5AVSA 3NALA 3AR3A 5AW0A 3A3YA 5AVYA 1U7QA 1T5SA 3FPBA 5AW1A 1XP5A 2EAUA 4YCLA 3AR5A 3A1EA 2A00A 2YJ6A 1T5TA 2KMXA 2A29A 2O9JA 2YJ4A 3AR7A 3J7TA 3WGVA 3A1CA 5AVQA 3AR4A 2ZBDA 3W5CA 2AGVA 2KMVA 1VFPA 5A3SA 1MO8A 3W5BA 4BEVA 2EARA 3W5AA 5A3QA 2ZBGA 3N8GA 4J2TA 3AR2A 4XOUA 5AW6A 2YJ5A 5AW9A 3GWIA 4Y3UA 4RETA 3TLMA 2C9MA 2EATA 4UMVA 4UU1A 3AR6A 3W5DA 3SKXA 4BBJA 4YCMA 1MO7A 3AR9A 5AW5A 3A1DA 2IYEA 3KDPA 2ZBEA 5AVWA 3B9RA 2DQSA 5AVXA 4H1WA 5AW2A 5AVRA 3NANA 3AR8A 4XE5A 5AW4A 2BY4A 4HYTA 3FGOA 3RFUA 2C8KA 2ZBFA 1Q3IA 2OA0A 1WPGA 2B8EA 4BYGA 2ARFA 4YCNA 3N5KA 4KYTA 4NABA 4UU0A 3NAMA
chains in the Genus database with same CATH superfamily
2C8LA 3B9BA 1IWOA 5AVZA 5AW3A 5AW7A 5AVVA 4RESA 3FPSA 2YJ3A 5AVTA 2YFYA 1SU4A 2ZXEA 3B8EA 5AW8A 2C88A 3WGUA 3SKYA 5A3RA 3BA6A 1SVJA 4BEWA 5AVUA 5AVSA 3NALA 3AR3A 5AW0A 3A3YA 5AVYA 1U7QA 1T5SA 3FPBA 5AW1A 1XP5A 2EAUA 4YCLA 3AR5A 3A1EA 2A00A 2YJ6A 1T5TA 2KMXA 2A29A 2O9JA 2YJ4A 3AR7A 3J7TA 3WGVA 3A1CA 5AVQA 3AR4A 2ZBDA 3W5CA 2AGVA 2KMVA 1VFPA 5A3SA 1MO8A 3W5BA 4BEVA 2EARA 3W5AA 5A3QA 2ZBGA 3N8GA 4J2TA 3AR2A 4XOUA 5AW6A 2YJ5A 5AW9A 3GWIA 4Y3UA 4RETA 3TLMA 2C9MA 2EATA 4UMVA 4UU1A 3AR6A 3W5DA 3SKXA 4BBJA 4YCMA 1MO7A 3AR9A 5AW5A 3A1DA 2IYEA 3KDPA 2ZBEA 5AVWA 3B9RA 2DQSA 5AVXA 4H1WA 5AW2A 5AVRA 3NANA 3AR8A 4XE5A 5AW4A 2BY4A 4HYTA 3FGOA 3RFUA 2C8KA 2ZBFA 1Q3IA 2OA0A 1WPGA 2B8EA 4BYGA 2ARFA 4YCNA 3N5KA 4KYTA 4NABA 4UU0A 3NAMA
chains in the Genus database with same CATH topology
2C8LA 3B9BA 1IWOA 5AVZA 5AW3A 5AW7A 5AVVA 4RESA 3FPSA 2YJ3A 5AVTA 2YFYA 1SU4A 2ZXEA 3B8EA 5AW8A 2C88A 3WGUA 3SKYA 5A3RA 3BA6A 1SVJA 4BEWA 5AVUA 5AVSA 3NALA 3AR3A 5AW0A 3A3YA 5AVYA 1U7QA 1T5SA 3FPBA 5AW1A 1XP5A 2EAUA 4YCLA 3AR5A 3A1EA 2A00A 2YJ6A 1T5TA 2KMXA 2A29A 2O9JA 2YJ4A 3AR7A 3J7TA 3WGVA 3A1CA 5AVQA 3AR4A 2ZBDA 3W5CA 2AGVA 2KMVA 1VFPA 5A3SA 1MO8A 3W5BA 4BEVA 2EARA 3W5AA 5A3QA 2ZBGA 3N8GA 4J2TA 3AR2A 4XOUA 5AW6A 2YJ5A 5AW9A 3GWIA 4Y3UA 4RETA 3TLMA 2C9MA 2EATA 4UMVA 4UU1A 3AR6A 3W5DA 3SKXA 4BBJA 4YCMA 1MO7A 3AR9A 5AW5A 3A1DA 2IYEA 3KDPA 2ZBEA 5AVWA 3B9RA 2DQSA 5AVXA 4H1WA 5AW2A 5AVRA 3NANA 3AR8A 4XE5A 5AW4A 2BY4A 4HYTA 3FGOA 3RFUA 2C8KA 2ZBFA 1Q3IA 2OA0A 1WPGA 2B8EA 4BYGA 2ARFA 4YCNA 3N5KA 4KYTA 4NABA 4UU0A 3NAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C8L A;  3B9B A;  1IWO A;  5AVZ A;  5AW3 A;  5AW7 A;  5AVV A;  4RES A;  3FPS A;  2YJ3 A;  5AVT A;  2YFY A;  1SU4 A;  2ZXE A;  3B8E A;  5AW8 A;  2C88 A;  3WGU A;  3SKY A;  5A3R A;  3BA6 A;  1SVJ A;  4BEW A;  5AVU A;  5AVS A;  3NAL A;  3AR3 A;  5AW0 A;  3A3Y A;  5AVY A;  1U7Q A;  1T5S A;  3FPB A;  5AW1 A;  1XP5 A;  2EAU A;  4YCL A;  3AR5 A;  3A1E A;  2A00 A;  2YJ6 A;  1T5T A;  2KMX A;  2A29 A;  2O9J A;  2YJ4 A;  3AR7 A;  3J7T A;  3WGV A;  3A1C A;  5AVQ A;  3AR4 A;  2ZBD A;  3W5C A;  2AGV A;  2KMV A;  1VFP A;  5A3S A;  1MO8 A;  3W5B A;  4BEV A;  2EAR A;  3W5A A;  5A3Q A;  2ZBG A;  3N8G A;  4J2T A;  3AR2 A;  4XOU A;  5AW6 A;  2YJ5 A;  5AW9 A;  3GWI A;  4Y3U A;  4RET A;  3TLM A;  2C9M A;  2EAT A;  4UMV A;  4UU1 A;  3AR6 A;  3W5D A;  3SKX A;  4BBJ A;  4YCM A;  1MO7 A;  3AR9 A;  5AW5 A;  3A1D A;  2IYE A;  3KDP A;  2ZBE A;  5AVW A;  3B9R A;  2DQS A;  5AVX A;  4H1W A;  5AW2 A;  5AVR A;  3NAN A;  3AR8 A;  4XE5 A;  5AW4 A;  2BY4 A;  4HYT A;  3FGO A;  3RFU A;  2C8K A;  2ZBF A;  1Q3I A;  2OA0 A;  1WPG A;  2B8E A;  4BYG A;  2ARF A;  4YCN A;  3N5K A;  4KYT A;  4NAB A;  4UU0 A;  3NAM A; 
#chains in the Genus database with same CATH topology
 2C8L A;  3B9B A;  1IWO A;  5AVZ A;  5AW3 A;  5AW7 A;  5AVV A;  4RES A;  3FPS A;  2YJ3 A;  5AVT A;  2YFY A;  1SU4 A;  2ZXE A;  3B8E A;  5AW8 A;  2C88 A;  3WGU A;  3SKY A;  5A3R A;  3BA6 A;  1SVJ A;  4BEW A;  5AVU A;  5AVS A;  3NAL A;  3AR3 A;  5AW0 A;  3A3Y A;  5AVY A;  1U7Q A;  1T5S A;  3FPB A;  5AW1 A;  1XP5 A;  2EAU A;  4YCL A;  3AR5 A;  3A1E A;  2A00 A;  2YJ6 A;  1T5T A;  2KMX A;  2A29 A;  2O9J A;  2YJ4 A;  3AR7 A;  3J7T A;  3WGV A;  3A1C A;  5AVQ A;  3AR4 A;  2ZBD A;  3W5C A;  2AGV A;  2KMV A;  1VFP A;  5A3S A;  1MO8 A;  3W5B A;  4BEV A;  2EAR A;  3W5A A;  5A3Q A;  2ZBG A;  3N8G A;  4J2T A;  3AR2 A;  4XOU A;  5AW6 A;  2YJ5 A;  5AW9 A;  3GWI A;  4Y3U A;  4RET A;  3TLM A;  2C9M A;  2EAT A;  4UMV A;  4UU1 A;  3AR6 A;  3W5D A;  3SKX A;  4BBJ A;  4YCM A;  1MO7 A;  3AR9 A;  5AW5 A;  3A1D A;  2IYE A;  3KDP A;  2ZBE A;  5AVW A;  3B9R A;  2DQS A;  5AVX A;  4H1W A;  5AW2 A;  5AVR A;  3NAN A;  3AR8 A;  4XE5 A;  5AW4 A;  2BY4 A;  4HYT A;  3FGO A;  3RFU A;  2C8K A;  2ZBF A;  1Q3I A;  2OA0 A;  1WPG A;  2B8E A;  4BYG A;  2ARF A;  4YCN A;  3N5K A;  4KYT A;  4NAB A;  4UU0 A;  3NAM A; 
#chains in the Genus database with same CATH homology
 2C8L A;  3B9B A;  1IWO A;  5AVZ A;  5AW3 A;  5AW7 A;  5AVV A;  4RES A;  3FPS A;  2YJ3 A;  5AVT A;  2YFY A;  1SU4 A;  2ZXE A;  3B8E A;  5AW8 A;  2C88 A;  3WGU A;  3SKY A;  5A3R A;  3BA6 A;  1SVJ A;  4BEW A;  5AVU A;  5AVS A;  3NAL A;  3AR3 A;  5AW0 A;  3A3Y A;  5AVY A;  1U7Q A;  1T5S A;  3FPB A;  5AW1 A;  1XP5 A;  2EAU A;  4YCL A;  3AR5 A;  3A1E A;  2A00 A;  2YJ6 A;  1T5T A;  2KMX A;  2A29 A;  2O9J A;  2YJ4 A;  3AR7 A;  3J7T A;  3WGV A;  3A1C A;  5AVQ A;  3AR4 A;  2ZBD A;  3W5C A;  2AGV A;  2KMV A;  1VFP A;  5A3S A;  1MO8 A;  3W5B A;  4BEV A;  2EAR A;  3W5A A;  5A3Q A;  2ZBG A;  3N8G A;  4J2T A;  3AR2 A;  4XOU A;  5AW6 A;  2YJ5 A;  5AW9 A;  3GWI A;  4Y3U A;  4RET A;  3TLM A;  2C9M A;  2EAT A;  4UMV A;  4UU1 A;  3AR6 A;  3W5D A;  3SKX A;  4BBJ A;  4YCM A;  1MO7 A;  3AR9 A;  5AW5 A;  3A1D A;  2IYE A;  3KDP A;  2ZBE A;  5AVW A;  3B9R A;  2DQS A;  5AVX A;  4H1W A;  5AW2 A;  5AVR A;  3NAN A;  3AR8 A;  4XE5 A;  5AW4 A;  2BY4 A;  4HYT A;  3FGO A;  3RFU A;  2C8K A;  2ZBF A;  1Q3I A;  2OA0 A;  1WPG A;  2B8E A;  4BYG A;  2ARF A;  4YCN A;  3N5K A;  4KYT A;  4NAB A;  4UU0 A;  3NAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...