2KMXA

Solution structure of the nucleotide binding domain of the human menkes protein in the atp-bound form
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
185
structure length
185
Chain Sequence
SFTMHGTPVVNQVKVLTESNRISHHKILAIVGTAESNSEHPLGTAITKYCKQELDTETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELCGLIAIADT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The binding mode of ATP revealed by the solution structure of the N-domain of human ATP7A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
total genus 39
structure length 185
sequence length 185
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2009-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2kmxA00
2BY4A 4BBJA 4UMVA 4YCLA 2YJ6A 4XOUA 3AR7A 4XE5A 5AW5A 2ZBFA 3B9RA 3WGVA 3AR9A 3A1DA 3AR3A 3A3YA 3J7TA 3N5KA 3SKXA 2YJ4A 5AVVA 5AVQA 5A3SA 4J2TA 3AR6A 2AGVA 1U7QA 2EAUA 3NALA 5AW9A 2C8LA 2ARFA 4YCMA 3W5BA 3W5CA 5AW4A 3WGUA 3AR4A 1T5TA 2KMVA 2DQSA 3SKYA 4BEVA 2KMXA 2ZXEA 5AW1A 5AVSA 1Q3IA 2ZBDA 4BYGA 5AVYA 4BEWA 5AVWA 3A1EA 2ZBGA 1IWOA 3W5AA 2IYEA 5AW7A 4HYTA 1WPGA 4Y3UA 1SU4A 2YJ5A 5AW2A 2A00A 4RETA 5AW8A 3RFUA 5AW0A 3B8EA 2ZBEA 2EARA 3A1CA 3BA6A 4RESA 2YJ3A 3NAMA 4KYTA 1XP5A 3W5DA 5AVZA 1MO7A 1T5SA 5AVUA 1VFPA 3B9BA 3TLMA 2C8KA 2EATA 5AVRA 1SVJA 4UU0A 5AVXA 2OA0A 3N8GA 3GWIA 4UU1A 5A3QA 4YCNA 3FGOA 3NANA 3KDPA 2B8EA 4H1WA 3AR5A 3AR2A 3FPBA 1MO8A 5AW3A 2C9MA 2YFYA 5AW6A 2A29A 5AVTA 4NABA 2C88A 5A3RA 3AR8A 3FPSA 2O9JA
chains in the Genus database with same CATH superfamily
2BY4A 4BBJA 4UMVA 4YCLA 2YJ6A 4XOUA 3AR7A 4XE5A 5AW5A 2ZBFA 3B9RA 3WGVA 3AR9A 3A1DA 3AR3A 3A3YA 3J7TA 3N5KA 3SKXA 2YJ4A 5AVVA 5AVQA 5A3SA 4J2TA 3AR6A 2AGVA 1U7QA 2EAUA 3NALA 5AW9A 2C8LA 2ARFA 4YCMA 3W5BA 3W5CA 5AW4A 3WGUA 3AR4A 1T5TA 2KMVA 2DQSA 3SKYA 4BEVA 2KMXA 2ZXEA 5AW1A 5AVSA 1Q3IA 2ZBDA 4BYGA 5AVYA 4BEWA 5AVWA 3A1EA 2ZBGA 1IWOA 3W5AA 2IYEA 5AW7A 4HYTA 1WPGA 4Y3UA 1SU4A 2YJ5A 5AW2A 2A00A 4RETA 5AW8A 3RFUA 5AW0A 3B8EA 2ZBEA 2EARA 3A1CA 3BA6A 4RESA 2YJ3A 3NAMA 4KYTA 1XP5A 3W5DA 5AVZA 1MO7A 1T5SA 5AVUA 1VFPA 3B9BA 3TLMA 2C8KA 2EATA 5AVRA 1SVJA 4UU0A 5AVXA 2OA0A 3N8GA 3GWIA 4UU1A 5A3QA 4YCNA 3FGOA 3NANA 3KDPA 2B8EA 4H1WA 3AR5A 3AR2A 3FPBA 1MO8A 5AW3A 2C9MA 2YFYA 5AW6A 2A29A 5AVTA 4NABA 2C88A 5A3RA 3AR8A 3FPSA 2O9JA
chains in the Genus database with same CATH topology
2BY4A 4BBJA 4UMVA 4YCLA 2YJ6A 4XOUA 3AR7A 4XE5A 5AW5A 2ZBFA 3B9RA 3WGVA 3AR9A 3A1DA 3AR3A 3A3YA 3J7TA 3N5KA 3SKXA 2YJ4A 5AVVA 5AVQA 5A3SA 4J2TA 3AR6A 2AGVA 1U7QA 2EAUA 3NALA 5AW9A 2C8LA 2ARFA 4YCMA 3W5BA 3W5CA 5AW4A 3WGUA 3AR4A 1T5TA 2KMVA 2DQSA 3SKYA 4BEVA 2KMXA 2ZXEA 5AW1A 5AVSA 1Q3IA 2ZBDA 4BYGA 5AVYA 4BEWA 5AVWA 3A1EA 2ZBGA 1IWOA 3W5AA 2IYEA 5AW7A 4HYTA 1WPGA 4Y3UA 1SU4A 2YJ5A 5AW2A 2A00A 4RETA 5AW8A 3RFUA 5AW0A 3B8EA 2ZBEA 2EARA 3A1CA 3BA6A 4RESA 2YJ3A 3NAMA 4KYTA 1XP5A 3W5DA 5AVZA 1MO7A 1T5SA 5AVUA 1VFPA 3B9BA 3TLMA 2C8KA 2EATA 5AVRA 1SVJA 4UU0A 5AVXA 2OA0A 3N8GA 3GWIA 4UU1A 5A3QA 4YCNA 3FGOA 3NANA 3KDPA 2B8EA 4H1WA 3AR5A 3AR2A 3FPBA 1MO8A 5AW3A 2C9MA 2YFYA 5AW6A 2A29A 5AVTA 4NABA 2C88A 5A3RA 3AR8A 3FPSA 2O9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BY4 A;  4BBJ A;  4UMV A;  4YCL A;  2YJ6 A;  4XOU A;  3AR7 A;  4XE5 A;  5AW5 A;  2ZBF A;  3B9R A;  3WGV A;  3AR9 A;  3A1D A;  3AR3 A;  3A3Y A;  3J7T A;  3N5K A;  3SKX A;  2YJ4 A;  5AVV A;  5AVQ A;  5A3S A;  4J2T A;  3AR6 A;  2AGV A;  1U7Q A;  2EAU A;  3NAL A;  5AW9 A;  2C8L A;  2ARF A;  4YCM A;  3W5B A;  3W5C A;  5AW4 A;  3WGU A;  3AR4 A;  1T5T A;  2KMV A;  2DQS A;  3SKY A;  4BEV A;  2KMX A;  2ZXE A;  5AW1 A;  5AVS A;  1Q3I A;  2ZBD A;  4BYG A;  5AVY A;  4BEW A;  5AVW A;  3A1E A;  2ZBG A;  1IWO A;  3W5A A;  2IYE A;  5AW7 A;  4HYT A;  1WPG A;  4Y3U A;  1SU4 A;  2YJ5 A;  5AW2 A;  2A00 A;  4RET A;  5AW8 A;  3RFU A;  5AW0 A;  3B8E A;  2ZBE A;  2EAR A;  3A1C A;  3BA6 A;  4RES A;  2YJ3 A;  3NAM A;  4KYT A;  1XP5 A;  3W5D A;  5AVZ A;  1MO7 A;  1T5S A;  5AVU A;  1VFP A;  3B9B A;  3TLM A;  2C8K A;  2EAT A;  5AVR A;  1SVJ A;  4UU0 A;  5AVX A;  2OA0 A;  3N8G A;  3GWI A;  4UU1 A;  5A3Q A;  4YCN A;  3FGO A;  3NAN A;  3KDP A;  2B8E A;  4H1W A;  3AR5 A;  3AR2 A;  3FPB A;  1MO8 A;  5AW3 A;  2C9M A;  2YFY A;  5AW6 A;  2A29 A;  5AVT A;  4NAB A;  2C88 A;  5A3R A;  3AR8 A;  3FPS A;  2O9J A; 
#chains in the Genus database with same CATH topology
 2BY4 A;  4BBJ A;  4UMV A;  4YCL A;  2YJ6 A;  4XOU A;  3AR7 A;  4XE5 A;  5AW5 A;  2ZBF A;  3B9R A;  3WGV A;  3AR9 A;  3A1D A;  3AR3 A;  3A3Y A;  3J7T A;  3N5K A;  3SKX A;  2YJ4 A;  5AVV A;  5AVQ A;  5A3S A;  4J2T A;  3AR6 A;  2AGV A;  1U7Q A;  2EAU A;  3NAL A;  5AW9 A;  2C8L A;  2ARF A;  4YCM A;  3W5B A;  3W5C A;  5AW4 A;  3WGU A;  3AR4 A;  1T5T A;  2KMV A;  2DQS A;  3SKY A;  4BEV A;  2KMX A;  2ZXE A;  5AW1 A;  5AVS A;  1Q3I A;  2ZBD A;  4BYG A;  5AVY A;  4BEW A;  5AVW A;  3A1E A;  2ZBG A;  1IWO A;  3W5A A;  2IYE A;  5AW7 A;  4HYT A;  1WPG A;  4Y3U A;  1SU4 A;  2YJ5 A;  5AW2 A;  2A00 A;  4RET A;  5AW8 A;  3RFU A;  5AW0 A;  3B8E A;  2ZBE A;  2EAR A;  3A1C A;  3BA6 A;  4RES A;  2YJ3 A;  3NAM A;  4KYT A;  1XP5 A;  3W5D A;  5AVZ A;  1MO7 A;  1T5S A;  5AVU A;  1VFP A;  3B9B A;  3TLM A;  2C8K A;  2EAT A;  5AVR A;  1SVJ A;  4UU0 A;  5AVX A;  2OA0 A;  3N8G A;  3GWI A;  4UU1 A;  5A3Q A;  4YCN A;  3FGO A;  3NAN A;  3KDP A;  2B8E A;  4H1W A;  3AR5 A;  3AR2 A;  3FPB A;  1MO8 A;  5AW3 A;  2C9M A;  2YFY A;  5AW6 A;  2A29 A;  5AVT A;  4NAB A;  2C88 A;  5A3R A;  3AR8 A;  3FPS A;  2O9J A; 
#chains in the Genus database with same CATH homology
 2BY4 A;  4BBJ A;  4UMV A;  4YCL A;  2YJ6 A;  4XOU A;  3AR7 A;  4XE5 A;  5AW5 A;  2ZBF A;  3B9R A;  3WGV A;  3AR9 A;  3A1D A;  3AR3 A;  3A3Y A;  3J7T A;  3N5K A;  3SKX A;  2YJ4 A;  5AVV A;  5AVQ A;  5A3S A;  4J2T A;  3AR6 A;  2AGV A;  1U7Q A;  2EAU A;  3NAL A;  5AW9 A;  2C8L A;  2ARF A;  4YCM A;  3W5B A;  3W5C A;  5AW4 A;  3WGU A;  3AR4 A;  1T5T A;  2KMV A;  2DQS A;  3SKY A;  4BEV A;  2KMX A;  2ZXE A;  5AW1 A;  5AVS A;  1Q3I A;  2ZBD A;  4BYG A;  5AVY A;  4BEW A;  5AVW A;  3A1E A;  2ZBG A;  1IWO A;  3W5A A;  2IYE A;  5AW7 A;  4HYT A;  1WPG A;  4Y3U A;  1SU4 A;  2YJ5 A;  5AW2 A;  2A00 A;  4RET A;  5AW8 A;  3RFU A;  5AW0 A;  3B8E A;  2ZBE A;  2EAR A;  3A1C A;  3BA6 A;  4RES A;  2YJ3 A;  3NAM A;  4KYT A;  1XP5 A;  3W5D A;  5AVZ A;  1MO7 A;  1T5S A;  5AVU A;  1VFP A;  3B9B A;  3TLM A;  2C8K A;  2EAT A;  5AVR A;  1SVJ A;  4UU0 A;  5AVX A;  2OA0 A;  3N8G A;  3GWI A;  4UU1 A;  5A3Q A;  4YCN A;  3FGO A;  3NAN A;  3KDP A;  2B8E A;  4H1W A;  3AR5 A;  3AR2 A;  3FPB A;  1MO8 A;  5AW3 A;  2C9M A;  2YFY A;  5AW6 A;  2A29 A;  5AVT A;  4NAB A;  2C88 A;  5A3R A;  3AR8 A;  3FPS A;  2O9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...