2KN9A

Solution structure of zinc-substituted rubredoxin b (rv3250c) from mycobacterium tuberculosis. seattle structural genomics center for infectious disease target mytud.01635.a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
MAHHHHHHMGTLEAQTQGPGSMNDYKLFRCIQCGFEYDEALGWPEDGIAAGTRWDDIPDDWSCPDCGAAKSDFEMVEVARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Solution-state NMR structure and biophysical characterization of zinc-substituted rubredoxin B (Rv3250c) from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Electron transport
total genus 12
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2kn9A01
2KKDA 1SMMA 2QL0A 1S30A 4TPUA 4YWMA 1YK5A 2V3BB 2PYAA 2K2DA 5RXNA 1E8JA 3RZTA 1CAAA 3QVDA 4POGA 3KYUA 1R0JA 4AR4A 1B13A 1H7VA 1FHHA 2HR5A 1CADA 1BQ8A 2DSXA 3RZ6A 4RXNA 1LKOA 1T9QA 1IU5A 1IROA 1LKMA 1RYTA 7RXNA 4AR5A 4POFA 3MPSA 1B71A 1LTLA 1R0HA 1RWDA 1BE7A 1YUZA 5AI3A 3SS2A 1YV1A 1FHMA 2LCQA 3PZAA 1RB9A 2VL6A 1BFYA 3KYXA 1T9OA 1B2OA 3A44A 2RDVA 8RXNA 1T9PA 3KYYA 1IU6A 2PVXA 1C09A 1S24A 1S2ZA 4AR3A 1BQ9A 1BRFA 1RDVA 2PVEA 1IRNA 5AI2A 2KN9A 1LKPA 1NNQA 1R0IA 5IY0A 1JYBA 1R0GA 3KYWA 1YK4A 3RYGA 4YWLA 1B2JA 1QCVA 4AR6A 1SMWA 2GMGA 3KYVA 4K9FA 1VCXA 2MS3A 1DVBA 2M4YA 1QYBA 1R0FA 6RXNA 1ZRPA 1YUXA 1DX8A 1SMUA 3PWFA 1RDGA 4ME3A
chains in the Genus database with same CATH superfamily
4TPUA 5FLML 3M3YL 3P2AA 3S1RL 5RXNA 2PMZP 4BY7L 2J9UB 1NXGA 4POGA 4QIWP 5M3FL 1RYQA 1BQ8A 4GS7D 2DSXA 5IYBL 4U671 2JI3A 1T9QA 3I4ML 2WB1P 2JA5L 2EY4E 4G6BA 3FKIL 3S14L 1P7PA 5C4XL 5AI3A 4UY81 2L0ZA 4Y52L 5MFZA 5EIOC 1FHMA 3PZAA 1SFOL 3FDJA 2V0EA 2VL6A 4WFN1 3KYXA 1B2OA 1I50L 2NVYL 2E2HL 1R9TL 2B63L 8RXNA 3HOZL 3GTPL 2A69D 1S24A 4AR3A 1BRFA 1RDVA 3PIO1 1IRNA 5C4JL 2KN9A 1LKPA 1VZIA 2A6HD 4E6YA 4A93L 1R0GA 5FJ8L 3GTML 2NVTL 1SMWA 2YU9L 1I6HL 3KYVA 5GAGc 2M4YA 1PFWA 2M6PA 3ZG6A 2PSMC 1YUXA 3HKZP 3B0AB 3WWNB 3P8BA 1Z92B 1SMMA 1Y1VL 3GTLL 2ZIXA 3HOYL 2V3BB 4A3BL 1PZXA 2AUSB 3RZTA 2R7ZL 5M5XL 3QVDA 2RFKB 3KYUA 1R0JA 3GTQL 1B13A 2V0FA 2E2IL 3H3VM 2JA8L 2A6ED 2JI1A 2NYDA 2VUML 3RZ6A 4RXNA 3GTKL 1LKMA 3J7Z1 3S15L 2CKAA 7RXNA 4AR5A 2ERSA 2XJPA 2R93L 1B71A 5IP7L 3JR7A 1BE7A 1I3QL 3LNLA 1K83L 4Y7NL 4AI0A 2LCQA 1RB9A 3LWOB 3HJWB 1BFYA 1TWAL 5C3EL 4BY1L 2CKCA 2RDVA 3CQZL 3LWRB 2B5ID 1C09A 1S2ZA 1BQ9A 2PVEA 2R92L 5AI2A 2M6OA 1NXEA 3S1NL 1R0IA 4A3GL 3KYWA 1TWHL 4A3EL 1YK4A 4YWLA 4A3FL 3S2DL 4JAEA 2GMGA 3H9CA 4K9FA 4JAFA 4XXBB 1QYBA 5H1Sc 4TVMA 5IYCL 1R0FA 2Z3QB 4AI3A 1ZRPA 4ZN1B 3PWFA 1RDGA 3HJYB 2XJVA 4X6AL 1S30A 1PFUA 3IU3I 5GADc 4YWMA 1YK5A 1VZGA 3M4OL 3S2HL 2C6AA 2Z3RB 4AHYA 1WJVA 1IW7D 3S16L 2AQCA 2C6BA 4AR4A 5MF6A 4A3IL 1FHHA 5M3ML 3B08B 3PKJA 4AHZA 3HOUL 1LKOA 1IROA 5DM71 5IP9L 2BE5D 5DM61 2XJSA 3MQKB 1VZHA 5EINC 1R0HA 1RWDA 3GTJL 1YUZA 3SS2A 3PKIA 4V196 1YV1A 2XJTA 4JADA 4A3DL 2O5JD 5C44L 3K35A 3S1ML 2XJRA 4A3CL 4A3JL 4AI2A 4A3LL 1T9PA 5MLC3 3KYYA 2PVXA 2PPTA 1TWGL 4AHXA 3LWPB 4AYBP 3S17L 2Y0SP 3VPBE 1F4LA 2JA7L 3RZOL 5M5WL 2H12A 2JI2A 3RYGA 1QCVA 1Y1WL 2NVXL 4B8CD 2JA6L 2APOB 3LWQB 3PIP1 4ZN3B 1TWCL 3HOWL 3PO3L 4AI1A 1OWCA 4ME3A 2KKDA 4C2M1 4C3JL 2QL0A 2ERJA 2HVYC 5GAEc 4A3ML 1OWBA 2CR8A 2PYAA 3S1QL 4BBRL 2K2DA 3QQCE 3H97A 2E2JL 1E8JA 4A3KL 1CAAA 3I4NL 4BXXL 1PFYA 4C3HL 3J7Y1 1H7VA 4LHNA 3H0GL 2HR5A 1CADA 2AYJA 2A68D 5K2ME 5MGNA 5M5YL 1IU5A 3LPEB 1RYTA 5GAHc 4XGHA 4POFA 3MPSA 1LTLA 4LHLA 5JVG1 5JVH1 3PL5A 2NVQL 1QQTA 1T9OA 3A44A 2XJQA 3H99A 4AHWA 3GTOL 1IU6A 1WCML 2WAQP 2M4VA 1NNQA 5IY0A 1JYBA 4BBSL 1TWFL 3RZDL 5AN9H 1B2JA 3K7AL 4AR6A 2XJUA 3GTGL 3HOXL 1VCXA 3H9BA 3LWVB 3MSUA 2MS3A 1DVBA 3HOVL 3HAXC 5IYDL 4C3IL 1PFVA 3NFPI 4JAGA 1ODHA 6RXNA 3WWLA 1DX8A 3PO2L 1SMUA 5MFPA
chains in the Genus database with same CATH topology
2KKDA 1SMMA 2ERJA 2QL0A 1S30A 2XJVA 3IU3I 4TPUA 5GADc 5GAEc 2ZIXA 4YWMA 1OWBA 1YK5A 1VZGA 2CR8A 2V3BB 2PYAA 3P2AA 2K2DA 2C6AA 3QQCE 2Z3RB 4AHYA 5RXNA 1E8JA 3RZTA 1WJVA 1IW7D 1CAAA 2J9UB 1NXGA 3QVDA 4POGA 2C6BA 3KYUA 1R0JA 4AR4A 1B13A 2V0FA 3J7Y1 5MF6A 1H7VA 2A6ED 2JI1A 1FHHA 4LHNA 2NYDA 3B08B 2HR5A 1CADA 1RYQA 2A68D 2AYJA 5K2ME 3PKJA 5MGNA 4AHZA 1BQ8A 4GS7D 2DSXA 3RZ6A 4RXNA 4U671 1LKOA 2JI3A 1T9QA 1IU5A 1IROA 1LKMA 3LPEB 5DM71 3J7Z1 1RYTA 2CKAA 4G6BA 2BE5D 4AR5A 5GAHc 2XJSA 4XGHA 2ERSA 2XJPA 7RXNA 1VZHA 5DM61 4POFA 3MPSA 1B71A 5EINC 1LTLA 1R0HA 1RWDA 1BE7A 3LNLA 4LHLA 1YUZA 5AI3A 3SS2A 3PKIA 5JVG1 4UY81 2L0ZA 4V196 5MFZA 5EIOC 1YV1A 1FHMA 2XJTA 4AI0A 4JADA 5JVH1 2LCQA 2O5JD 3K35A 3PZAA 1RB9A 2V0EA 2VL6A 2XJRA 1BFYA 4WFN1 3KYXA 1T9OA 1B2OA 3A44A 2XJQA 2CKCA 2RDVA 4AI2A 4AHWA 8RXNA 1T9PA 5MLC3 2B5ID 3KYYA 1IU6A 2A69D 2PVXA 1C09A 1S24A 1S2ZA 2PPTA 4AR3A 4AHXA 1BQ9A 1BRFA 1RDVA 2PVEA 3PIO1 1IRNA 2M4VA 3VPBE 5AI2A 2KN9A 2M6OA 1LKPA 1NXEA 1VZIA 1NNQA 2A6HD 1R0IA 4E6YA 5IY0A 2H12A 1JYBA 1R0GA 3KYWA 2JI2A 1YK4A 3RYGA 5AN9H 4YWLA 1B2JA 1QCVA 4AR6A 2XJUA 4B8CD 1SMWA 4JAEA 2GMGA 3KYVA 4K9FA 1VCXA 3MSUA 5GAGc 3PIP1 4ZN3B 2MS3A 1DVBA 2M4YA 4JAFA 4XXBB 1QYBA 5H1Sc 4TVMA 1R0FA 2M6PA 3NFPI 4JAGA 2Z3QB 3ZG6A 1ODHA 6RXNA 3WWLA 4AI3A 1ZRPA 2PSMC 4ZN1B 1YUXA 4AI1A 1DX8A 1OWCA 3B0AB 1SMUA 3PWFA 3WWNB 5MFPA 1RDGA 3P8BA 1Z92B 4ME3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKD A;  1SMM A;  2QL0 A;  1S30 A;  4TPU A;  4YWM A;  1YK5 A;  2V3B B;  2PYA A;  2K2D A;  5RXN A;  1E8J A;  3RZT A;  1CAA A;  3QVD A;  4POG A;  3KYU A;  1R0J A;  4AR4 A;  1B13 A;  1H7V A;  1FHH A;  2HR5 A;  1CAD A;  1BQ8 A;  2DSX A;  3RZ6 A;  4RXN A;  1LKO A;  1T9Q A;  1IU5 A;  1IRO A;  1LKM A;  1RYT A;  7RXN A;  4AR5 A;  4POF A;  3MPS A;  1B71 A;  1LTL A;  1R0H A;  1RWD A;  1BE7 A;  1YUZ A;  5AI3 A;  3SS2 A;  1YV1 A;  1FHM A;  2LCQ A;  3PZA A;  1RB9 A;  2VL6 A;  1BFY A;  3KYX A;  1T9O A;  1B2O A;  3A44 A;  2RDV A;  8RXN A;  1T9P A;  3KYY A;  1IU6 A;  2PVX A;  1C09 A;  1S24 A;  1S2Z A;  4AR3 A;  1BQ9 A;  1BRF A;  1RDV A;  2PVE A;  1IRN A;  5AI2 A;  2KN9 A;  1LKP A;  1NNQ A;  1R0I A;  5IY0 A;  1JYB A;  1R0G A;  3KYW A;  1YK4 A;  3RYG A;  4YWL A;  1B2J A;  1QCV A;  4AR6 A;  1SMW A;  2GMG A;  3KYV A;  4K9F A;  1VCX A;  2MS3 A;  1DVB A;  2M4Y A;  1QYB A;  1R0F A;  6RXN A;  1ZRP A;  1YUX A;  1DX8 A;  1SMU A;  3PWF A;  1RDG A;  4ME3 A; 
#chains in the Genus database with same CATH topology
 4TPU A;  5FLM L;  3M3Y L;  3P2A A;  3S1R L;  5RXN A;  2PMZ P;  4BY7 L;  2J9U B;  1NXG A;  4POG A;  4QIW P;  5M3F L;  1RYQ A;  1BQ8 A;  4GS7 D;  2DSX A;  5IYB L;  4U67 1;  2JI3 A;  1T9Q A;  3I4M L;  2WB1 P;  2JA5 L;  2EY4 E;  4G6B A;  3FKI L;  3S14 L;  1P7P A;  5C4X L;  5AI3 A;  4UY8 1;  2L0Z A;  4Y52 L;  5MFZ A;  5EIO C;  1FHM A;  3PZA A;  1SFO L;  3FDJ A;  2V0E A;  2VL6 A;  4WFN 1;  3KYX A;  1B2O A;  1I50 L;  2NVY L;  2E2H L;  1R9T L;  2B63 L;  8RXN A;  3HOZ L;  3GTP L;  2A69 D;  1S24 A;  4AR3 A;  1BRF A;  1RDV A;  3PIO 1;  1IRN A;  5C4J L;  2KN9 A;  1LKP A;  1VZI A;  2A6H D;  4E6Y A;  4A93 L;  1R0G A;  5FJ8 L;  3GTM L;  2NVT L;  1SMW A;  2YU9 L;  1I6H L;  3KYV A;  5GAG c;  2M4Y A;  1PFW A;  2M6P A;  3ZG6 A;  2PSM C;  1YUX A;  3HKZ P;  3B0A B;  3WWN B;  3P8B A;  1Z92 B;  1SMM A;  1Y1V L;  3GTL L;  2ZIX A;  3HOY L;  2V3B B;  4A3B L;  1PZX A;  2AUS B;  3RZT A;  2R7Z L;  5M5X L;  3QVD A;  2RFK B;  3KYU A;  1R0J A;  3GTQ L;  1B13 A;  2V0F A;  2E2I L;  3H3V M;  2JA8 L;  2A6E D;  2JI1 A;  2NYD A;  2VUM L;  3RZ6 A;  4RXN A;  3GTK L;  1LKM A;  3J7Z 1;  3S15 L;  2CKA A;  7RXN A;  4AR5 A;  2ERS A;  2XJP A;  2R93 L;  1B71 A;  5IP7 L;  3JR7 A;  1BE7 A;  1I3Q L;  3LNL A;  1K83 L;  4Y7N L;  4AI0 A;  2LCQ A;  1RB9 A;  3LWO B;  3HJW B;  1BFY A;  1TWA L;  5C3E L;  4BY1 L;  2CKC A;  2RDV A;  3CQZ L;  3LWR B;  2B5I D;  1C09 A;  1S2Z A;  1BQ9 A;  2PVE A;  2R92 L;  5AI2 A;  2M6O A;  1NXE A;  3S1N L;  1R0I A;  4A3G L;  3KYW A;  1TWH L;  4A3E L;  1YK4 A;  4YWL A;  4A3F L;  3S2D L;  4JAE A;  2GMG A;  3H9C A;  4K9F A;  4JAF A;  4XXB B;  1QYB A;  5H1S c;  4TVM A;  5IYC L;  1R0F A;  2Z3Q B;  4AI3 A;  1ZRP A;  4ZN1 B;  3PWF A;  1RDG A;  3HJY B;  2XJV A;  4X6A L;  1S30 A;  1PFU A;  3IU3 I;  5GAD c;  4YWM A;  1YK5 A;  1VZG A;  3M4O L;  3S2H L;  2C6A A;  2Z3R B;  4AHY A;  1WJV A;  1IW7 D;  3S16 L;  2AQC A;  2C6B A;  4AR4 A;  5MF6 A;  4A3I L;  1FHH A;  5M3M L;  3B08 B;  3PKJ A;  4AHZ A;  3HOU L;  1LKO A;  1IRO A;  5DM7 1;  5IP9 L;  2BE5 D;  5DM6 1;  2XJS A;  3MQK B;  1VZH A;  5EIN C;  1R0H A;  1RWD A;  3GTJ L;  1YUZ A;  3SS2 A;  3PKI A;  4V19 6;  1YV1 A;  2XJT A;  4JAD A;  4A3D L;  2O5J D;  5C44 L;  3K35 A;  3S1M L;  2XJR A;  4A3C L;  4A3J L;  4AI2 A;  4A3L L;  1T9P A;  5MLC 3;  3KYY A;  2PVX A;  2PPT A;  1TWG L;  4AHX A;  3LWP B;  4AYB P;  3S17 L;  2Y0S P;  3VPB E;  1F4L A;  2JA7 L;  3RZO L;  5M5W L;  2H12 A;  2JI2 A;  3RYG A;  1QCV A;  1Y1W L;  2NVX L;  4B8C D;  2JA6 L;  2APO B;  3LWQ B;  3PIP 1;  4ZN3 B;  1TWC L;  3HOW L;  3PO3 L;  4AI1 A;  1OWC A;  4ME3 A;  2KKD A;  4C2M 1;  4C3J L;  2QL0 A;  2ERJ A;  2HVY C;  5GAE c;  4A3M L;  1OWB A;  2CR8 A;  2PYA A;  3S1Q L;  4BBR L;  2K2D A;  3QQC E;  3H97 A;  2E2J L;  1E8J A;  4A3K L;  1CAA A;  3I4N L;  4BXX L;  1PFY A;  4C3H L;  3J7Y 1;  1H7V A;  4LHN A;  3H0G L;  2HR5 A;  1CAD A;  2AYJ A;  2A68 D;  5K2M E;  5MGN A;  5M5Y L;  1IU5 A;  3LPE B;  1RYT A;  5GAH c;  4XGH A;  4POF A;  3MPS A;  1LTL A;  4LHL A;  5JVG 1;  5JVH 1;  3PL5 A;  2NVQ L;  1QQT A;  1T9O A;  3A44 A;  2XJQ A;  3H99 A;  4AHW A;  3GTO L;  1IU6 A;  1WCM L;  2WAQ P;  2M4V A;  1NNQ A;  5IY0 A;  1JYB A;  4BBS L;  1TWF L;  3RZD L;  5AN9 H;  1B2J A;  3K7A L;  4AR6 A;  2XJU A;  3GTG L;  3HOX L;  1VCX A;  3H9B A;  3LWV B;  3MSU A;  2MS3 A;  1DVB A;  3HOV L;  3HAX C;  5IYD L;  4C3I L;  1PFV A;  3NFP I;  4JAG A;  1ODH A;  6RXN A;  3WWL A;  1DX8 A;  3PO2 L;  1SMU A;  5MFP A; 
#chains in the Genus database with same CATH homology
 2KKD A;  1SMM A;  2ERJ A;  2QL0 A;  1S30 A;  2XJV A;  3IU3 I;  4TPU A;  5GAD c;  5GAE c;  2ZIX A;  4YWM A;  1OWB A;  1YK5 A;  1VZG A;  2CR8 A;  2V3B B;  2PYA A;  3P2A A;  2K2D A;  2C6A A;  3QQC E;  2Z3R B;  4AHY A;  5RXN A;  1E8J A;  3RZT A;  1WJV A;  1IW7 D;  1CAA A;  2J9U B;  1NXG A;  3QVD A;  4POG A;  2C6B A;  3KYU A;  1R0J A;  4AR4 A;  1B13 A;  2V0F A;  3J7Y 1;  5MF6 A;  1H7V A;  2A6E D;  2JI1 A;  1FHH A;  4LHN A;  2NYD A;  3B08 B;  2HR5 A;  1CAD A;  1RYQ A;  2A68 D;  2AYJ A;  5K2M E;  3PKJ A;  5MGN A;  4AHZ A;  1BQ8 A;  4GS7 D;  2DSX A;  3RZ6 A;  4RXN A;  4U67 1;  1LKO A;  2JI3 A;  1T9Q A;  1IU5 A;  1IRO A;  1LKM A;  3LPE B;  5DM7 1;  3J7Z 1;  1RYT A;  2CKA A;  4G6B A;  2BE5 D;  4AR5 A;  5GAH c;  2XJS A;  4XGH A;  2ERS A;  2XJP A;  7RXN A;  1VZH A;  5DM6 1;  4POF A;  3MPS A;  1B71 A;  5EIN C;  1LTL A;  1R0H A;  1RWD A;  1BE7 A;  3LNL A;  4LHL A;  1YUZ A;  5AI3 A;  3SS2 A;  3PKI A;  5JVG 1;  4UY8 1;  2L0Z A;  4V19 6;  5MFZ A;  5EIO C;  1YV1 A;  1FHM A;  2XJT A;  4AI0 A;  4JAD A;  5JVH 1;  2LCQ A;  2O5J D;  3K35 A;  3PZA A;  1RB9 A;  2V0E A;  2VL6 A;  2XJR A;  1BFY A;  4WFN 1;  3KYX A;  1T9O A;  1B2O A;  3A44 A;  2XJQ A;  2CKC A;  2RDV A;  4AI2 A;  4AHW A;  8RXN A;  1T9P A;  5MLC 3;  2B5I D;  3KYY A;  1IU6 A;  2A69 D;  2PVX A;  1C09 A;  1S24 A;  1S2Z A;  2PPT A;  4AR3 A;  4AHX A;  1BQ9 A;  1BRF A;  1RDV A;  2PVE A;  3PIO 1;  1IRN A;  2M4V A;  3VPB E;  5AI2 A;  2KN9 A;  2M6O A;  1LKP A;  1NXE A;  1VZI A;  1NNQ A;  2A6H D;  1R0I A;  4E6Y A;  5IY0 A;  2H12 A;  1JYB A;  1R0G A;  3KYW A;  2JI2 A;  1YK4 A;  3RYG A;  5AN9 H;  4YWL A;  1B2J A;  1QCV A;  4AR6 A;  2XJU A;  4B8C D;  1SMW A;  4JAE A;  2GMG A;  3KYV A;  4K9F A;  1VCX A;  3MSU A;  5GAG c;  3PIP 1;  4ZN3 B;  2MS3 A;  1DVB A;  2M4Y A;  4JAF A;  4XXB B;  1QYB A;  5H1S c;  4TVM A;  1R0F A;  2M6P A;  3NFP I;  4JAG A;  2Z3Q B;  3ZG6 A;  1ODH A;  6RXN A;  3WWL A;  4AI3 A;  1ZRP A;  2PSM C;  4ZN1 B;  1YUX A;  4AI1 A;  1DX8 A;  1OWC A;  3B0A B;  1SMU A;  3PWF A;  3WWN B;  5MFP A;  1RDG A;  3P8B A;  1Z92 B;  4ME3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...