2KNBA

Solution nmr structure of the parkin ubl domain in complex with the endophilin-a1 sh3 domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
MIVFVRFNSSYGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELQNHLTVQNCDLEQQSIVHIVQRPQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase parkin
publication title SH3 domains from a subset of BAR proteins define a Ubl-binding domain and implicate parkin in synaptic ubiquitination.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 18
structure length 76
sequence length 76
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2knbA00
1WJUA 4RMAA 4IWQA 5D6JB 3O65B 2I1JA 4KSLC 3TBLD 3IVFA 2WWZA 3ZNGC 5HKHA 2FCMA 4FLHA 4B6WA 4DHJD 5JHBA 1X1MA 4IWOA 2LRWA 4B9KA 4NQLB 4HCNB 2XBBC 1J0GA 2KMAA 4HXDA 2BYVE 2R2OA 2UWQA 3AULA 3UQBA 4GDLB 4BVUC 3ZO5B 3QK0A 4FHJA 3PLUA 2FIDA 3PSEB 3HM3A 2V4LA 1WX8A 3BY4B 3QCAA 4W9DA 3H7PB 2KLCA 2ZNVB 2N9EB 3Q3JA 3AU4A 1H8CA 4IM2A 2MRPA 5DCNA 1VCBA 2C9WB 2W9NA 3DBHI 3MTNB 2ZCCA 4MJSB 1E5WA 3C0RB 3I3TB 5IA7A 1P1AA 4A3OA 1LXDA 4LDTD 3CMMB 5E6OA 4HDOA 1RFAA 1LM8B 4EKUA 1UGMA 2GBMA 3ZNZB 2OJRA 4J6IA 3VH4B 4NJ7A 1CMXB 4I6NB 4TQ0A 1WM2A 2Z0EB 4KZ0A 1S1QB 2KOXA 4EUTA 4EEWA 2KJ6A 3DVGY 4OVVA 4W9HA 3V61A 4IC7B 2DYMA 2JRIB 4EOYA 2L05A 3VXWA 4BKTA 2FUHB 5L95C 2IO0B 2ZNVC 3A9KA 4W9GA 5CX3A 1WGDA 3SU8X 2D10A 2AYOB 2K1FA 4AOFA 1V49A 1XT9B 3AU5A 4GN1A 4JQWC 2NPTA 4LJPB 3V62A 2GBKA 4DDID 2ZZPB 1EO6A 4PS8A 3ZTDA 1VD2A 3GZNI 4K7SA 2KDIA 3MHSD 4TUUA 3ZRFA 2L76A 2Z59B 4WQOB 3RZFA 2NPTB 5G2NA 4BOZB 3QA8A 2KHWB 4JGHB 2D07B 4OVUA 3VUYA 4FJZA 2IYDB 1YX6B 1UD7A 3WIMA 4GGQA 4IUMB 3KUDB 4ANWA 4KV2A 4WJPA 4RM9A 3B08A 3RYTA 1WGYA 5D94A 2Z0DB 1WXAA 3ZRCA 1P9DU 4ASWC 1WI0A 1OEYJ 2G4DB 3EHVA 2HE7A 4II3B 1C3TA 4HWIB 2KTRB 1GG3A 3K9OB 3RZWC 2J0MA 2KQSA 4CYEA 2KXJA 3NOBA 4IWPA 5CHWA 2IO3B 3CF6E 3DVGX 5KHQA 2O2VB 2ASQA 4KIKA 4DHZE 2B3AA 3DCGA 3PTFC 4FJVB 2IO1B 4IG7B 3KUZA 2V1YA 4TV3A 2ZCBA 1RRBA 2LASA 2ZEQA 3CSTA 5LXHA 3H1UA 2J0KA 2XK5B 2NCNA 1KOTA 2IO2B 2KDFB 3WA0A 2MSED 2JXXA 5E6PA 2KTFA 3RUIB 2PE9A 3EECA 2MBEA 1LFDA 2DX5B 1V5TA 4DBGA 5JHAA 2C60A 2KLGA 5J18A 3QQ8B 1E90A 1L2NA 4WJOA 1BT0A 1NDDA 3L10B 2JUOA 3ZDMC 3W1SC 3DQVA 3L16A 3JSVB 4JIOU 4GOCA 2KQ7A 2OOBB 2BGFA 3DPDA 2CU1A 3MJWA 4FHKA 4LCDE 4ZRJA 4NPNA 1TZ1A 2FCSA 4K7UA 4G0NB 4K81A 3RD2A 2A5UA 1Y8RC 4EZLA 3NZSA 2AWTA 4FN2A 3R7RA 4DHJB 3X23A 2O6VD 4ANVA 3QX1A 2JWZA 2KK8A 2MBQA 1V86A 1E8WA 3ENEA 4PYUA 3SD5A 3DBSA 4GDKB 3WANA 3UF8A 2BWES 2MBHA 1WRDB 3EC8A 3R3MA 4TQ1A 4RM8A 3RT3B 3K9PB 1EF5A 5AZHA 5C1ZA 1HE8A 1YJ1A 2DZKA 5CTRC 3ZUNA 2NS5A 4TKNA 5J17A 2JY6A 2UYZB 5DPWA 2FIFA 1I35A 4NNJB 2M8SA 5E6NA 2KWCA 1P0RA 3V6EB 2LXAA 3VDZA 4DWFA 1WE7A 3VTVA 3LDZE 1OGWA 3QAQA 4W9IA 3R7QA 2DHZA 2RR9A 3V6CB 4LDTB 4DDGD 2N4FA 3VVWB 3HIZA 4KDIC 4HDQA 2GBJA 4JL9A 2M4NA 2RSUA 2NBUA 2LD9A 2IBIB 2KDBA 1V2YA 1UH6A 4X57B 5KHOA 3L17A 1SIFA 1J19A 2PJHA 4MELA 2WDTB 2WX0A 5LXIB 4I6PA 2LVQA 3ALBA 3VUWA 2MLBA 2RPQA 3L0WB 2C7MB 4AJWA 2L3ZA 3ZNHB 4BKSD 4GXBA 2NR2A 4FA6A 1NBFC 2M17A 3N3KB 1UBQA 4BKGA 1GC7A 2DAFA 2LWPA 4A20A 4HCPB 4BBNC 2PE6B 1R4NI 3JVZX 3OAWA 4F1SA 1AARA 1H4RA 2K8BA 4GSWA 3PHWB 1WIAA 3TCAA 1YQBA 2MBOA 2ZJDA 2WYQA 4W9EA 3HHMA 3SHQA 4URKA 2ZVNA 2BYFA 3PHXB 2AL6A 2LGDA 3P2BA 1J8CA 1ZKHA 5D7GA 1GNUA 2L00B 4LJOB 2RGFA 4MGIE 3KVFB 2N1VA 4ZDVA 4ICUA 1SGHA 4CHKA 4XZ4A 1WY8A 2J0JA 3S2AA 2MW5A 4AWJA 3EFUA 3UGBB 3A9KB 4W9CA 2JVCA 2N9XA 2KMCA 3NHEB 2K39A 1V5OA 4IM0A 4MGZE 3JW0X 3PPAA 2BYEA 2Y5BB 5C23A 1YX5B 3ZTCA 4KDLB 5DPSA 4K1RB 1G6JA 2DZJA 4IW0A 2FCNA 3JYUA 2CKHB 3M95A 2KC2A 2KFKA 2LVOA 1RLFA 2G45B 1P3QU 3OJ4B 4PYZA 4XX5A 3U8ZA 2EKEC 4NY0A 1EF1A 1LQBA 1WH3A 2ZVOA 2VRRB 2HTHA 4ICVA 4GU2A 4MM3A 2NBVB 2MWSB 3U30A 1TGZB 3HM6X 2M0XA 2WX1A 3ONSA 3X0WA 4DXAB 2HD5B 1C1YB 3A1QA 5IAAC 1OEYA 2KX0A 2KJHB 3APFA 2LUEA 2KDEB 3GOEA 3KYDD 3A9JA 4MDKE 3VUXA 2KVRA 1GUAB 2LRUA 3DVNV 3PRPB 2KWUB 3A33B 2C7HA 4KIKB 2HJ8A 1Q5WB 3PV1A 5CHVC 1E8XA 1WE6A 2CHZA 3APDA 4FBJB 1V9JA 4GB9A 3DOWA 2LGXA 4HK2A 1WZ0A 4BFRA 2YVCA 1SE9A 3QHTA 4PS3A 4P7IA 4ZRIA 5AZGA 1WX9A 1WGHA 1V6EA 2L0TA 2O6VA 4WWOA 4F7ZA 3Q3FA 1GJZA 1WGRA 1UELA 3QJZA 4EZKA 4ANUA 3ML9A 4W9FA 4G11A 2G4SA 2LGYA 3T8MA 2R2QA 4WJNA 1E8ZA 2FCQA 2K8CA 2O6VB 2DENB 3L08A 1E8YA 2DZMA 3RCZA 3KUCB 1WR1A 1WXMA 2BKFA 1WZ3A 1WX7A 1E7UA 1IYFA 4FADA 1WJ4A 3M3JA 4W9JA 1WYWB 2LVPA 2A4ZA 2XEWA 3WAPA 1YD8U 1JRUA 2G3QB 2C5LC 2CS4A 2K6QA 4HPLB 1Z2MA 2NVUI 4WWPA 4E3CA 2JPHA 1WR6E 5JZEB 2CHXA 3PGEA 4CO7A 1XQQA 2PEAA 3PVLA 4ZRKA 4PS7A 1IPGA 3TMPB 4EZJA 1EUVB 4KSKC 2KNBA 2KZRA 2KFJA 1Q0WB 4WJQA 2C7NB 2QHOA 2BKRB 1ZW7A 3VQIA 4BKSA 5L83A 1KJTA 4WAAA 3DDCB 3APCA 3HK0A 1WXSA 1UZXB 1ZGUB 2J7QB 2DYOA 2L7RA 3L13A 2JZ3B 2LJ5A 4HPMB 2KC1A 4II2B 3VHTC 3IBEA 4DK5A 5J2RA 3WAMA 4GDLA 1M94A 5GMVA 2JT4B 5D2MB 5JH5C 3NS8A 3IFWB 3V60A 3H7PA 5CHFA 2DAJA 1GC6A 3M63B 1Q1OA 3TJPA 4MGKE 2MBBB 4MJSA 3VFKA 4W9KA 3BINA 1V80A 2I1KA 3DBLI 4MSQB 2MCNB 1P98A 4NAWA 3U7DA 5FR6A 2D3GA 4GIVA 4KVGB 2DYBA 3RULA 4B95A 2KO3A 4MH0E 2NBWB 3NY5A 3W1YA 3QC8B 3N30A 4G50A 4ANXA 3UQAA 2KX3A 4MEMA 2KANA 2GBRA 2JRHA 2GBNA 4NAWB 3VTWA 1PQSA 2D11A 3AI5A 2FNJB 4EFOA 2N7DA 3SDLC 3ZDTA 1U4AA 2K6DB 3NZUA 2M1MA 5DPTA 3TIXA 1YIWA 3PRZA 1D3ZA 2ZPYA 1R4MI 3KW5B 2V3SA 2N9PC 3CSFA 2PPHA 2MQJA 4N9F4 1IP9A 3IG3A 4K7WA 4NQKE 4AUQC 2CR5A 2MP2A 3A4SC 4MGYE 2CHWA 1F9JA 2DZIA 3AXCA 3R66C 5TR5A 3ECIA 4AP4C 1V81A 3ZKJC 4YL8A 2K8HA 2KJRA 3T9LA 3N32A 2MP2B 2MX2A 3PZDA 4A3PA 5BO4B 2KFKB 4XC2A 2BPSA 3UIOB 2GMIC 3A4RA 4DHZB 2BF8B 1WM3A 2N1WA 3L54A 2JZZA 2L8JA 3IHPC 3PREA 3VAWA 1E7VA 4I6LB 3PRMB 2KTRA 3A1QB 1KLVA 2KN5A 1MG8A 3W1SA 4F8CB 2IY0B 2MA9B 4BBNF 4FJYA 2O2VA 4NJ6A 3ZVVA 3A9JB 3PT2B 2IZVB 2L0FA 4JLCA 4HJKA 3VTUA 2K25A 2YLMA 1ISNA 1Z5SB 3ZW3A 1WFYA 2LZ6A 2KWVB 1KM7A 4ZYNA 3UIPB 3OLMD 4HLEA 1WJ6A 1I42A 2XK5A 3DVNU 3QWZB 3VH3B 5EDSA 4W9LA 2BWFA 1L7YA 2REXA 3ZNID 2RD0A 2LI5A 3ZLZA 1K8RB 3PS6A 5LLIA 4FULA 1WGGA 2D2QA 3LJ3A 2AL3A 3WALA 4GMVA 1A5RA 3ML8A 3OJ3A 1OTRB 5DPRA 3UINB 1RAXA 2FAZA 2GOWA 3H6NA 1WMHA 3QIJA 3QARA 4KZCA 3TL5A 2JF5A 1NI2A 3B0AA 2ZPNA 3JSVA 1FXTB 2N7EA 4MSMB 2KKCA 4AJYB 4BOSC 5G55A 4WWNA 3B1LX 1WMHB 3DBRI 3KH0A 4M8NA 4M8MA 4IM3A 4G3XB 5AEKB 4HVBA 3H7SA 1XD3B 1S3SG 5AZFA 3KYCD 3H9DA 1WF9A 1WXVA 1TBEA 4E74A 2IY1B 1T0YA 1OQYA 3D32A 4GDKA 3ZIMA 1UBIA 3M62B 2KD0A 4E71A 3WAOA 3PLVA 1QZEA 1TTNA 2EMSA 2LXCA 4M0WB 1WJNA 2AEHA 2EMTA
chains in the Genus database with same CATH superfamily
1AN8A 1LGRA 1WJUA 2PMVA 3H8HA 5D6JB 2QJLA 1L0XB 3IVFA 3LYYA 2FCMA 4B6WA 1CK1A 4DHJD 1X1MA 2XBBC 4HXDA 2BYVE 1NYRA 2RDGA 3KQ4A 4JWSC 2FIDA 3PSEB 2V4LA 2FUG1 2KLCA 2N9EB 1JROA 2MRPA 4MJSB 1MPEA 4A3OA 5FKAC 4LDTD 1L5PA 3BIID 2BB6A 2IGHA 3VH4B 1CMXB 4KX6B 4TQ0A 1TS3A 2Z0EB 4KZ0A 4EEWA 3DVGY 4OVVA 1UF0A 2JRIB 1OFFA 3FC4A 4EOYA 3VXWA 1ESFA 2G9HD 5L95C 1WGDA 3SU8X 4AOFA 1V49A 1J7AA 1WXQA 3V62A 4DDID 3T3OA 1VD2A 3GZNI 1N60A 3MHSD 4BOZB 2KHWB 2D07B 2WXHA 2QDFA 1YX6B 3WIMA 3KUDB 1GB1A 4ITKA 3B08A 3RYTA 2V4IB 1YJJA 2Z0DB 1WXAA 2V0GA 2NMQA 1OEYJ 4S17A 5EE9A 1K51A 2KTRB 3RZWC 1I4PA 5CHWA 3NOBA 5KHQA 1T0QC 4L2YA 3N9YC 1E0ZA 4IG7B 2SEBD 1RRBA 2LASA 1XXGA 5LXHA 1N6ZA 1EM7A 5E6PA 2KWDA 2MBEA 2XN9C 2KQ4X 4HKQA 4M01A 1HZ6A 1BT0A 3W5UB 2JUOA 3ZDMC 3W1SC 2JSVX 2OOBB 3P63A 4FHKA 4LCDE 4H2AA 1T5XD 2WDRB 1RYJA 2FCSA 4K7UA 4K81A 3RD2A 3UQBA 4DHJB 2ICIA 1D5ZC 3Q2AC 3X23A 4ANVA 1FRRA 1FNUA 1ET9A 4A55A 3WANA 1WRDB 4RM8A 2J4XA 1EF5A 1VZ7A 5AZHA 1HE8A 1YJ1A 2DZKA 4KGRA 5BMGA 3ZUNA 3Q8CA 2UYZB 5DPWA 2H88B 2FIFA 4NNJB 2SAKA 4N59A 5HFYA 5MPOA 3R7QA 5JXVA 4LNKA 4LDTB 2N4FA 4HDQA 1V2YA 3ZJVA 1UH6A 4X57B 1L6VA 5LXIB 4I6PA 2LVQA 3VUWA 2KDMA 2M17A 1R4NI 5G5GA 1AARA 4UDUC 2K8BA 4US9A 3FKYA 2WYQA 4W9EA 3P2BA 1J8CA 1SSNA 1GNUA 2L00B 3W9CB 2LEKA 1QILA 3S2AA 3NUHB 4AWJA 4W9CA 2N9XA 1V5OA 4MGZE 5C23A 3ZTCA 1YX5B 1G6JA 3WCQA 2KC2A 1QT9A 2KFKA 2LVOA 1F52A 1RLFA 4XX5A 3ZJTA 3OJ4B 3AEBB 4NY0A 2HTHA 4MM3A 2NBVB 2MWSB 2NTSA 2PVGC 2WX1A 2LJIA 3A1QA 2KX0A 1IUEA 2KJHB 1ZOYB 2KDEB 2WQYB 1JWSD 4MDKE 2LRUA 3DVNV 2KWUB 2C7HA 2JX5A 1TJEA 3PV1A 1SE4A 1V9JA 4GB9A 1KLGD 3KLSX 4BFRA 2YVCA 2WXJA 1TY0A 2L0TA 2O6VA 4WWOA 1UELA 3ML9A 4W9FA 4G11A 4HROA 4J3OD 4WJNA 1E9MA 2DENB 1E8YA 1E7PB 1FO4A 3BVGA 3M3JA 1FFUA 1EWYC 1FFVA 1WGKA 3I57A 1Z2MA 4KGSA 4IOIE 1BMLC 2JYTA 3RNGC 1KTKA 4PS7A 2QIEB 3RNEC 2KFJA 4M0WA 2C7NB 1ZW7A 3VQIA 3HK0A 1UZXB 3VRAB 2K3UA 4HPMB 1V97A 2YEPB 4DK5A 1PGAA 3MC0B 1TT5B 3WAMA 2JT4B 5D2MB 1YJIA 2WXGA 3IFWB 1TS2A 2WXQA 3H7PA 3M63B 2MBBB 4W9KA 2W55A 2I1KA 3DBLI 2TSSA 3U7DA 1P98A 4GIVA 2DYBA 3NVYA 2K0PA 3P4PB 3UQAA 2KANA 2D5GA 2GBNA 3VTWA 1PQSA 2EKIA 3AI5A 2N7DA 3SDLC 1U4AA 2DBYA 1YIWA 2D3CA 1FXIA 1R4MI 3SFDB 2PPHA 1QOAA 1IP9A 2BQQA 3A4SC 5TR5A 3R66C 2DZIA 3AXCA 1V81A 3ZKJC 2AQ3B 2INDC 2QMTA 2W82A 2MP2B 3PZDA 2KFKB 3C19A 4XC2A 2GMIC 2BF8B 1WM3A 2K5PA 3PREA 2Y5CA 3O13A 2J52A 1B1ZA 3PRMB 3A1QB 4F8CB 4NJ6A 3ZVVA 1I4RA 2EELA 2IZVB 4S0RA 3AE1B 1L6UA 3HUIA 2MEKA 3N1XC 2LZ6A 2KWVB 1WJ6A 1V1OA 1I42A 4W9LA 2BWFA 1L7YA 2RD0A 2B76B 4FULA 3LJ3A 3WALA 1A5RA 2FAZA 3H6NA 4KZCA 1IGCA 3U2SC 2ZPNA 3JSVA 4MSMB 2N9LA 4AJYB 4A8XC 5G55A 3B1LX 1WMHB 3DBRI 4IM3A 1TKYA 4G3XB 5AZFA 1XD3B 3H9DA 2WS3B 3DHIC 3M62B 2KD0A 1KH0A 4M0WB 3U30A 2LXCA 3Q8BA 4RMAA 4IWQA 3O65B 3TEYA 1V1PA 4KSLC 3ZNGC 3ZYYX 4FLHA 5JHBA 4IWOA 1MVKA 4XDCA 1FPYA 2BVCA 2I38A 4REZA 1YQ3B 3QK0A 3PLUA 3BY4B 3QCAA 3H7PB 1FD6A 2ZNVB 1PGXA 3AV8A 3AU4A 4IM2A 1VCBA 2C9WB 2ZCCA 3NZ3A 1E5WA 3C0RB 3HRDD 3I3TB 1LO5D 4LNIA 3CMMB 5E6OA 4HDOA 1LM8B 4EKUA 2GBMA 3DHHC 4J6IA 5IOIA 1WM2A 4EUTA 3V61A 4W9HA 4TMAB 3P42A 4RCOA 2WXNA 4AS1A 3RN9C 3V3XA 3A9KA 4W9GA 5CX3A 3AU5A 4GN1A 2AQ2B 4LJPB 4B0EA 1T3QA 3EGRA 3SFEB 1YQ4B 1EO6A 4PS8A 1ACCA 3P4SB 4K7SA 2NPTB 3QA8A 3Q8FA 1RFKA 3VUYA 4FJZA 2IYDB 4IUMB 1ZUD2 2BB5A 1EU4A 4RM9A 4WJPA 2FE8A 3R8BA 2GB1A 3GE3C 4L1BA 2G4DB 4II3B 2HE7A 3P1MA 1C3TA 2J0MA 2KQSA 3AE2B 1CQVA 1DOYA 2KT7A 2B3AA 3PTFC 2OHFA 3U7ZA 1C4AA 2ZEQA 5H92C 3CSTA 2J0KA 2NCNA 2MSED 3BYTB 1HZ5A 2KTFA 1QOBA 2PE9A 1LFDA 1V5TA 4L23A 4DBGA 2LHDA 5FK9C 1E90A 1L2NA 3MC8A 1QLBB 1NDDA 1PYWD 3DQVA 3JSVB 4JIOU 4GOCA 2KQ7A 3HVDA 1IBXB 2JYEA 3MJWA 2WXPA 2NTTA 2N9KA 4OVZA 3B9JA 2KK8A 2IPKD 4PYUA 3ENEA 3EUB2 1DGJA 2WP9B 4N58A 3UF8A 2BWES 2MBHA 3EC8A 4TQ1A 3RT3B 1MHHE 5CTRC 4TKNA 1PUTA 2JY6A 3RFZB 1I35A 1V1PB 2M8SA 3I9V1 3V6EB 3QAQA 2DHZA 4YSXB 4LTUA 2M4NA 2NBUA 1F2RC 2IBIB 3MJ5A 1K50A 1SIFA 3GZNB 2WX0A 5LNK1 3ALBA 2MLBA 4GXBA 4OW0A 4FA6A 3N3KB 4HCPB 2E6XA 2HTME 3PHWB 5BYRA 2PKOA 2MBOA 2AX5A 3GE8C 2ZJDA 2ZVNA 2BYFA 3PHXB 2AL6A 3Q3OC 3IT6B 4C4VA 4XZ4A 2J0JA 3A9KB 2BTEA 1VRAB 1RM6C 2INNE 4EE2A 3JW0X 1QF6A 2DZJA 4IW0A 2FCNA 3M95A 2IGGA 1EF1A 1LQBA 2ZVOA 3BZDB 4ICVA 3R2TA 3ONSA 2M0XA 1C1YB 1MJDA 3APFA 2DNFA 4XDDA 1A70A 3VUXA 2YEPF 2KVRA 3IAS1 1TIFA 1Q10A 1ROEA 1ZDXA 3DOWA 5C3JB 2LGXA 3NRZA 1WZ0A 1SE9A 3QHTA 4P7IA 1XCQL 4ZRIA 3ZQ4A 3TUOA 3BVZA 4WWMA 3UI3A 3AEGB 4P1BC 1TS5A 2G4SA 2CJNA 1E8ZA 1P7EA 1JWUD 1WR1A 1WXMA 5BMHA 1WX7A 1E7UA 2XEWA 4YWGG 1FNVA 1JRUA 2JZPA 4HPLB 3W5VB 4E3CA 2JPHA 2VH1A 2UU7A 2CHXA 5IKCM 3PVLA 2RDHA 1R4NB 2X8XX 2HDEA 1EUVB 4KSKC 1TKEA 2PLPA 2WXMA 4XWWA 4WJQA 2QHOA 1GB4A 3APCA 1SJED 2L83A 3E9SA 3AB5A 1K53A 3L13A 2LJ5A 1UGJA 2QSDA 1FIQA 3AE9B 2XNAC 5GMVA 2QCZA 3NS8A 1HTOA 5CHFA 2DAJA 3RNBC 2D3AA 1Q1OA 3TJPA 4MGKE 1GOZA 3IXSA 4MSQB 2MCNB 4P1CC 4KVGB 3RULA 3VRBB 2KO3A 1JWAD 3NY5A 1I4HA 2JXTA 3N30A 3CWIA 4NAWB 2FNJB 1BXTA 2L32A 2M19A 4C56C 2LGSA 4IDIA 3RNCC 4C4VB 3CSFA 2MQJA 4N9F4 3IG3A 4AUQC 3AE4B 2CR5A 2MP2A 4AP4C 2KACA 4K3BA 3ECIA 1PDXA 4YL8A 2KJRA 4A3PA 4A90A 1C77A 4AQ7A 4WAFA 1MI0A 3Q3NC 1MFWA 3RNAC 2JZZA 3VAWA 4NZLB 2WDVB 3AEAB 1MG8A 1C9FA 2PTLA 4BBNF 4FJYA 1EWCA 4JLCA 4RGNA 4HJKA 3VTUA 2YLMA 1Z5SB 2QEJC 1C4PA 2W3RA 3ZW3A 1WFYA 3AE3B 1KM7A 3UIPB 4MT5A 4HLEA 4YTNB 2XK5A 3QWZB 3VH3B 3URYA 3ZNID 1EU3A 1UUPA 3ZLZA 1SE3A 5LLIA 3ML8A 1RAXA 3QARA 1WMHA 2KKCA 3NVZA 3FAHA 1FRDA 4M8MA 5TSSA 4HVBA 1S3SG 2LMCA 4OZBA 3DBLB 1WF9A 5C2TB 3AEEB 3OG5A 1T0YA 3D32A 2BS3B 1E10A 1UBIA 3FILA 3WAOA 1QZEA 3AM9A 2I1JA 3TBLD 1R4MB 5HKHA 2K9XA 3AE7B 3Q69A 4HCNB 3N1ZC 1J0GA 1NYQA 4YSZB 4WH4A 2HJ1A 4LNNA 4XE0A 4BVUC 4FHJA 2DLBA 3HM3A 1KLUD 1C79A 3NJTA 3Q3JA 5DCNA 2W9NA 3KWLA 1SB3C 3DBHI 2J53A 4KGTA 1D5XC 2RDBC 4NAMA 3NS1A 4RGOS 3ZNZB 1FCCC 1NI3A 3ZJUA 2OJRA 4LNOA 4YTPB 4NJ7A 5H8YE 4I6NB 2KOXA 5G5HA 1I4XA 2WXFA 1K52A 4XYCA 1FNWA 2FUHB 2IO0B 2ZNVC 2D10A 2NPTA 1PGBA 1M4VA 3ZTDA 1KF6B 2KDIA 3ZRFA 4TUUA 2L76A 3RZFA 4LLGM 2Y5PA 1L0VB 4GGQA 2BW2A 2V9HA 4KV2A 3L4PA 1WGYA 5D94A 3RI7C 1SXTA 1HXYD 1P9DU 4WIPA 4ASWC 2BS2B 3EHVA 3DBRB 1GG3A 3MC9A 2WDQB 4CYEA 2IO3B 4OZAA 3DVGX 1QQRA 1ENFA 3DCGA 5AUKA 2IO1B 4TSSA 2ZCBA 1V8CA 3H1UA 1T0RC 2XK5B 1KOTA 2IO2B 2N7JA 3RUIB 1JMLA 3I63C 3VR9B 2C60A 1UNSA 5J18A 4WJOA 1IBXA 4KKIA 1ZPSA 2VZKD 2BGFA 2CU1A 3EA6A 1GAQB 2WHIA 4G0NB 2INPE 2A5UA 2X38A 5GXGB 4EZLA 1WSPA 2ONQA 2RMMA 4JWUC 3QX1A 2MBQA 1E8WA 3RPFC 3DBSA 3FILB 1CZPA 1JQ4A 2OEDA 5C1ZA 3GP7A 3P4QB 1GPXA 4MACA 1MHXA 4P6VF 5E6NA 4FXCA 3TEZA 2KWCA 4DWFA 1WE7A 3Q8EA 3LDZE 4W9IA 2RR9A 5IO9A 3V6CB 5T8IA 4DDGD 4KDIC 4YTMB 2RSUA 2KDBA 2WXOA 5KHOA 2PJHA 4MELA 1IGDA 4QAYA 4ZRQA 2RPQA 3TEWA 1SIJA 1YNTE 2L3ZA 3ZNHB 4BKSD 1NBFC 4BKGA 1GC7A 2DAFA 3JVZX 3OAWA 4GSWA 2FBWB 3TCAA 3W2DA 1YQBA 1SF0A 3SHQA 4P16A 1YN3A 1ZKHA 3DWGC 5D7GA 4LJOB 2RGFA 3KVFB 2N1VA 4ZDVA 4ICUA 2Z8LA 1WY8A 2K39A 4IM0A 3PPAA 2BYEA 2Y5BB 1PFDA 4ACFA 4K1RB 2CKHB 3U8ZA 3N20C 4PYZA 4DXGA 2EKEC 2M0AA 1JALA 4BZAA 1N5XA 2VRRB 3AE6B 3MHZA 1WRIA 4GU2A 1F77A 3P4RB 1TGZB 3AECB 3HM6X 1D4BA 2HD5B 2OJWA 5IAAC 1J7BA 1OEYA 2MHJA 2BBCA 2LUEA 1TS4A 2WLBA 1GUAB 5CHVC 1WE6A 3APDA 3NVWA 3HVZA 4HK2A 3NVVA 4PS3A 5AZGA 1WX9A 1WGHA 1V6EA 4F7ZA 1GJZA 1WGRA 4EZKA 2PW9A 5BYQA 4R3DA 3T8MA 3IT4B 3RCZA 2IDYA 3KUCB 1IYFA 4HRSA 1WJ4A 1TYGB 2LVPA 2A4ZA 2G3QB 2D3BA 4XGAB 2C5LC 2CS4A 4WWPA 2NVUI 1WR6E 2QC8A 5JZEB 3PGEA 2PEAA 1OQRA 1B9RA 4ZRKA 1XLQA 2V3PA 2KNBA 1XLOA 1HTQA 2KVZA 2BKRB 4WAAA 3DDCB 4IKGA 1ZDVA 4HKZE 1R7SA 2DYOA 1JCKB 5BMIA 4II2B 3VHTC 5J2RA 1HEZE 4GDLA 1N5WA 5FR3A 5JH5C 1MG4A 2R61A 2MJDA 5I4DA 3VFKA 3BINA 1V80A 4NAWA 2D3GA 1XF5L 4B95A 4MH0E 3W1YA 3QC8B 2I2YA 1VJKA 4ANXA 4JE3B 1Y56A 5HHDG 4MEMA 2D11A 4EFOA 3ZDTA 2K6DB 3NZUA 5DPTA 3TIXA 1ET6A 4M00A 2ZPYA 2N0SB 1P7FA 4DQOC 4WQMA 4K7WA 3MP9A 3Q8AA 4RGMA 2KMMA 4MGYE 1F9JA 4ZRPA 4K3CA 1N62A 2K8HA 3T9LA 2E3TA 3N32A 2MX2A 5BO4B 4MH8A 2BPSA 2INCC 4DHZB 1TZOA 3L54A 1VLBA 2L8JA 3IHPC 1E7VA 1JW9D 1AW7A 2KN5A 4HJGE 1J7CA 3W1SA 5D3IB 2IY0B 2O2VA 2KYWA 1I4GA 2KN4A 3DVNU 2JQRB 4YSYB 2REXA 1FXAA 2LI5A 1T6BX 2BT6A 2WU2B 3PS6A 2W3SA 4GMVA 3PZ7A 3RMKC 3CIRB 2GOWA 3TL5A 1NI2A 1TKGA 1ZP0B 1FXTB 1FM0D 2ACZB 3VR8B 1DYQA 4OZCA 2WXLA 4BOSC 4C00A 1QKZA 3KH0A 4M8NA 1HQRD 3AEFB 2GRIA 5AEKB 4RFBA 4HPPA 4BAXA 4Q2JA 2GLSA 4E74A 1OQYA 4GDKA 3ZIMA 3LXFA 3NG0A 4YT0B 4E71A 3PLVA 1TTNA 2EMTA 4ARIA 2QILA 1XCTL 1AWDA 2WWZA 2BYTA 4M02A 4B9KA 2LRWA 4NQLB 1N63A 2KMAA 2R2OA 2LGIA 2IJ0A 2UWQA 3AULA 4GDLB 4CQNA 3ZO5B 3I5JC 1WX8A 4W9DA 1H8CA 3MTNB 1F2RI 2H89B 2WXRA 5IA7A 1P1AA 1LXDA 1RFAA 1UGMA 4B0MA 3AMZA 5AUIA 1S1QB 2KJ6A 2CU3A 4IC7B 2DYMA 4LK0M 3GS2A 2L05A 4ARCA 4C80A 4BKTA 2DWQA 3PZ8A 1I7HA 3IAM1 2AYOB 2K1FA 2G1EA 1XT9B 4RF1A 1JWBD 4JQWC 1FEHA 1N61A 2GBKA 2ZZPB 1HA5A 3BYYB 1C4CA 2WU5B 2Z59B 4WQOB 2LFIA 5G2NA 4JGHB 4OVUA 5EE0A 3SR6A 2GI9A 5EE3A 1UD7A 4ANWA 1WYGA 3ZRCA 1WI0A 3R2IA 4A6QA 1XLNA 4RF0A 4HWIB 3K9OB 1NEKB 2KXJA 4IWPA 4LNFA 3CF6E 2O2VB 2ASQA 3AE8B 2J42A 4KIKA 4DHZE 4FJVB 2ZW0A 3KUZA 2V1YA 4TV3A 3RNFC 1VR9A 4D2KA 2KDFB 1RWSA 2KAJA 3WA0A 3AN1A 2JXXA 5HG2A 3OWEB 2RPVA 1SJHD 3EECA 2DX5B 5JHAA 1F1HA 3U52E 2KLGA 3SEBA 3QQ8B 4C7YA 3L10B 4YXDB 3L16A 1XO3A 1DOIA 4HEA1 5IP4D 1E6EB 3DPDA 3PO0A 4ZRJA 3BWUD 2JU6X 3C8YA 4PK1A 3DBHB 4NPNA 1TZ1A 2K22A 4OHJA 1Y8RC 3NZSA 2AWTA 4FN2A 3R7RA 2O6VD 2JWZA 1V86A 3SD5A 3AEDB 4RNAA 4GDKB 1QOFA 1YMHE 3R3MA 1JWMD 3K9PB 1C78A 2NS5A 3TSSA 5J17A 1F0ZA 1SBBB 3GB1A 1P0RA 2LXAA 3VDZA 3VTVA 1OGWA 3VVWB 3HIZA 2L1AA 2JWUA 2GBJA 4JL9A 2LD9A 4USAA 3AE5B 3L17A 3V05A 1J19A 1QOGA 2WDTB 2VH2A 3L0WB 2C7MB 2WGSA 4AJWA 2NR2A 1UBQA 1YN4A 4XWTA 2LWPA 3BK2A 4A20A 4BBNC 2PE6B 4F1SA 1T0SC 1AYFA 1H4RA 1WIAA 2WXIA 4JX1C 3HHMA 4URKA 2LGDA 4KKJA 4O1NA 2AQ1B 1BUIC 4MGIE 3BK1A 1SGHA 4CHKA 5IN7A 2MW5A 3EFUA 3UGBB 2JVCA 2KMCA 3NHEB 2MJ3A 4PT5A 4KDLB 5DPSA 3JYUA 4ZOHC 2G45B 1P3QU 3AH7A 1WH3A 4ZYSA 2IGDA 3X0WA 4DXAB 1WWTA 4MM3B 3ZGZA 3GOEA 3KYDD 3A9JA 3T3NA 3PRPB 1KFYB 3A33B 4KIKB 4RH6A 2HJ8A 1Q5WB 1E8XA 2CHZA 4FBJB 3B2GA 1KRHA 3DHGC 3MFGA 3Q3FA 2V3NA 3QJZA 1I4QA 4ANUA 2LGYA 2R2QA 1XLPA 2FCQA 2K8CA 2O6VB 3L08A 2DZMA 3LB8C 1XEEA 2BKFA 1WZ3A 2PIAA 1D6EC 4FADA 4W9JA 1L4DB 3WAPA 1WYWB 2W54A 2MJEA 3U4EG 1YD8U 1NENB 2K6QA 3ZXVA 4CO7A 2LUMA 1UWXA 1XQQA 5BYSA 1IPGA 1STEA 1FMAD 3TMPB 4EZJA 2KZRA 3ETRA 1Q0WB 4DXFA 4US8A 4ZHPA 4BKSA 5L83A 1KJTA 1UWMA 3BVMA 1WXSA 1ZGUB 3EFCA 1YOVB 2J7QB 2L7RA 2JZ3B 1ZE3D 2KC1A 3IBEA 4A9AA 1M94A 1L0YB 3V60A 2CJOA 1GC6A 1SE2A 4MJSA 1C76A 3B2FA 4JPSA 5FR6A 5E6JA 2NBWB 4G50A 3E56A 2KX3A 1FCLA 2GBRA 2JRHA 4C7ZA 3Q14C 2M1MA 3PRZA 1D3ZA 1VZ6A 3KW5B 2V3SA 2Y3AA 2N9PC 5D3DA 4NQKE 1OQQA 2CHWA 3ZXRA 1DOXA 1YN5A 1CJEA 2WNMA 3UIOB 3A4RA 2N1WA 3ABVB 1SEBD 4I6LB 3KWVA 2KTRA 1TY2A 1KLVA 1VZ8A 2BS4B 2MH7A 2MA9B 3TEXA 4N6EB 3A9JB 5HI1A 3PT2B 1VDVA 2L0FA 3N1YC 2K25A 2ZW1A 1ISNA 2VZKB 4ZYNA 3OLMD 5EDSA 2ON8A 5EE1A 3DWMA 1D5MC 4ZHOA 3J9CA 3Q6BA 1K8RB 1WGGA 1NVID 2D2QA 2Q5WD 2AL3A 3OJ3A 1OTRB 5DPRA 3UINB 2LHEA 3QIJA 2JF5A 3B0AA 2N7EA 2WXKA 2L52A 4WWNA 1ZXHA 1L4ZB 2M56B 3Q3MC 3H7SA 3KYCD 4NJCA 1WXVA 1TBEA 2PVOD 2IY1B 4GLSC 1JRPA 1ZXIA 4WURA 4RGTA 2EMSA 1WJNA 2AEHA
chains in the Genus database with same CATH topology
1WJUA 4RMAA 4IWQA 5D6JB 3O65B 2I1JA 4KSLC 3TBLD 3IVFA 2WWZA 3ZNGC 5HKHA 2FCMA 4FLHA 4B6WA 4DHJD 5JHBA 1X1MA 4IWOA 2LRWA 4B9KA 4NQLB 4HCNB 2XBBC 1J0GA 2KMAA 4HXDA 2BYVE 2R2OA 2UWQA 3AULA 3UQBA 4GDLB 4BVUC 3ZO5B 3QK0A 4FHJA 3PLUA 2FIDA 3PSEB 3HM3A 2V4LA 1WX8A 3BY4B 3QCAA 4W9DA 3H7PB 2KLCA 2ZNVB 2N9EB 3Q3JA 3AU4A 1H8CA 4IM2A 2MRPA 5DCNA 1VCBA 2C9WB 2W9NA 3DBHI 3MTNB 2ZCCA 4MJSB 1E5WA 3C0RB 3I3TB 5IA7A 1P1AA 4A3OA 1LXDA 4LDTD 3CMMB 5E6OA 4HDOA 1RFAA 1LM8B 4EKUA 1UGMA 2GBMA 3ZNZB 2OJRA 4J6IA 3VH4B 4NJ7A 1CMXB 4I6NB 4TQ0A 1WM2A 2Z0EB 4KZ0A 1S1QB 2KOXA 4EUTA 4EEWA 2KJ6A 3DVGY 4OVVA 4W9HA 3V61A 4IC7B 2DYMA 2JRIB 4EOYA 2L05A 3VXWA 4BKTA 2FUHB 5L95C 2IO0B 2ZNVC 3A9KA 4W9GA 5CX3A 1WGDA 3SU8X 2D10A 2AYOB 2K1FA 4AOFA 1V49A 1XT9B 3AU5A 4GN1A 4JQWC 2NPTA 4LJPB 3V62A 2GBKA 4DDID 2ZZPB 1EO6A 4PS8A 3ZTDA 1VD2A 3GZNI 4K7SA 2KDIA 3MHSD 4TUUA 3ZRFA 2L76A 2Z59B 4WQOB 3RZFA 2NPTB 5G2NA 4BOZB 3QA8A 2KHWB 4JGHB 2D07B 4OVUA 3VUYA 4FJZA 2IYDB 1YX6B 1UD7A 3WIMA 4GGQA 4IUMB 3KUDB 4ANWA 4KV2A 4WJPA 4RM9A 3B08A 3RYTA 1WGYA 5D94A 2Z0DB 1WXAA 3ZRCA 1P9DU 4ASWC 1WI0A 1OEYJ 2G4DB 3EHVA 2HE7A 4II3B 1C3TA 4HWIB 2KTRB 1GG3A 3K9OB 3RZWC 2J0MA 2KQSA 4CYEA 2KXJA 3NOBA 4IWPA 5CHWA 2IO3B 3CF6E 3DVGX 5KHQA 2O2VB 2ASQA 4KIKA 4DHZE 2B3AA 3DCGA 3PTFC 4FJVB 2IO1B 4IG7B 3KUZA 2V1YA 4TV3A 2ZCBA 1RRBA 2LASA 2ZEQA 3CSTA 5LXHA 3H1UA 2J0KA 2XK5B 2NCNA 1KOTA 2IO2B 2KDFB 3WA0A 2MSED 2JXXA 5E6PA 2KTFA 3RUIB 2PE9A 3EECA 2MBEA 1LFDA 2DX5B 1V5TA 4DBGA 5JHAA 2C60A 2KLGA 5J18A 3QQ8B 1E90A 1L2NA 4WJOA 1BT0A 1NDDA 3L10B 2JUOA 3ZDMC 3W1SC 3DQVA 3L16A 3JSVB 4JIOU 4GOCA 2KQ7A 2OOBB 2BGFA 3DPDA 2CU1A 3MJWA 4FHKA 4LCDE 4ZRJA 4NPNA 1TZ1A 2FCSA 4K7UA 4G0NB 4K81A 3RD2A 2A5UA 1Y8RC 4EZLA 3NZSA 2AWTA 4FN2A 3R7RA 4DHJB 3X23A 2O6VD 4ANVA 3QX1A 2JWZA 2KK8A 2MBQA 1V86A 1E8WA 3ENEA 4PYUA 3SD5A 3DBSA 4GDKB 3WANA 3UF8A 2BWES 2MBHA 1WRDB 3EC8A 3R3MA 4TQ1A 4RM8A 3RT3B 3K9PB 1EF5A 5AZHA 5C1ZA 1HE8A 1YJ1A 2DZKA 5CTRC 3ZUNA 2NS5A 4TKNA 5J17A 2JY6A 2UYZB 5DPWA 2FIFA 1I35A 4NNJB 2M8SA 5E6NA 2KWCA 1P0RA 3V6EB 2LXAA 3VDZA 4DWFA 1WE7A 3VTVA 3LDZE 1OGWA 3QAQA 4W9IA 3R7QA 2DHZA 2RR9A 3V6CB 4LDTB 4DDGD 2N4FA 3VVWB 3HIZA 4KDIC 4HDQA 2GBJA 4JL9A 2M4NA 2RSUA 2NBUA 2LD9A 2IBIB 2KDBA 1V2YA 1UH6A 4X57B 5KHOA 3L17A 1SIFA 1J19A 2PJHA 4MELA 2WDTB 2WX0A 5LXIB 4I6PA 2LVQA 3ALBA 3VUWA 2MLBA 2RPQA 3L0WB 2C7MB 4AJWA 2L3ZA 3ZNHB 4BKSD 4GXBA 2NR2A 4FA6A 1NBFC 2M17A 3N3KB 1UBQA 4BKGA 1GC7A 2DAFA 2LWPA 4A20A 4HCPB 4BBNC 2PE6B 1R4NI 3JVZX 3OAWA 4F1SA 1AARA 1H4RA 2K8BA 4GSWA 3PHWB 1WIAA 3TCAA 1YQBA 2MBOA 2ZJDA 2WYQA 4W9EA 3HHMA 3SHQA 4URKA 2ZVNA 2BYFA 3PHXB 2AL6A 2LGDA 3P2BA 1J8CA 1ZKHA 5D7GA 1GNUA 2L00B 4LJOB 2RGFA 4MGIE 3KVFB 2N1VA 4ZDVA 4ICUA 1SGHA 4CHKA 4XZ4A 1WY8A 2J0JA 3S2AA 2MW5A 4AWJA 3EFUA 3UGBB 3A9KB 4W9CA 2JVCA 2N9XA 2KMCA 3NHEB 2K39A 1V5OA 4IM0A 4MGZE 3JW0X 3PPAA 2BYEA 2Y5BB 5C23A 1YX5B 3ZTCA 4KDLB 5DPSA 4K1RB 1G6JA 2DZJA 4IW0A 2FCNA 3JYUA 2CKHB 3M95A 2KC2A 2KFKA 2LVOA 1RLFA 2G45B 1P3QU 3OJ4B 4PYZA 4XX5A 3U8ZA 2EKEC 4NY0A 1EF1A 1LQBA 1WH3A 2ZVOA 2VRRB 2HTHA 4ICVA 4GU2A 4MM3A 2NBVB 2MWSB 3U30A 1TGZB 3HM6X 2M0XA 2WX1A 3ONSA 3X0WA 4DXAB 2HD5B 1C1YB 3A1QA 5IAAC 1OEYA 2KX0A 2KJHB 3APFA 2LUEA 2KDEB 3GOEA 3KYDD 3A9JA 4MDKE 3VUXA 2KVRA 1GUAB 2LRUA 3DVNV 3PRPB 2KWUB 3A33B 2C7HA 4KIKB 2HJ8A 1Q5WB 3PV1A 5CHVC 1E8XA 1WE6A 2CHZA 3APDA 4FBJB 1V9JA 4GB9A 3DOWA 2LGXA 4HK2A 1WZ0A 4BFRA 2YVCA 1SE9A 3QHTA 4PS3A 4P7IA 4ZRIA 5AZGA 1WX9A 1WGHA 1V6EA 2L0TA 2O6VA 4WWOA 4F7ZA 3Q3FA 1GJZA 1WGRA 1UELA 3QJZA 4EZKA 4ANUA 3ML9A 4W9FA 4G11A 2G4SA 2LGYA 3T8MA 2R2QA 4WJNA 1E8ZA 2FCQA 2K8CA 2O6VB 2DENB 3L08A 1E8YA 2DZMA 3RCZA 3KUCB 1WR1A 1WXMA 2BKFA 1WZ3A 1WX7A 1E7UA 1IYFA 4FADA 1WJ4A 3M3JA 4W9JA 1WYWB 2LVPA 2A4ZA 2XEWA 3WAPA 1YD8U 1JRUA 2G3QB 2C5LC 2CS4A 2K6QA 4HPLB 1Z2MA 2NVUI 4WWPA 4E3CA 2JPHA 1WR6E 5JZEB 2CHXA 3PGEA 4CO7A 1XQQA 2PEAA 3PVLA 4ZRKA 4PS7A 1IPGA 3TMPB 4EZJA 1EUVB 4KSKC 2KNBA 2KZRA 2KFJA 1Q0WB 4WJQA 2C7NB 2QHOA 2BKRB 1ZW7A 3VQIA 4BKSA 5L83A 1KJTA 4WAAA 3DDCB 3APCA 3HK0A 1WXSA 1UZXB 1ZGUB 2J7QB 2DYOA 2L7RA 3L13A 2JZ3B 2LJ5A 4HPMB 2KC1A 4II2B 3VHTC 3IBEA 4DK5A 5J2RA 3WAMA 4GDLA 1M94A 5GMVA 2JT4B 5D2MB 5JH5C 3NS8A 3IFWB 3V60A 3H7PA 5CHFA 2DAJA 1GC6A 3M63B 1Q1OA 3TJPA 4MGKE 2MBBB 4MJSA 3VFKA 4W9KA 3BINA 1V80A 2I1KA 3DBLI 4MSQB 2MCNB 1P98A 4NAWA 3U7DA 5FR6A 2D3GA 4GIVA 4KVGB 2DYBA 3RULA 4B95A 2KO3A 4MH0E 2NBWB 3NY5A 3W1YA 3QC8B 3N30A 4G50A 4ANXA 3UQAA 2KX3A 4MEMA 2KANA 2GBRA 2JRHA 2GBNA 4NAWB 3VTWA 1PQSA 2D11A 3AI5A 2FNJB 4EFOA 2N7DA 3SDLC 3ZDTA 1U4AA 2K6DB 3NZUA 2M1MA 5DPTA 3TIXA 1YIWA 3PRZA 1D3ZA 2ZPYA 1R4MI 3KW5B 2V3SA 2N9PC 3CSFA 2PPHA 2MQJA 4N9F4 1IP9A 3IG3A 4K7WA 4NQKE 4AUQC 2CR5A 2MP2A 3A4SC 4MGYE 2CHWA 1F9JA 2DZIA 3AXCA 3R66C 5TR5A 3ECIA 4AP4C 1V81A 3ZKJC 4YL8A 2K8HA 2KJRA 3T9LA 3N32A 2MP2B 2MX2A 3PZDA 4A3PA 5BO4B 2KFKB 4XC2A 2BPSA 3UIOB 2GMIC 3A4RA 4DHZB 2BF8B 1WM3A 2N1WA 3L54A 2JZZA 2L8JA 3IHPC 3PREA 3VAWA 1E7VA 4I6LB 3PRMB 2KTRA 3A1QB 1KLVA 2KN5A 1MG8A 3W1SA 4F8CB 2IY0B 2MA9B 4BBNF 4FJYA 2O2VA 4NJ6A 3ZVVA 3A9JB 3PT2B 2IZVB 2L0FA 4JLCA 4HJKA 3VTUA 2K25A 2YLMA 1ISNA 1Z5SB 3ZW3A 1WFYA 2LZ6A 2KWVB 1KM7A 4ZYNA 3UIPB 3OLMD 4HLEA 1WJ6A 1I42A 2XK5A 3DVNU 3QWZB 3VH3B 5EDSA 4W9LA 2BWFA 1L7YA 2REXA 3ZNID 2RD0A 2LI5A 3ZLZA 1K8RB 3PS6A 5LLIA 4FULA 1WGGA 2D2QA 3LJ3A 2AL3A 3WALA 4GMVA 1A5RA 3ML8A 3OJ3A 1OTRB 5DPRA 3UINB 1RAXA 2FAZA 2GOWA 3H6NA 1WMHA 3QIJA 3QARA 4KZCA 3TL5A 2JF5A 1NI2A 3B0AA 2ZPNA 3JSVA 1FXTB 2N7EA 4MSMB 2KKCA 4AJYB 4BOSC 5G55A 4WWNA 3B1LX 1WMHB 3DBRI 3KH0A 4M8NA 4M8MA 4IM3A 4G3XB 5AEKB 4HVBA 3H7SA 1XD3B 1S3SG 5AZFA 3KYCD 3H9DA 1WF9A 1WXVA 1TBEA 4E74A 2IY1B 1T0YA 1OQYA 3D32A 4GDKA 3ZIMA 1UBIA 3M62B 2KD0A 4E71A 3WAOA 3PLVA 1QZEA 1TTNA 2EMSA 2LXCA 4M0WB 1WJNA 2AEHA 2EMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJU A;  4RMA A;  4IWQ A;  5D6J B;  3O65 B;  2I1J A;  4KSL C;  3TBL D;  3IVF A;  2WWZ A;  3ZNG C;  5HKH A;  2FCM A;  4FLH A;  4B6W A;  4DHJ D;  5JHB A;  1X1M A;  4IWO A;  2LRW A;  4B9K A;  4NQL B;  4HCN B;  2XBB C;  1J0G A;  2KMA A;  4HXD A;  2BYV E;  2R2O A;  2UWQ A;  3AUL A;  3UQB A;  4GDL B;  4BVU C;  3ZO5 B;  3QK0 A;  4FHJ A;  3PLU A;  2FID A;  3PSE B;  3HM3 A;  2V4L A;  1WX8 A;  3BY4 B;  3QCA A;  4W9D A;  3H7P B;  2KLC A;  2ZNV B;  2N9E B;  3Q3J A;  3AU4 A;  1H8C A;  4IM2 A;  2MRP A;  5DCN A;  1VCB A;  2C9W B;  2W9N A;  3DBH I;  3MTN B;  2ZCC A;  4MJS B;  1E5W A;  3C0R B;  3I3T B;  5IA7 A;  1P1A A;  4A3O A;  1LXD A;  4LDT D;  3CMM B;  5E6O A;  4HDO A;  1RFA A;  1LM8 B;  4EKU A;  1UGM A;  2GBM A;  3ZNZ B;  2OJR A;  4J6I A;  3VH4 B;  4NJ7 A;  1CMX B;  4I6N B;  4TQ0 A;  1WM2 A;  2Z0E B;  4KZ0 A;  1S1Q B;  2KOX A;  4EUT A;  4EEW A;  2KJ6 A;  3DVG Y;  4OVV A;  4W9H A;  3V61 A;  4IC7 B;  2DYM A;  2JRI B;  4EOY A;  2L05 A;  3VXW A;  4BKT A;  2FUH B;  5L95 C;  2IO0 B;  2ZNV C;  3A9K A;  4W9G A;  5CX3 A;  1WGD A;  3SU8 X;  2D10 A;  2AYO B;  2K1F A;  4AOF A;  1V49 A;  1XT9 B;  3AU5 A;  4GN1 A;  4JQW C;  2NPT A;  4LJP B;  3V62 A;  2GBK A;  4DDI D;  2ZZP B;  1EO6 A;  4PS8 A;  3ZTD A;  1VD2 A;  3GZN I;  4K7S A;  2KDI A;  3MHS D;  4TUU A;  3ZRF A;  2L76 A;  2Z59 B;  4WQO B;  3RZF A;  2NPT B;  5G2N A;  4BOZ B;  3QA8 A;  2KHW B;  4JGH B;  2D07 B;  4OVU A;  3VUY A;  4FJZ A;  2IYD B;  1YX6 B;  1UD7 A;  3WIM A;  4GGQ A;  4IUM B;  3KUD B;  4ANW A;  4KV2 A;  4WJP A;  4RM9 A;  3B08 A;  3RYT A;  1WGY A;  5D94 A;  2Z0D B;  1WXA A;  3ZRC A;  1P9D U;  4ASW C;  1WI0 A;  1OEY J;  2G4D B;  3EHV A;  2HE7 A;  4II3 B;  1C3T A;  4HWI B;  2KTR B;  1GG3 A;  3K9O B;  3RZW C;  2J0M A;  2KQS A;  4CYE A;  2KXJ A;  3NOB A;  4IWP A;  5CHW A;  2IO3 B;  3CF6 E;  3DVG X;  5KHQ A;  2O2V B;  2ASQ A;  4KIK A;  4DHZ E;  2B3A A;  3DCG A;  3PTF C;  4FJV B;  2IO1 B;  4IG7 B;  3KUZ A;  2V1Y A;  4TV3 A;  2ZCB A;  1RRB A;  2LAS A;  2ZEQ A;  3CST A;  5LXH A;  3H1U A;  2J0K A;  2XK5 B;  2NCN A;  1KOT A;  2IO2 B;  2KDF B;  3WA0 A;  2MSE D;  2JXX A;  5E6P A;  2KTF A;  3RUI B;  2PE9 A;  3EEC A;  2MBE A;  1LFD A;  2DX5 B;  1V5T A;  4DBG A;  5JHA A;  2C60 A;  2KLG A;  5J18 A;  3QQ8 B;  1E90 A;  1L2N A;  4WJO A;  1BT0 A;  1NDD A;  3L10 B;  2JUO A;  3ZDM C;  3W1S C;  3DQV A;  3L16 A;  3JSV B;  4JIO U;  4GOC A;  2KQ7 A;  2OOB B;  2BGF A;  3DPD A;  2CU1 A;  3MJW A;  4FHK A;  4LCD E;  4ZRJ A;  4NPN A;  1TZ1 A;  2FCS A;  4K7U A;  4G0N B;  4K81 A;  3RD2 A;  2A5U A;  1Y8R C;  4EZL A;  3NZS A;  2AWT A;  4FN2 A;  3R7R A;  4DHJ B;  3X23 A;  2O6V D;  4ANV A;  3QX1 A;  2JWZ A;  2KK8 A;  2MBQ A;  1V86 A;  1E8W A;  3ENE A;  4PYU A;  3SD5 A;  3DBS A;  4GDK B;  3WAN A;  3UF8 A;  2BWE S;  2MBH A;  1WRD B;  3EC8 A;  3R3M A;  4TQ1 A;  4RM8 A;  3RT3 B;  3K9P B;  1EF5 A;  5AZH A;  5C1Z A;  1HE8 A;  1YJ1 A;  2DZK A;  5CTR C;  3ZUN A;  2NS5 A;  4TKN A;  5J17 A;  2JY6 A;  2UYZ B;  5DPW A;  2FIF A;  1I35 A;  4NNJ B;  2M8S A;  5E6N A;  2KWC A;  1P0R A;  3V6E B;  2LXA A;  3VDZ A;  4DWF A;  1WE7 A;  3VTV A;  3LDZ E;  1OGW A;  3QAQ A;  4W9I A;  3R7Q A;  2DHZ A;  2RR9 A;  3V6C B;  4LDT B;  4DDG D;  2N4F A;  3VVW B;  3HIZ A;  4KDI C;  4HDQ A;  2GBJ A;  4JL9 A;  2M4N A;  2RSU A;  2NBU A;  2LD9 A;  2IBI B;  2KDB A;  1V2Y A;  1UH6 A;  4X57 B;  5KHO A;  3L17 A;  1SIF A;  1J19 A;  2PJH A;  4MEL A;  2WDT B;  2WX0 A;  5LXI B;  4I6P A;  2LVQ A;  3ALB A;  3VUW A;  2MLB A;  2RPQ A;  3L0W B;  2C7M B;  4AJW A;  2L3Z A;  3ZNH B;  4BKS D;  4GXB A;  2NR2 A;  4FA6 A;  1NBF C;  2M17 A;  3N3K B;  1UBQ A;  4BKG A;  1GC7 A;  2DAF A;  2LWP A;  4A20 A;  4HCP B;  4BBN C;  2PE6 B;  1R4N I;  3JVZ X;  3OAW A;  4F1S A;  1AAR A;  1H4R A;  2K8B A;  4GSW A;  3PHW B;  1WIA A;  3TCA A;  1YQB A;  2MBO A;  2ZJD A;  2WYQ A;  4W9E A;  3HHM A;  3SHQ A;  4URK A;  2ZVN A;  2BYF A;  3PHX B;  2AL6 A;  2LGD A;  3P2B A;  1J8C A;  1ZKH A;  5D7G A;  1GNU A;  2L00 B;  4LJO B;  2RGF A;  4MGI E;  3KVF B;  2N1V A;  4ZDV A;  4ICU A;  1SGH A;  4CHK A;  4XZ4 A;  1WY8 A;  2J0J A;  3S2A A;  2MW5 A;  4AWJ A;  3EFU A;  3UGB B;  3A9K B;  4W9C A;  2JVC A;  2N9X A;  2KMC A;  3NHE B;  2K39 A;  1V5O A;  4IM0 A;  4MGZ E;  3JW0 X;  3PPA A;  2BYE A;  2Y5B B;  5C23 A;  1YX5 B;  3ZTC A;  4KDL B;  5DPS A;  4K1R B;  1G6J A;  2DZJ A;  4IW0 A;  2FCN A;  3JYU A;  2CKH B;  3M95 A;  2KC2 A;  2KFK A;  2LVO A;  1RLF A;  2G45 B;  1P3Q U;  3OJ4 B;  4PYZ A;  4XX5 A;  3U8Z A;  2EKE C;  4NY0 A;  1EF1 A;  1LQB A;  1WH3 A;  2ZVO A;  2VRR B;  2HTH A;  4ICV A;  4GU2 A;  4MM3 A;  2NBV B;  2MWS B;  3U30 A;  1TGZ B;  3HM6 X;  2M0X A;  2WX1 A;  3ONS A;  3X0W A;  4DXA B;  2HD5 B;  1C1Y B;  3A1Q A;  5IAA C;  1OEY A;  2KX0 A;  2KJH B;  3APF A;  2LUE A;  2KDE B;  3GOE A;  3KYD D;  3A9J A;  4MDK E;  3VUX A;  2KVR A;  1GUA B;  2LRU A;  3DVN V;  3PRP B;  2KWU B;  3A33 B;  2C7H A;  4KIK B;  2HJ8 A;  1Q5W B;  3PV1 A;  5CHV C;  1E8X A;  1WE6 A;  2CHZ A;  3APD A;  4FBJ B;  1V9J A;  4GB9 A;  3DOW A;  2LGX A;  4HK2 A;  1WZ0 A;  4BFR A;  2YVC A;  1SE9 A;  3QHT A;  4PS3 A;  4P7I A;  4ZRI A;  5AZG A;  1WX9 A;  1WGH A;  1V6E A;  2L0T A;  2O6V A;  4WWO A;  4F7Z A;  3Q3F A;  1GJZ A;  1WGR A;  1UEL A;  3QJZ A;  4EZK A;  4ANU A;  3ML9 A;  4W9F A;  4G11 A;  2G4S A;  2LGY A;  3T8M A;  2R2Q A;  4WJN A;  1E8Z A;  2FCQ A;  2K8C A;  2O6V B;  2DEN B;  3L08 A;  1E8Y A;  2DZM A;  3RCZ A;  3KUC B;  1WR1 A;  1WXM A;  2BKF A;  1WZ3 A;  1WX7 A;  1E7U A;  1IYF A;  4FAD A;  1WJ4 A;  3M3J A;  4W9J A;  1WYW B;  2LVP A;  2A4Z A;  2XEW A;  3WAP A;  1YD8 U;  1JRU A;  2G3Q B;  2C5L C;  2CS4 A;  2K6Q A;  4HPL B;  1Z2M A;  2NVU I;  4WWP A;  4E3C A;  2JPH A;  1WR6 E;  5JZE B;  2CHX A;  3PGE A;  4CO7 A;  1XQQ A;  2PEA A;  3PVL A;  4ZRK A;  4PS7 A;  1IPG A;  3TMP B;  4EZJ A;  1EUV B;  4KSK C;  2KNB A;  2KZR A;  2KFJ A;  1Q0W B;  4WJQ A;  2C7N B;  2QHO A;  2BKR B;  1ZW7 A;  3VQI A;  4BKS A;  5L83 A;  1KJT A;  4WAA A;  3DDC B;  3APC A;  3HK0 A;  1WXS A;  1UZX B;  1ZGU B;  2J7Q B;  2DYO A;  2L7R A;  3L13 A;  2JZ3 B;  2LJ5 A;  4HPM B;  2KC1 A;  4II2 B;  3VHT C;  3IBE A;  4DK5 A;  5J2R A;  3WAM A;  4GDL A;  1M94 A;  5GMV A;  2JT4 B;  5D2M B;  5JH5 C;  3NS8 A;  3IFW B;  3V60 A;  3H7P A;  5CHF A;  2DAJ A;  1GC6 A;  3M63 B;  1Q1O A;  3TJP A;  4MGK E;  2MBB B;  4MJS A;  3VFK A;  4W9K A;  3BIN A;  1V80 A;  2I1K A;  3DBL I;  4MSQ B;  2MCN B;  1P98 A;  4NAW A;  3U7D A;  5FR6 A;  2D3G A;  4GIV A;  4KVG B;  2DYB A;  3RUL A;  4B95 A;  2KO3 A;  4MH0 E;  2NBW B;  3NY5 A;  3W1Y A;  3QC8 B;  3N30 A;  4G50 A;  4ANX A;  3UQA A;  2KX3 A;  4MEM A;  2KAN A;  2GBR A;  2JRH A;  2GBN A;  4NAW B;  3VTW A;  1PQS A;  2D11 A;  3AI5 A;  2FNJ B;  4EFO A;  2N7D A;  3SDL C;  3ZDT A;  1U4A A;  2K6D B;  3NZU A;  2M1M A;  5DPT A;  3TIX A;  1YIW A;  3PRZ A;  1D3Z A;  2ZPY A;  1R4M I;  3KW5 B;  2V3S A;  2N9P C;  3CSF A;  2PPH A;  2MQJ A;  4N9F 4;  1IP9 A;  3IG3 A;  4K7W A;  4NQK E;  4AUQ C;  2CR5 A;  2MP2 A;  3A4S C;  4MGY E;  2CHW A;  1F9J A;  2DZI A;  3AXC A;  3R66 C;  5TR5 A;  3ECI A;  4AP4 C;  1V81 A;  3ZKJ C;  4YL8 A;  2K8H A;  2KJR A;  3T9L A;  3N32 A;  2MP2 B;  2MX2 A;  3PZD A;  4A3P A;  5BO4 B;  2KFK B;  4XC2 A;  2BPS A;  3UIO B;  2GMI C;  3A4R A;  4DHZ B;  2BF8 B;  1WM3 A;  2N1W A;  3L54 A;  2JZZ A;  2L8J A;  3IHP C;  3PRE A;  3VAW A;  1E7V A;  4I6L B;  3PRM B;  2KTR A;  3A1Q B;  1KLV A;  2KN5 A;  1MG8 A;  3W1S A;  4F8C B;  2IY0 B;  2MA9 B;  4BBN F;  4FJY A;  2O2V A;  4NJ6 A;  3ZVV A;  3A9J B;  3PT2 B;  2IZV B;  2L0F A;  4JLC A;  4HJK A;  3VTU A;  2K25 A;  2YLM A;  1ISN A;  1Z5S B;  3ZW3 A;  1WFY A;  2LZ6 A;  2KWV B;  1KM7 A;  4ZYN A;  3UIP B;  3OLM D;  4HLE A;  1WJ6 A;  1I42 A;  2XK5 A;  3DVN U;  3QWZ B;  3VH3 B;  5EDS A;  4W9L A;  2BWF A;  1L7Y A;  2REX A;  3ZNI D;  2RD0 A;  2LI5 A;  3ZLZ A;  1K8R B;  3PS6 A;  5LLI A;  4FUL A;  1WGG A;  2D2Q A;  3LJ3 A;  2AL3 A;  3WAL A;  4GMV A;  1A5R A;  3ML8 A;  3OJ3 A;  1OTR B;  5DPR A;  3UIN B;  1RAX A;  2FAZ A;  2GOW A;  3H6N A;  1WMH A;  3QIJ A;  3QAR A;  4KZC A;  3TL5 A;  2JF5 A;  1NI2 A;  3B0A A;  2ZPN A;  3JSV A;  1FXT B;  2N7E A;  4MSM B;  2KKC A;  4AJY B;  4BOS C;  5G55 A;  4WWN A;  3B1L X;  1WMH B;  3DBR I;  3KH0 A;  4M8N A;  4M8M A;  4IM3 A;  4G3X B;  5AEK B;  4HVB A;  3H7S A;  1XD3 B;  1S3S G;  5AZF A;  3KYC D;  3H9D A;  1WF9 A;  1WXV A;  1TBE A;  4E74 A;  2IY1 B;  1T0Y A;  1OQY A;  3D32 A;  4GDK A;  3ZIM A;  1UBI A;  3M62 B;  2KD0 A;  4E71 A;  3WAO A;  3PLV A;  1QZE A;  1TTN A;  2EMS A;  2LXC A;  4M0W B;  1WJN A;  2AEH A;  2EMT A; 
#chains in the Genus database with same CATH topology
 1AN8 A;  1LGR A;  1WJU A;  2PMV A;  3H8H A;  5D6J B;  2QJL A;  1L0X B;  3IVF A;  3LYY A;  2FCM A;  4B6W A;  1CK1 A;  4DHJ D;  1X1M A;  2XBB C;  4HXD A;  2BYV E;  1NYR A;  2RDG A;  3KQ4 A;  4JWS C;  2FID A;  3PSE B;  2V4L A;  2FUG 1;  2KLC A;  2N9E B;  1JRO A;  2MRP A;  4MJS B;  1MPE A;  4A3O A;  5FKA C;  4LDT D;  1L5P A;  3BII D;  2BB6 A;  2IGH A;  3VH4 B;  1CMX B;  4KX6 B;  4TQ0 A;  1TS3 A;  2Z0E B;  4KZ0 A;  4EEW A;  3DVG Y;  4OVV A;  1UF0 A;  2JRI B;  1OFF A;  3FC4 A;  4EOY A;  3VXW A;  1ESF A;  2G9H D;  5L95 C;  1WGD A;  3SU8 X;  4AOF A;  1V49 A;  1J7A A;  1WXQ A;  3V62 A;  4DDI D;  3T3O A;  1VD2 A;  3GZN I;  1N60 A;  3MHS D;  4BOZ B;  2KHW B;  2D07 B;  2WXH A;  2QDF A;  1YX6 B;  3WIM A;  3KUD B;  1GB1 A;  4ITK A;  3B08 A;  3RYT A;  2V4I B;  1YJJ A;  2Z0D B;  1WXA A;  2V0G A;  2NMQ A;  1OEY J;  4S17 A;  5EE9 A;  1K51 A;  2KTR B;  3RZW C;  1I4P A;  5CHW A;  3NOB A;  5KHQ A;  1T0Q C;  4L2Y A;  3N9Y C;  1E0Z A;  4IG7 B;  2SEB D;  1RRB A;  2LAS A;  1XXG A;  5LXH A;  1N6Z A;  1EM7 A;  5E6P A;  2KWD A;  2MBE A;  2XN9 C;  2KQ4 X;  4HKQ A;  4M01 A;  1HZ6 A;  1BT0 A;  3W5U B;  2JUO A;  3ZDM C;  3W1S C;  2JSV X;  2OOB B;  3P63 A;  4FHK A;  4LCD E;  4H2A A;  1T5X D;  2WDR B;  1RYJ A;  2FCS A;  4K7U A;  4K81 A;  3RD2 A;  3UQB A;  4DHJ B;  2ICI A;  1D5Z C;  3Q2A C;  3X23 A;  4ANV A;  1FRR A;  1FNU A;  1ET9 A;  4A55 A;  3WAN A;  1WRD B;  4RM8 A;  2J4X A;  1EF5 A;  1VZ7 A;  5AZH A;  1HE8 A;  1YJ1 A;  2DZK A;  4KGR A;  5BMG A;  3ZUN A;  3Q8C A;  2UYZ B;  5DPW A;  2H88 B;  2FIF A;  4NNJ B;  2SAK A;  4N59 A;  5HFY A;  5MPO A;  3R7Q A;  5JXV A;  4LNK A;  4LDT B;  2N4F A;  4HDQ A;  1V2Y A;  3ZJV A;  1UH6 A;  4X57 B;  1L6V A;  5LXI B;  4I6P A;  2LVQ A;  3VUW A;  2KDM A;  2M17 A;  1R4N I;  5G5G A;  1AAR A;  4UDU C;  2K8B A;  4US9 A;  3FKY A;  2WYQ A;  4W9E A;  3P2B A;  1J8C A;  1SSN A;  1GNU A;  2L00 B;  3W9C B;  2LEK A;  1QIL A;  3S2A A;  3NUH B;  4AWJ A;  4W9C A;  2N9X A;  1V5O A;  4MGZ E;  5C23 A;  3ZTC A;  1YX5 B;  1G6J A;  3WCQ A;  2KC2 A;  1QT9 A;  2KFK A;  2LVO A;  1F52 A;  1RLF A;  4XX5 A;  3ZJT A;  3OJ4 B;  3AEB B;  4NY0 A;  2HTH A;  4MM3 A;  2NBV B;  2MWS B;  2NTS A;  2PVG C;  2WX1 A;  2LJI A;  3A1Q A;  2KX0 A;  1IUE A;  2KJH B;  1ZOY B;  2KDE B;  2WQY B;  1JWS D;  4MDK E;  2LRU A;  3DVN V;  2KWU B;  2C7H A;  2JX5 A;  1TJE A;  3PV1 A;  1SE4 A;  1V9J A;  4GB9 A;  1KLG D;  3KLS X;  4BFR A;  2YVC A;  2WXJ A;  1TY0 A;  2L0T A;  2O6V A;  4WWO A;  1UEL A;  3ML9 A;  4W9F A;  4G11 A;  4HRO A;  4J3O D;  4WJN A;  1E9M A;  2DEN B;  1E8Y A;  1E7P B;  1FO4 A;  3BVG A;  3M3J A;  1FFU A;  1EWY C;  1FFV A;  1WGK A;  3I57 A;  1Z2M A;  4KGS A;  4IOI E;  1BML C;  2JYT A;  3RNG C;  1KTK A;  4PS7 A;  2QIE B;  3RNE C;  2KFJ A;  4M0W A;  2C7N B;  1ZW7 A;  3VQI A;  3HK0 A;  1UZX B;  3VRA B;  2K3U A;  4HPM B;  1V97 A;  2YEP B;  4DK5 A;  1PGA A;  3MC0 B;  1TT5 B;  3WAM A;  2JT4 B;  5D2M B;  1YJI A;  2WXG A;  3IFW B;  1TS2 A;  2WXQ A;  3H7P A;  3M63 B;  2MBB B;  4W9K A;  2W55 A;  2I1K A;  3DBL I;  2TSS A;  3U7D A;  1P98 A;  4GIV A;  2DYB A;  3NVY A;  2K0P A;  3P4P B;  3UQA A;  2KAN A;  2D5G A;  2GBN A;  3VTW A;  1PQS A;  2EKI A;  3AI5 A;  2N7D A;  3SDL C;  1U4A A;  2DBY A;  1YIW A;  2D3C A;  1FXI A;  1R4M I;  3SFD B;  2PPH A;  1QOA A;  1IP9 A;  2BQQ A;  3A4S C;  5TR5 A;  3R66 C;  2DZI A;  3AXC A;  1V81 A;  3ZKJ C;  2AQ3 B;  2IND C;  2QMT A;  2W82 A;  2MP2 B;  3PZD A;  2KFK B;  3C19 A;  4XC2 A;  2GMI C;  2BF8 B;  1WM3 A;  2K5P A;  3PRE A;  2Y5C A;  3O13 A;  2J52 A;  1B1Z A;  3PRM B;  3A1Q B;  4F8C B;  4NJ6 A;  3ZVV A;  1I4R A;  2EEL A;  2IZV B;  4S0R A;  3AE1 B;  1L6U A;  3HUI A;  2MEK A;  3N1X C;  2LZ6 A;  2KWV B;  1WJ6 A;  1V1O A;  1I42 A;  4W9L A;  2BWF A;  1L7Y A;  2RD0 A;  2B76 B;  4FUL A;  3LJ3 A;  3WAL A;  1A5R A;  2FAZ A;  3H6N A;  4KZC A;  1IGC A;  3U2S C;  2ZPN A;  3JSV A;  4MSM B;  2N9L A;  4AJY B;  4A8X C;  5G55 A;  3B1L X;  1WMH B;  3DBR I;  4IM3 A;  1TKY A;  4G3X B;  5AZF A;  1XD3 B;  3H9D A;  2WS3 B;  3DHI C;  3M62 B;  2KD0 A;  1KH0 A;  4M0W B;  3U30 A;  2LXC A;  3Q8B A;  4RMA A;  4IWQ A;  3O65 B;  3TEY A;  1V1P A;  4KSL C;  3ZNG C;  3ZYY X;  4FLH A;  5JHB A;  4IWO A;  1MVK A;  4XDC A;  1FPY A;  2BVC A;  2I38 A;  4REZ A;  1YQ3 B;  3QK0 A;  3PLU A;  3BY4 B;  3QCA A;  3H7P B;  1FD6 A;  2ZNV B;  1PGX A;  3AV8 A;  3AU4 A;  4IM2 A;  1VCB A;  2C9W B;  2ZCC A;  3NZ3 A;  1E5W A;  3C0R B;  3HRD D;  3I3T B;  1LO5 D;  4LNI A;  3CMM B;  5E6O A;  4HDO A;  1LM8 B;  4EKU A;  2GBM A;  3DHH C;  4J6I A;  5IOI A;  1WM2 A;  4EUT A;  3V61 A;  4W9H A;  4TMA B;  3P42 A;  4RCO A;  2WXN A;  4AS1 A;  3RN9 C;  3V3X A;  3A9K A;  4W9G A;  5CX3 A;  3AU5 A;  4GN1 A;  2AQ2 B;  4LJP B;  4B0E A;  1T3Q A;  3EGR A;  3SFE B;  1YQ4 B;  1EO6 A;  4PS8 A;  1ACC A;  3P4S B;  4K7S A;  2NPT B;  3QA8 A;  3Q8F A;  1RFK A;  3VUY A;  4FJZ A;  2IYD B;  4IUM B;  1ZUD 2;  2BB5 A;  1EU4 A;  4RM9 A;  4WJP A;  2FE8 A;  3R8B A;  2GB1 A;  3GE3 C;  4L1B A;  2G4D B;  4II3 B;  2HE7 A;  3P1M A;  1C3T A;  2J0M A;  2KQS A;  3AE2 B;  1CQV A;  1DOY A;  2KT7 A;  2B3A A;  3PTF C;  2OHF A;  3U7Z A;  1C4A A;  2ZEQ A;  5H92 C;  3CST A;  2J0K A;  2NCN A;  2MSE D;  3BYT B;  1HZ5 A;  2KTF A;  1QOB A;  2PE9 A;  1LFD A;  1V5T A;  4L23 A;  4DBG A;  2LHD A;  5FK9 C;  1E90 A;  1L2N A;  3MC8 A;  1QLB B;  1NDD A;  1PYW D;  3DQV A;  3JSV B;  4JIO U;  4GOC A;  2KQ7 A;  3HVD A;  1IBX B;  2JYE A;  3MJW A;  2WXP A;  2NTT A;  2N9K A;  4OVZ A;  3B9J A;  2KK8 A;  2IPK D;  4PYU A;  3ENE A;  3EUB 2;  1DGJ A;  2WP9 B;  4N58 A;  3UF8 A;  2BWE S;  2MBH A;  3EC8 A;  4TQ1 A;  3RT3 B;  1MHH E;  5CTR C;  4TKN A;  1PUT A;  2JY6 A;  3RFZ B;  1I35 A;  1V1P B;  2M8S A;  3I9V 1;  3V6E B;  3QAQ A;  2DHZ A;  4YSX B;  4LTU A;  2M4N A;  2NBU A;  1F2R C;  2IBI B;  3MJ5 A;  1K50 A;  1SIF A;  3GZN B;  2WX0 A;  5LNK 1;  3ALB A;  2MLB A;  4GXB A;  4OW0 A;  4FA6 A;  3N3K B;  4HCP B;  2E6X A;  2HTM E;  3PHW B;  5BYR A;  2PKO A;  2MBO A;  2AX5 A;  3GE8 C;  2ZJD A;  2ZVN A;  2BYF A;  3PHX B;  2AL6 A;  3Q3O C;  3IT6 B;  4C4V A;  4XZ4 A;  2J0J A;  3A9K B;  2BTE A;  1VRA B;  1RM6 C;  2INN E;  4EE2 A;  3JW0 X;  1QF6 A;  2DZJ A;  4IW0 A;  2FCN A;  3M95 A;  2IGG A;  1EF1 A;  1LQB A;  2ZVO A;  3BZD B;  4ICV A;  3R2T A;  3ONS A;  2M0X A;  1C1Y B;  1MJD A;  3APF A;  2DNF A;  4XDD A;  1A70 A;  3VUX A;  2YEP F;  2KVR A;  3IAS 1;  1TIF A;  1Q10 A;  1ROE A;  1ZDX A;  3DOW A;  5C3J B;  2LGX A;  3NRZ A;  1WZ0 A;  1SE9 A;  3QHT A;  4P7I A;  1XCQ L;  4ZRI A;  3ZQ4 A;  3TUO A;  3BVZ A;  4WWM A;  3UI3 A;  3AEG B;  4P1B C;  1TS5 A;  2G4S A;  2CJN A;  1E8Z A;  1P7E A;  1JWU D;  1WR1 A;  1WXM A;  5BMH A;  1WX7 A;  1E7U A;  2XEW A;  4YWG G;  1FNV A;  1JRU A;  2JZP A;  4HPL B;  3W5V B;  4E3C A;  2JPH A;  2VH1 A;  2UU7 A;  2CHX A;  5IKC M;  3PVL A;  2RDH A;  1R4N B;  2X8X X;  2HDE A;  1EUV B;  4KSK C;  1TKE A;  2PLP A;  2WXM A;  4XWW A;  4WJQ A;  2QHO A;  1GB4 A;  3APC A;  1SJE D;  2L83 A;  3E9S A;  3AB5 A;  1K53 A;  3L13 A;  2LJ5 A;  1UGJ A;  2QSD A;  1FIQ A;  3AE9 B;  2XNA C;  5GMV A;  2QCZ A;  3NS8 A;  1HTO A;  5CHF A;  2DAJ A;  3RNB C;  2D3A A;  1Q1O A;  3TJP A;  4MGK E;  1GOZ A;  3IXS A;  4MSQ B;  2MCN B;  4P1C C;  4KVG B;  3RUL A;  3VRB B;  2KO3 A;  1JWA D;  3NY5 A;  1I4H A;  2JXT A;  3N30 A;  3CWI A;  4NAW B;  2FNJ B;  1BXT A;  2L32 A;  2M19 A;  4C56 C;  2LGS A;  4IDI A;  3RNC C;  4C4V B;  3CSF A;  2MQJ A;  4N9F 4;  3IG3 A;  4AUQ C;  3AE4 B;  2CR5 A;  2MP2 A;  4AP4 C;  2KAC A;  4K3B A;  3ECI A;  1PDX A;  4YL8 A;  2KJR A;  4A3P A;  4A90 A;  1C77 A;  4AQ7 A;  4WAF A;  1MI0 A;  3Q3N C;  1MFW A;  3RNA C;  2JZZ A;  3VAW A;  4NZL B;  2WDV B;  3AEA B;  1MG8 A;  1C9F A;  2PTL A;  4BBN F;  4FJY A;  1EWC A;  4JLC A;  4RGN A;  4HJK A;  3VTU A;  2YLM A;  1Z5S B;  2QEJ C;  1C4P A;  2W3R A;  3ZW3 A;  1WFY A;  3AE3 B;  1KM7 A;  3UIP B;  4MT5 A;  4HLE A;  4YTN B;  2XK5 A;  3QWZ B;  3VH3 B;  3URY A;  3ZNI D;  1EU3 A;  1UUP A;  3ZLZ A;  1SE3 A;  5LLI A;  3ML8 A;  1RAX A;  3QAR A;  1WMH A;  2KKC A;  3NVZ A;  3FAH A;  1FRD A;  4M8M A;  5TSS A;  4HVB A;  1S3S G;  2LMC A;  4OZB A;  3DBL B;  1WF9 A;  5C2T B;  3AEE B;  3OG5 A;  1T0Y A;  3D32 A;  2BS3 B;  1E10 A;  1UBI A;  3FIL A;  3WAO A;  1QZE A;  3AM9 A;  2I1J A;  3TBL D;  1R4M B;  5HKH A;  2K9X A;  3AE7 B;  3Q69 A;  4HCN B;  3N1Z C;  1J0G A;  1NYQ A;  4YSZ B;  4WH4 A;  2HJ1 A;  4LNN A;  4XE0 A;  4BVU C;  4FHJ A;  2DLB A;  3HM3 A;  1KLU D;  1C79 A;  3NJT A;  3Q3J A;  5DCN A;  2W9N A;  3KWL A;  1SB3 C;  3DBH I;  2J53 A;  4KGT A;  1D5X C;  2RDB C;  4NAM A;  3NS1 A;  4RGO S;  3ZNZ B;  1FCC C;  1NI3 A;  3ZJU A;  2OJR A;  4LNO A;  4YTP B;  4NJ7 A;  5H8Y E;  4I6N B;  2KOX A;  5G5H A;  1I4X A;  2WXF A;  1K52 A;  4XYC A;  1FNW A;  2FUH B;  2IO0 B;  2ZNV C;  2D10 A;  2NPT A;  1PGB A;  1M4V A;  3ZTD A;  1KF6 B;  2KDI A;  3ZRF A;  4TUU A;  2L76 A;  3RZF A;  4LLG M;  2Y5P A;  1L0V B;  4GGQ A;  2BW2 A;  2V9H A;  4KV2 A;  3L4P A;  1WGY A;  5D94 A;  3RI7 C;  1SXT A;  1HXY D;  1P9D U;  4WIP A;  4ASW C;  2BS2 B;  3EHV A;  3DBR B;  1GG3 A;  3MC9 A;  2WDQ B;  4CYE A;  2IO3 B;  4OZA A;  3DVG X;  1QQR A;  1ENF A;  3DCG A;  5AUK A;  2IO1 B;  4TSS A;  2ZCB A;  1V8C A;  3H1U A;  1T0R C;  2XK5 B;  1KOT A;  2IO2 B;  2N7J A;  3RUI B;  1JML A;  3I63 C;  3VR9 B;  2C60 A;  1UNS A;  5J18 A;  4WJO A;  1IBX A;  4KKI A;  1ZPS A;  2VZK D;  2BGF A;  2CU1 A;  3EA6 A;  1GAQ B;  2WHI A;  4G0N B;  2INP E;  2A5U A;  2X38 A;  5GXG B;  4EZL A;  1WSP A;  2ONQ A;  2RMM A;  4JWU C;  3QX1 A;  2MBQ A;  1E8W A;  3RPF C;  3DBS A;  3FIL B;  1CZP A;  1JQ4 A;  2OED A;  5C1Z A;  3GP7 A;  3P4Q B;  1GPX A;  4MAC A;  1MHX A;  4P6V F;  5E6N A;  4FXC A;  3TEZ A;  2KWC A;  4DWF A;  1WE7 A;  3Q8E A;  3LDZ E;  4W9I A;  2RR9 A;  5IO9 A;  3V6C B;  5T8I A;  4DDG D;  4KDI C;  4YTM B;  2RSU A;  2KDB A;  2WXO A;  5KHO A;  2PJH A;  4MEL A;  1IGD A;  4QAY A;  4ZRQ A;  2RPQ A;  3TEW A;  1SIJ A;  1YNT E;  2L3Z A;  3ZNH B;  4BKS D;  1NBF C;  4BKG A;  1GC7 A;  2DAF A;  3JVZ X;  3OAW A;  4GSW A;  2FBW B;  3TCA A;  3W2D A;  1YQB A;  1SF0 A;  3SHQ A;  4P16 A;  1YN3 A;  1ZKH A;  3DWG C;  5D7G A;  4LJO B;  2RGF A;  3KVF B;  2N1V A;  4ZDV A;  4ICU A;  2Z8L A;  1WY8 A;  2K39 A;  4IM0 A;  3PPA A;  2BYE A;  2Y5B B;  1PFD A;  4ACF A;  4K1R B;  2CKH B;  3U8Z A;  3N20 C;  4PYZ A;  4DXG A;  2EKE C;  2M0A A;  1JAL A;  4BZA A;  1N5X A;  2VRR B;  3AE6 B;  3MHZ A;  1WRI A;  4GU2 A;  1F77 A;  3P4R B;  1TGZ B;  3AEC B;  3HM6 X;  1D4B A;  2HD5 B;  2OJW A;  5IAA C;  1J7B A;  1OEY A;  2MHJ A;  2BBC A;  2LUE A;  1TS4 A;  2WLB A;  1GUA B;  5CHV C;  1WE6 A;  3APD A;  3NVW A;  3HVZ A;  4HK2 A;  3NVV A;  4PS3 A;  5AZG A;  1WX9 A;  1WGH A;  1V6E A;  4F7Z A;  1GJZ A;  1WGR A;  4EZK A;  2PW9 A;  5BYQ A;  4R3D A;  3T8M A;  3IT4 B;  3RCZ A;  2IDY A;  3KUC B;  1IYF A;  4HRS A;  1WJ4 A;  1TYG B;  2LVP A;  2A4Z A;  2G3Q B;  2D3B A;  4XGA B;  2C5L C;  2CS4 A;  4WWP A;  2NVU I;  1WR6 E;  2QC8 A;  5JZE B;  3PGE A;  2PEA A;  1OQR A;  1B9R A;  4ZRK A;  1XLQ A;  2V3P A;  2KNB A;  1XLO A;  1HTQ A;  2KVZ A;  2BKR B;  4WAA A;  3DDC B;  4IKG A;  1ZDV A;  4HKZ E;  1R7S A;  2DYO A;  1JCK B;  5BMI A;  4II2 B;  3VHT C;  5J2R A;  1HEZ E;  4GDL A;  1N5W A;  5FR3 A;  5JH5 C;  1MG4 A;  2R61 A;  2MJD A;  5I4D A;  3VFK A;  3BIN A;  1V80 A;  4NAW A;  2D3G A;  1XF5 L;  4B95 A;  4MH0 E;  3W1Y A;  3QC8 B;  2I2Y A;  1VJK A;  4ANX A;  4JE3 B;  1Y56 A;  5HHD G;  4MEM A;  2D11 A;  4EFO A;  3ZDT A;  2K6D B;  3NZU A;  5DPT A;  3TIX A;  1ET6 A;  4M00 A;  2ZPY A;  2N0S B;  1P7F A;  4DQO C;  4WQM A;  4K7W A;  3MP9 A;  3Q8A A;  4RGM A;  2KMM A;  4MGY E;  1F9J A;  4ZRP A;  4K3C A;  1N62 A;  2K8H A;  3T9L A;  2E3T A;  3N32 A;  2MX2 A;  5BO4 B;  4MH8 A;  2BPS A;  2INC C;  4DHZ B;  1TZO A;  3L54 A;  1VLB A;  2L8J A;  3IHP C;  1E7V A;  1JW9 D;  1AW7 A;  2KN5 A;  4HJG E;  1J7C A;  3W1S A;  5D3I B;  2IY0 B;  2O2V A;  2KYW A;  1I4G A;  2KN4 A;  3DVN U;  2JQR B;  4YSY B;  2REX A;  1FXA A;  2LI5 A;  1T6B X;  2BT6 A;  2WU2 B;  3PS6 A;  2W3S A;  4GMV A;  3PZ7 A;  3RMK C;  3CIR B;  2GOW A;  3TL5 A;  1NI2 A;  1TKG A;  1ZP0 B;  1FXT B;  1FM0 D;  2ACZ B;  3VR8 B;  1DYQ A;  4OZC A;  2WXL A;  4BOS C;  4C00 A;  1QKZ A;  3KH0 A;  4M8N A;  1HQR D;  3AEF B;  2GRI A;  5AEK B;  4RFB A;  4HPP A;  4BAX A;  4Q2J A;  2GLS A;  4E74 A;  1OQY A;  4GDK A;  3ZIM A;  3LXF A;  3NG0 A;  4YT0 B;  4E71 A;  3PLV A;  1TTN A;  2EMT A;  4ARI A;  2QIL A;  1XCT L;  1AWD A;  2WWZ A;  2BYT A;  4M02 A;  4B9K A;  2LRW A;  4NQL B;  1N63 A;  2KMA A;  2R2O A;  2LGI A;  2IJ0 A;  2UWQ A;  3AUL A;  4GDL B;  4CQN A;  3ZO5 B;  3I5J C;  1WX8 A;  4W9D A;  1H8C A;  3MTN B;  1F2R I;  2H89 B;  2WXR A;  5IA7 A;  1P1A A;  1LXD A;  1RFA A;  1UGM A;  4B0M A;  3AMZ A;  5AUI A;  1S1Q B;  2KJ6 A;  2CU3 A;  4IC7 B;  2DYM A;  4LK0 M;  3GS2 A;  2L05 A;  4ARC A;  4C80 A;  4BKT A;  2DWQ A;  3PZ8 A;  1I7H A;  3IAM 1;  2AYO B;  2K1F A;  2G1E A;  1XT9 B;  4RF1 A;  1JWB D;  4JQW C;  1FEH A;  1N61 A;  2GBK A;  2ZZP B;  1HA5 A;  3BYY B;  1C4C A;  2WU5 B;  2Z59 B;  4WQO B;  2LFI A;  5G2N A;  4JGH B;  4OVU A;  5EE0 A;  3SR6 A;  2GI9 A;  5EE3 A;  1UD7 A;  4ANW A;  1WYG A;  3ZRC A;  1WI0 A;  3R2I A;  4A6Q A;  1XLN A;  4RF0 A;  4HWI B;  3K9O B;  1NEK B;  2KXJ A;  4IWP A;  4LNF A;  3CF6 E;  2O2V B;  2ASQ A;  3AE8 B;  2J42 A;  4KIK A;  4DHZ E;  4FJV B;  2ZW0 A;  3KUZ A;  2V1Y A;  4TV3 A;  3RNF C;  1VR9 A;  4D2K A;  2KDF B;  1RWS A;  2KAJ A;  3WA0 A;  3AN1 A;  2JXX A;  5HG2 A;  3OWE B;  2RPV A;  1SJH D;  3EEC A;  2DX5 B;  5JHA A;  1F1H A;  3U52 E;  2KLG A;  3SEB A;  3QQ8 B;  4C7Y A;  3L10 B;  4YXD B;  3L16 A;  1XO3 A;  1DOI A;  4HEA 1;  5IP4 D;  1E6E B;  3DPD A;  3PO0 A;  4ZRJ A;  3BWU D;  2JU6 X;  3C8Y A;  4PK1 A;  3DBH B;  4NPN A;  1TZ1 A;  2K22 A;  4OHJ A;  1Y8R C;  3NZS A;  2AWT A;  4FN2 A;  3R7R A;  2O6V D;  2JWZ A;  1V86 A;  3SD5 A;  3AED B;  4RNA A;  4GDK B;  1QOF A;  1YMH E;  3R3M A;  1JWM D;  3K9P B;  1C78 A;  2NS5 A;  3TSS A;  5J17 A;  1F0Z A;  1SBB B;  3GB1 A;  1P0R A;  2LXA A;  3VDZ A;  3VTV A;  1OGW A;  3VVW B;  3HIZ A;  2L1A A;  2JWU A;  2GBJ A;  4JL9 A;  2LD9 A;  4USA A;  3AE5 B;  3L17 A;  3V05 A;  1J19 A;  1QOG A;  2WDT B;  2VH2 A;  3L0W B;  2C7M B;  2WGS A;  4AJW A;  2NR2 A;  1UBQ A;  1YN4 A;  4XWT A;  2LWP A;  3BK2 A;  4A20 A;  4BBN C;  2PE6 B;  4F1S A;  1T0S C;  1AYF A;  1H4R A;  1WIA A;  2WXI A;  4JX1 C;  3HHM A;  4URK A;  2LGD A;  4KKJ A;  4O1N A;  2AQ1 B;  1BUI C;  4MGI E;  3BK1 A;  1SGH A;  4CHK A;  5IN7 A;  2MW5 A;  3EFU A;  3UGB B;  2JVC A;  2KMC A;  3NHE B;  2MJ3 A;  4PT5 A;  4KDL B;  5DPS A;  3JYU A;  4ZOH C;  2G45 B;  1P3Q U;  3AH7 A;  1WH3 A;  4ZYS A;  2IGD A;  3X0W A;  4DXA B;  1WWT A;  4MM3 B;  3ZGZ A;  3GOE A;  3KYD D;  3A9J A;  3T3N A;  3PRP B;  1KFY B;  3A33 B;  4KIK B;  4RH6 A;  2HJ8 A;  1Q5W B;  1E8X A;  2CHZ A;  4FBJ B;  3B2G A;  1KRH A;  3DHG C;  3MFG A;  3Q3F A;  2V3N A;  3QJZ A;  1I4Q A;  4ANU A;  2LGY A;  2R2Q A;  1XLP A;  2FCQ A;  2K8C A;  2O6V B;  3L08 A;  2DZM A;  3LB8 C;  1XEE A;  2BKF A;  1WZ3 A;  2PIA A;  1D6E C;  4FAD A;  4W9J A;  1L4D B;  3WAP A;  1WYW B;  2W54 A;  2MJE A;  3U4E G;  1YD8 U;  1NEN B;  2K6Q A;  3ZXV A;  4CO7 A;  2LUM A;  1UWX A;  1XQQ A;  5BYS A;  1IPG A;  1STE A;  1FMA D;  3TMP B;  4EZJ A;  2KZR A;  3ETR A;  1Q0W B;  4DXF A;  4US8 A;  4ZHP A;  4BKS A;  5L83 A;  1KJT A;  1UWM A;  3BVM A;  1WXS A;  1ZGU B;  3EFC A;  1YOV B;  2J7Q B;  2L7R A;  2JZ3 B;  1ZE3 D;  2KC1 A;  3IBE A;  4A9A A;  1M94 A;  1L0Y B;  3V60 A;  2CJO A;  1GC6 A;  1SE2 A;  4MJS A;  1C76 A;  3B2F A;  4JPS A;  5FR6 A;  5E6J A;  2NBW B;  4G50 A;  3E56 A;  2KX3 A;  1FCL A;  2GBR A;  2JRH A;  4C7Z A;  3Q14 C;  2M1M A;  3PRZ A;  1D3Z A;  1VZ6 A;  3KW5 B;  2V3S A;  2Y3A A;  2N9P C;  5D3D A;  4NQK E;  1OQQ A;  2CHW A;  3ZXR A;  1DOX A;  1YN5 A;  1CJE A;  2WNM A;  3UIO B;  3A4R A;  2N1W A;  3ABV B;  1SEB D;  4I6L B;  3KWV A;  2KTR A;  1TY2 A;  1KLV A;  1VZ8 A;  2BS4 B;  2MH7 A;  2MA9 B;  3TEX A;  4N6E B;  3A9J B;  5HI1 A;  3PT2 B;  1VDV A;  2L0F A;  3N1Y C;  2K25 A;  2ZW1 A;  1ISN A;  2VZK B;  4ZYN A;  3OLM D;  5EDS A;  2ON8 A;  5EE1 A;  3DWM A;  1D5M C;  4ZHO A;  3J9C A;  3Q6B A;  1K8R B;  1WGG A;  1NVI D;  2D2Q A;  2Q5W D;  2AL3 A;  3OJ3 A;  1OTR B;  5DPR A;  3UIN B;  2LHE A;  3QIJ A;  2JF5 A;  3B0A A;  2N7E A;  2WXK A;  2L52 A;  4WWN A;  1ZXH A;  1L4Z B;  2M56 B;  3Q3M C;  3H7S A;  3KYC D;  4NJC A;  1WXV A;  1TBE A;  2PVO D;  2IY1 B;  4GLS C;  1JRP A;  1ZXI A;  4WUR A;  4RGT A;  2EMS A;  1WJN A;  2AEH A; 
#chains in the Genus database with same CATH homology
 1WJU A;  4RMA A;  4IWQ A;  5D6J B;  3O65 B;  2I1J A;  4KSL C;  3TBL D;  3IVF A;  2WWZ A;  3ZNG C;  5HKH A;  2FCM A;  4FLH A;  4B6W A;  4DHJ D;  5JHB A;  1X1M A;  4IWO A;  2LRW A;  4B9K A;  4NQL B;  4HCN B;  2XBB C;  1J0G A;  2KMA A;  4HXD A;  2BYV E;  2R2O A;  2UWQ A;  3AUL A;  3UQB A;  4GDL B;  4BVU C;  3ZO5 B;  3QK0 A;  4FHJ A;  3PLU A;  2FID A;  3PSE B;  3HM3 A;  2V4L A;  1WX8 A;  3BY4 B;  3QCA A;  4W9D A;  3H7P B;  2KLC A;  2ZNV B;  2N9E B;  3Q3J A;  3AU4 A;  1H8C A;  4IM2 A;  2MRP A;  5DCN A;  1VCB A;  2C9W B;  2W9N A;  3DBH I;  3MTN B;  2ZCC A;  4MJS B;  1E5W A;  3C0R B;  3I3T B;  5IA7 A;  1P1A A;  4A3O A;  1LXD A;  4LDT D;  3CMM B;  5E6O A;  4HDO A;  1RFA A;  1LM8 B;  4EKU A;  1UGM A;  2GBM A;  3ZNZ B;  2OJR A;  4J6I A;  3VH4 B;  4NJ7 A;  1CMX B;  4I6N B;  4TQ0 A;  1WM2 A;  2Z0E B;  4KZ0 A;  1S1Q B;  2KOX A;  4EUT A;  4EEW A;  2KJ6 A;  3DVG Y;  4OVV A;  4W9H A;  3V61 A;  4IC7 B;  2DYM A;  2JRI B;  4EOY A;  2L05 A;  3VXW A;  4BKT A;  2FUH B;  5L95 C;  2IO0 B;  2ZNV C;  3A9K A;  4W9G A;  5CX3 A;  1WGD A;  3SU8 X;  2D10 A;  2AYO B;  2K1F A;  4AOF A;  1V49 A;  1XT9 B;  3AU5 A;  4GN1 A;  4JQW C;  2NPT A;  4LJP B;  3V62 A;  2GBK A;  4DDI D;  2ZZP B;  1EO6 A;  4PS8 A;  3ZTD A;  1VD2 A;  3GZN I;  4K7S A;  2KDI A;  3MHS D;  4TUU A;  3ZRF A;  2L76 A;  2Z59 B;  4WQO B;  3RZF A;  2NPT B;  5G2N A;  4BOZ B;  3QA8 A;  2KHW B;  4JGH B;  2D07 B;  4OVU A;  3VUY A;  4FJZ A;  2IYD B;  1YX6 B;  1UD7 A;  3WIM A;  4GGQ A;  4IUM B;  3KUD B;  4ANW A;  4KV2 A;  4WJP A;  4RM9 A;  3B08 A;  3RYT A;  1WGY A;  5D94 A;  2Z0D B;  1WXA A;  3ZRC A;  1P9D U;  4ASW C;  1WI0 A;  1OEY J;  2G4D B;  3EHV A;  2HE7 A;  4II3 B;  1C3T A;  4HWI B;  2KTR B;  1GG3 A;  3K9O B;  3RZW C;  2J0M A;  2KQS A;  4CYE A;  2KXJ A;  3NOB A;  4IWP A;  5CHW A;  2IO3 B;  3CF6 E;  3DVG X;  5KHQ A;  2O2V B;  2ASQ A;  4KIK A;  4DHZ E;  2B3A A;  3DCG A;  3PTF C;  4FJV B;  2IO1 B;  4IG7 B;  3KUZ A;  2V1Y A;  4TV3 A;  2ZCB A;  1RRB A;  2LAS A;  2ZEQ A;  3CST A;  5LXH A;  3H1U A;  2J0K A;  2XK5 B;  2NCN A;  1KOT A;  2IO2 B;  2KDF B;  3WA0 A;  2MSE D;  2JXX A;  5E6P A;  2KTF A;  3RUI B;  2PE9 A;  3EEC A;  2MBE A;  1LFD A;  2DX5 B;  1V5T A;  4DBG A;  5JHA A;  2C60 A;  2KLG A;  5J18 A;  3QQ8 B;  1E90 A;  1L2N A;  4WJO A;  1BT0 A;  1NDD A;  3L10 B;  2JUO A;  3ZDM C;  3W1S C;  3DQV A;  3L16 A;  3JSV B;  4JIO U;  4GOC A;  2KQ7 A;  2OOB B;  2BGF A;  3DPD A;  2CU1 A;  3MJW A;  4FHK A;  4LCD E;  4ZRJ A;  4NPN A;  1TZ1 A;  2FCS A;  4K7U A;  4G0N B;  4K81 A;  3RD2 A;  2A5U A;  1Y8R C;  4EZL A;  3NZS A;  2AWT A;  4FN2 A;  3R7R A;  4DHJ B;  3X23 A;  2O6V D;  4ANV A;  3QX1 A;  2JWZ A;  2KK8 A;  2MBQ A;  1V86 A;  1E8W A;  3ENE A;  4PYU A;  3SD5 A;  3DBS A;  4GDK B;  3WAN A;  3UF8 A;  2BWE S;  2MBH A;  1WRD B;  3EC8 A;  3R3M A;  4TQ1 A;  4RM8 A;  3RT3 B;  3K9P B;  1EF5 A;  5AZH A;  5C1Z A;  1HE8 A;  1YJ1 A;  2DZK A;  5CTR C;  3ZUN A;  2NS5 A;  4TKN A;  5J17 A;  2JY6 A;  2UYZ B;  5DPW A;  2FIF A;  1I35 A;  4NNJ B;  2M8S A;  5E6N A;  2KWC A;  1P0R A;  3V6E B;  2LXA A;  3VDZ A;  4DWF A;  1WE7 A;  3VTV A;  3LDZ E;  1OGW A;  3QAQ A;  4W9I A;  3R7Q A;  2DHZ A;  2RR9 A;  3V6C B;  4LDT B;  4DDG D;  2N4F A;  3VVW B;  3HIZ A;  4KDI C;  4HDQ A;  2GBJ A;  4JL9 A;  2M4N A;  2RSU A;  2NBU A;  2LD9 A;  2IBI B;  2KDB A;  1V2Y A;  1UH6 A;  4X57 B;  5KHO A;  3L17 A;  1SIF A;  1J19 A;  2PJH A;  4MEL A;  2WDT B;  2WX0 A;  5LXI B;  4I6P A;  2LVQ A;  3ALB A;  3VUW A;  2MLB A;  2RPQ A;  3L0W B;  2C7M B;  4AJW A;  2L3Z A;  3ZNH B;  4BKS D;  4GXB A;  2NR2 A;  4FA6 A;  1NBF C;  2M17 A;  3N3K B;  1UBQ A;  4BKG A;  1GC7 A;  2DAF A;  2LWP A;  4A20 A;  4HCP B;  4BBN C;  2PE6 B;  1R4N I;  3JVZ X;  3OAW A;  4F1S A;  1AAR A;  1H4R A;  2K8B A;  4GSW A;  3PHW B;  1WIA A;  3TCA A;  1YQB A;  2MBO A;  2ZJD A;  2WYQ A;  4W9E A;  3HHM A;  3SHQ A;  4URK A;  2ZVN A;  2BYF A;  3PHX B;  2AL6 A;  2LGD A;  3P2B A;  1J8C A;  1ZKH A;  5D7G A;  1GNU A;  2L00 B;  4LJO B;  2RGF A;  4MGI E;  3KVF B;  2N1V A;  4ZDV A;  4ICU A;  1SGH A;  4CHK A;  4XZ4 A;  1WY8 A;  2J0J A;  3S2A A;  2MW5 A;  4AWJ A;  3EFU A;  3UGB B;  3A9K B;  4W9C A;  2JVC A;  2N9X A;  2KMC A;  3NHE B;  2K39 A;  1V5O A;  4IM0 A;  4MGZ E;  3JW0 X;  3PPA A;  2BYE A;  2Y5B B;  5C23 A;  1YX5 B;  3ZTC A;  4KDL B;  5DPS A;  4K1R B;  1G6J A;  2DZJ A;  4IW0 A;  2FCN A;  3JYU A;  2CKH B;  3M95 A;  2KC2 A;  2KFK A;  2LVO A;  1RLF A;  2G45 B;  1P3Q U;  3OJ4 B;  4PYZ A;  4XX5 A;  3U8Z A;  2EKE C;  4NY0 A;  1EF1 A;  1LQB A;  1WH3 A;  2ZVO A;  2VRR B;  2HTH A;  4ICV A;  4GU2 A;  4MM3 A;  2NBV B;  2MWS B;  3U30 A;  1TGZ B;  3HM6 X;  2M0X A;  2WX1 A;  3ONS A;  3X0W A;  4DXA B;  2HD5 B;  1C1Y B;  3A1Q A;  5IAA C;  1OEY A;  2KX0 A;  2KJH B;  3APF A;  2LUE A;  2KDE B;  3GOE A;  3KYD D;  3A9J A;  4MDK E;  3VUX A;  2KVR A;  1GUA B;  2LRU A;  3DVN V;  3PRP B;  2KWU B;  3A33 B;  2C7H A;  4KIK B;  2HJ8 A;  1Q5W B;  3PV1 A;  5CHV C;  1E8X A;  1WE6 A;  2CHZ A;  3APD A;  4FBJ B;  1V9J A;  4GB9 A;  3DOW A;  2LGX A;  4HK2 A;  1WZ0 A;  4BFR A;  2YVC A;  1SE9 A;  3QHT A;  4PS3 A;  4P7I A;  4ZRI A;  5AZG A;  1WX9 A;  1WGH A;  1V6E A;  2L0T A;  2O6V A;  4WWO A;  4F7Z A;  3Q3F A;  1GJZ A;  1WGR A;  1UEL A;  3QJZ A;  4EZK A;  4ANU A;  3ML9 A;  4W9F A;  4G11 A;  2G4S A;  2LGY A;  3T8M A;  2R2Q A;  4WJN A;  1E8Z A;  2FCQ A;  2K8C A;  2O6V B;  2DEN B;  3L08 A;  1E8Y A;  2DZM A;  3RCZ A;  3KUC B;  1WR1 A;  1WXM A;  2BKF A;  1WZ3 A;  1WX7 A;  1E7U A;  1IYF A;  4FAD A;  1WJ4 A;  3M3J A;  4W9J A;  1WYW B;  2LVP A;  2A4Z A;  2XEW A;  3WAP A;  1YD8 U;  1JRU A;  2G3Q B;  2C5L C;  2CS4 A;  2K6Q A;  4HPL B;  1Z2M A;  2NVU I;  4WWP A;  4E3C A;  2JPH A;  1WR6 E;  5JZE B;  2CHX A;  3PGE A;  4CO7 A;  1XQQ A;  2PEA A;  3PVL A;  4ZRK A;  4PS7 A;  1IPG A;  3TMP B;  4EZJ A;  1EUV B;  4KSK C;  2KNB A;  2KZR A;  2KFJ A;  1Q0W B;  4WJQ A;  2C7N B;  2QHO A;  2BKR B;  1ZW7 A;  3VQI A;  4BKS A;  5L83 A;  1KJT A;  4WAA A;  3DDC B;  3APC A;  3HK0 A;  1WXS A;  1UZX B;  1ZGU B;  2J7Q B;  2DYO A;  2L7R A;  3L13 A;  2JZ3 B;  2LJ5 A;  4HPM B;  2KC1 A;  4II2 B;  3VHT C;  3IBE A;  4DK5 A;  5J2R A;  3WAM A;  4GDL A;  1M94 A;  5GMV A;  2JT4 B;  5D2M B;  5JH5 C;  3NS8 A;  3IFW B;  3V60 A;  3H7P A;  5CHF A;  2DAJ A;  1GC6 A;  3M63 B;  1Q1O A;  3TJP A;  4MGK E;  2MBB B;  4MJS A;  3VFK A;  4W9K A;  3BIN A;  1V80 A;  2I1K A;  3DBL I;  4MSQ B;  2MCN B;  1P98 A;  4NAW A;  3U7D A;  5FR6 A;  2D3G A;  4GIV A;  4KVG B;  2DYB A;  3RUL A;  4B95 A;  2KO3 A;  4MH0 E;  2NBW B;  3NY5 A;  3W1Y A;  3QC8 B;  3N30 A;  4G50 A;  4ANX A;  3UQA A;  2KX3 A;  4MEM A;  2KAN A;  2GBR A;  2JRH A;  2GBN A;  4NAW B;  3VTW A;  1PQS A;  2D11 A;  3AI5 A;  2FNJ B;  4EFO A;  2N7D A;  3SDL C;  3ZDT A;  1U4A A;  2K6D B;  3NZU A;  2M1M A;  5DPT A;  3TIX A;  1YIW A;  3PRZ A;  1D3Z A;  2ZPY A;  1R4M I;  3KW5 B;  2V3S A;  2N9P C;  3CSF A;  2PPH A;  2MQJ A;  4N9F 4;  1IP9 A;  3IG3 A;  4K7W A;  4NQK E;  4AUQ C;  2CR5 A;  2MP2 A;  3A4S C;  4MGY E;  2CHW A;  1F9J A;  2DZI A;  3AXC A;  3R66 C;  5TR5 A;  3ECI A;  4AP4 C;  1V81 A;  3ZKJ C;  4YL8 A;  2K8H A;  2KJR A;  3T9L A;  3N32 A;  2MP2 B;  2MX2 A;  3PZD A;  4A3P A;  5BO4 B;  2KFK B;  4XC2 A;  2BPS A;  3UIO B;  2GMI C;  3A4R A;  4DHZ B;  2BF8 B;  1WM3 A;  2N1W A;  3L54 A;  2JZZ A;  2L8J A;  3IHP C;  3PRE A;  3VAW A;  1E7V A;  4I6L B;  3PRM B;  2KTR A;  3A1Q B;  1KLV A;  2KN5 A;  1MG8 A;  3W1S A;  4F8C B;  2IY0 B;  2MA9 B;  4BBN F;  4FJY A;  2O2V A;  4NJ6 A;  3ZVV A;  3A9J B;  3PT2 B;  2IZV B;  2L0F A;  4JLC A;  4HJK A;  3VTU A;  2K25 A;  2YLM A;  1ISN A;  1Z5S B;  3ZW3 A;  1WFY A;  2LZ6 A;  2KWV B;  1KM7 A;  4ZYN A;  3UIP B;  3OLM D;  4HLE A;  1WJ6 A;  1I42 A;  2XK5 A;  3DVN U;  3QWZ B;  3VH3 B;  5EDS A;  4W9L A;  2BWF A;  1L7Y A;  2REX A;  3ZNI D;  2RD0 A;  2LI5 A;  3ZLZ A;  1K8R B;  3PS6 A;  5LLI A;  4FUL A;  1WGG A;  2D2Q A;  3LJ3 A;  2AL3 A;  3WAL A;  4GMV A;  1A5R A;  3ML8 A;  3OJ3 A;  1OTR B;  5DPR A;  3UIN B;  1RAX A;  2FAZ A;  2GOW A;  3H6N A;  1WMH A;  3QIJ A;  3QAR A;  4KZC A;  3TL5 A;  2JF5 A;  1NI2 A;  3B0A A;  2ZPN A;  3JSV A;  1FXT B;  2N7E A;  4MSM B;  2KKC A;  4AJY B;  4BOS C;  5G55 A;  4WWN A;  3B1L X;  1WMH B;  3DBR I;  3KH0 A;  4M8N A;  4M8M A;  4IM3 A;  4G3X B;  5AEK B;  4HVB A;  3H7S A;  1XD3 B;  1S3S G;  5AZF A;  3KYC D;  3H9D A;  1WF9 A;  1WXV A;  1TBE A;  4E74 A;  2IY1 B;  1T0Y A;  1OQY A;  3D32 A;  4GDK A;  3ZIM A;  1UBI A;  3M62 B;  2KD0 A;  4E71 A;  3WAO A;  3PLV A;  1QZE A;  1TTN A;  2EMS A;  2LXC A;  4M0W B;  1WJN A;  2AEH A;  2EMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...