2KNBA

Solution nmr structure of the parkin ubl domain in complex with the endophilin-a1 sh3 domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
MIVFVRFNSSYGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELQNHLTVQNCDLEQQSIVHIVQRPQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SH3 domains from a subset of BAR proteins define a Ubl-binding domain and implicate parkin in synaptic ubiquitination.
pubmed doi rcsb
molecule keywords E3 ubiquitin-protein ligase parkin
molecule tags Protein binding
source organism Rattus norvegicus
total genus 18
structure length 76
sequence length 76
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2knbA00
2JRIB 1ZW7A 2G45B 2IO0B 3L17A 3X23A 4BKGA 4G50A 3H7SA 2NPTA 2JF5A 1EO6A 4W9LA 3HM3A 1Q5WB 4MJSB 3P2BA 3CF6E 1NBFC 1YD8U 2D10A 2MX2A 1WX7A 2DAJA 3W1YA 1V49A 5JHBA 1OEYJ 4YL8A 2C7MB 1V5TA 3VUWA 4URKA 3TMPB 3PT2B 1QZEA 2MRPA 2MBHA 2ZCCA 3OJ4B 3UQAA 4ASWC 5CTRC 4BKTA 4AWJA 2KN5A 2N7DA 3CSFA 3U30A 2NBVB 4IM2A 4ANWA 3SD5A 3Q3FA 4ANUA 2LZ6A 2PPHA 2ZVNA 4W9EA 3QC8B 3DVNV 1WM2A 2MP2A 2A5UA 4KDIC 2FCNA 3ZVVA 1YJ1A 4FBJB 4WJPA 2HE7A 1WXVA 1TTNA 4MDKE 1P9DU 2BKRB 2CHXA 2KDEB 1EF5A 2KWUB 5CHFA 2L00B 3KYDD 2L7RA 2FUHB 2Z0EB 4GDLB 4PS8A 3PSEB 4CYEA 2AL3A 3H7PB 3L16A 3N3KB 1S1QB 1WE7A 2DZKA 2REXA 1PQSA 2LGYA 4ZRKA 2JPHA 2M0XA 3DVGX 2DENB 2RSUA 1M94A 1WXMA 3M63B 4WWPA 5JZEB 4FADA 3DBSA 2LJ5A 2IZVB 4MJSA 2JWZA 5E6NA 3APCA 4IUMB 3KUCB 3ALBA 2LD9A 3HK0A 4FN2A 3MJWA 1G6JA 2ZEQA 4K7UA 3OLMD 3DVNU 2BYEA 2CR5A 2C7HA 2PEAA 3B08A 3TBLD 5E6OA 2L8JA 2KX3A 4WJQA 4XZ4A 1ISNA 2L3ZA 2DAFA 4ZRJA 5G2NA 3PLVA 2KNBA 2PE9A 3NZUA 3PLUA 5D2MB 3KYCD 4II3B 1OTRB 3VDZA 5AZHA 1WXSA 4CHKA 2HTHA 2IYDB 2KOXA 3AXCA 4K1RB 2QHOA 1RFAA 2L76A 4CO7A 2KJRA 2KVRA 3IBEA 4FLHA 1YQBA 3APFA 3CMMB 3PS6A 2CS4A 2WDTB 3A1QB 3DQVA 4KVGB 4EOYA 4EUTA 1IP9A 3RD2A 4A3PA 1S3SG 3DCGA 2KO3A 1LQBA 3SDLC 1XQQA 2IO3B 3I3TB 3DBHI 4LCDE 1LM8B 2KQ7A 2L0FA 2I1JA 4GDLA 3KUDB 3H7PA 2FAZA 2ZCBA 2ZJDA 2J0MA 4OVVA 3U7DA 3VTUA 4BOSC 5C1ZA 2AL6A 2R2OA 4BVUC 2FIFA 4HDOA 1I35A 1GUAB 3ENEA 1WGRA 2D2QA 3OAWA 4FJYA 2KWCA 2BGFA 3T8MA 4LJOB 5CHWA 2K8BA 2RGFA 3ZNID 2IY0B 3EFUA 1V9JA 3H6NA 4JLCA 5KHOA 3ZNGC 1WY8A 2O2VB 2WX0A 4IWPA 3NOBA 4W9IA 2CU1A 2FCSA 4HPLB 2MQJA 3T9LA 3UF8A 3R66C 4MGZE 4B9KA 2N1WA 2PE6B 3RZFA 5DPWA 1P0RA 1X1MA 4DWFA 4EEWA 1YX5B 2MWSB 3R3MA 1WX8A 4IC7B 1FXTB 4X57B 3VVWB 3W1SA 4XX5A 3PVLA 3RULA 2KDBA 3QJZA 2M4NA 2O6VB 4IG7B 4NQLB 2KKCA 4FHJA 3A1QA 4MH0E 1WJ6A 3MTNB 3ZRCA 4F8CB 3A9JB 3VAWA 4GDKB 4KSLC 2K25A 4AJYB 2R2QA 3D32A 3PV1A 1WJUA 4E71A 5E6PA 2KLGA 2ZPNA 1KLVA 2EKEC 2Z59B 2C5LC 3HM6X 3AI5A 4EZLA 5TR5A 2WX1A 3ZRFA 2KJHB 4M0WB 4NQKE 2NVUI 2K8CA 3R7RA 1WX9A 3KW5B 1K8RB 2ASQA 1WZ3A 1V81A 2K8HA 3H1UA 3KVFB 4I6NB 5C23A 2IO1B 3ECIA 3ZO5B 3O65B 1P3QU 4M8MA 1SIFA 1UH6A 2KHWB 3DBLI 4MELA 4BKSD 1C1YB 1WJ4A 3A4SC 4DXAB 1C3TA 1WGYA 1WGDA 5AEKB 5FR6A 1L2NA 1WGHA 2ZNVC 5J18A 4DHJB 2LUEA 1WXAA 1UGMA 1SE9A 1Y8RC 2NCNA 3QX1A 4RM9A 3V6CB 2O2VA 5KHQA 4MEMA 1TZ1A 1ZKHA 4GIVA 4ZYNA 3GZNI 5G55A 1U4AA 2EMSA 2KC2A 2OJRA 2MBQA 2LRUA 3VUXA 3UQBA 1UBIA 5D7GA 5D6JB 3RUIB 2LXCA 1VD2A 3SHQA 3L08A 5JHAA 4EFOA 2KTFA 2BF8B 2KTRB 2N7EA 2LVOA 3PTFC 5DPSA 3ZIMA 2O6VA 1H4RA 3A4RA 4HCNB 4B95A 2D07B 1WZ0A 2J7QB 1I42A 2N4FA 4JGHB 3PHXB 2KMAA 3A9JA 4P7IA 2IO2B 1NDDA 2FNJB 4GDKA 3L13A 2JVCA 4KIKB 2KFJA 1RLFA 2DX5B 2XEWA 4HLEA 1GG3A 1E8ZA 5L95C 1ZGUB 3B0AA 3EC8A 2KZRA 4ZDVA 2B3AA 4LDTD 4XC2A 1LFDA 4WWOA 2KLCA 4G11A 4IW0A 4PYUA 2LVQA 4NY0A 3BINA 3PREA 2K6QA 1UBQA 1GC7A 3WAOA 1V5OA 2FCMA 3IHPC 2LGDA 4GGQA 3ML9A 1OEYA 3ZKJC 1LXDA 4NAWB 2G4SA 4NNJB 4KZCA 4ICUA 3S2AA 4EZJA 3M3JA 1IPGA 2V4LA 3L54A 4GN1A 3ZTDA 2BYVE 2KX0A 3HHMA 3VUYA 4PYZA 1WR6E 4B6WA 3ZTCA 2JZ3B 3DVGY 1E8WA 4W9FA 2ZPYA 4FJVB 2K1FA 2DYMA 4KV2A 2MCNB 2CKHB 4IWQA 3V60A 2D3GA 4JL9A 4J6IA 4W9HA 2MBOA 1CMXB 2MLBA 4IM3A 3ZUNA 3QCAA 2KTRA 2AYOB 3B1LX 5AZFA 3AULA 4GSWA 4GXBA 3VTWA 5IAAC 3PRZA 1F9JA 4PS3A 1E8XA 4W9DA 1HE8A 1E7VA 1EF1A 4G3XB 4EKUA 5EDSA 2K6DB 1R4MI 2FCQA 4GB9A 2KANA 4KIKA 3APDA 2CHZA 3KUZA 1Z2MA 2UYZB 4JIOU 1E5WA 2KD0A 2HD5B 2C60A 4AP4C 4ICVA 4AUQC 1P1AA 1WR1A 3X0WA 1H8CA 3GOEA 2KXJA 2XK5B 4TUUA 4WWNA 3RCZA 1IYFA 3PZDA 1WGGA 3H9DA 2GOWA 1V80A 3PRPB 3QHTA 4WAAA 2NR2A 1AARA 3DOWA 3WALA 4DHZE 4E74A 4F7ZA 1D3ZA 4NAWA 2AEHA 2YLMA 4BBNC 3JYUA 3K9OB 2C7NB 4DHZB 3M95A 2KDIA 3RT3B 4NJ7A 3WA0A 1E7UA 2A4ZA 4HXDA 2ZVOA 3ZNZB 1WYWB 1YX6B 4EZKA 2NBWB 1RRBA 1J19A 3RYTA 4G0NB 3JW0X 3QIJA 3V6EB 2W9NA 2LRWA 3UIPB 2KFKB 1MG8A 1OGWA 2CHWA 2V3SA 3NY5A 3UIOB 1GJZA 3UINB 3ML8A 1Z5SB 4FHKA 5D94A 2JY6A 2K39A 3ZDTA 4DBGA 3ZNHB 4GU2A 3QAQA 4MSQB 3PHWB 1NI2A 2JUOA 3TCAA 1WE6A 3TL5A 2KC1A 2UWQA 3ZLZA 2ZZPB 5LXIB 4W9JA 1WI0A 2GBJA 5DCNA 1TGZB 2DYBA 4W9GA 1BT0A 3DBRI 2XK5A 5J2RA 2JRHA 3VHTC 4ZRIA 2L0TA 1A5RA 1WIAA 2FIDA 2GBKA 1WMHB 2LVPA 3DDCB 2RD0A 3HIZA 3W1SC 4FA6A 4I6LB 3SU8X 4MGYE 4TV3A 2D11A 1TBEA 1WM3A 3Q3JA 3L0WB 3K9PB 3PPAA 4BBNF 4HVBA 1V6EA 2MW5A 3JSVB 4HWIB 2BWES 5IA7A 4DK5A 3TJPA 3IFWB 5L83A 1WFYA 2G4DB 3VFKA 1GC6A 2J0JA 4IM0A 2J0KA 3OJ3A 3VQIA 1R4NI 4WJNA 2BWFA 3BY4B 1J0GA 4KSKC 3CSTA 1L7YA 4NPNA 4DDID 3WAPA 2EMTA 2I1KA 4GMVA 1OQYA 2GBNA 2C9WB 3ONSA 4DDGD 4ANXA 2KFKA 4HPMB 5HKHA 4RM8A 4KDLB 2WWZA 1E90A 2OOBB 3C0RB 4HJKA 1V86A 4N9F4 2KDFB 1J8CA 1XD3B 3LDZE 3PGEA 3V61A 4AOFA 3QK0A 4AJWA 4ANVA 3KH0A 1RAXA 4W9CA 3R7QA 1YIWA 1Q0WB 2LGXA 3EHVA 2MA9B 1XT9B 2GBRA 3VXWA 5GMVA 3M62B 2MBEA 2L05A 1EUVB 3IVFA 1WJNA 2AWTA 4HK2A 3UGBB 3VTVA 5LLIA 2NS5A 2XBBC 3WAMA 3QA8A 2KQSA 2RPQA 1WMHA 2G3QB 2KWVB 3LJ3A 4WQOB 5DPRA 1UD7A 4MSMB 3WANA 4A3OA 2ZNVB 4I6PA 2BYFA 3U8ZA 5J17A 2M17A 2GBMA 2RR9A 4NJ6A 2DYOA 2VRRB 3ZW3A 3A9KB 3RZWC 4LJPB 1UELA 2KMCA 3JSVA 4KZ0A 2N1VA 2HJ8A 2MSED 1WRDB 4RMAA 1UZXB 1KOTA 2KJ6A 2N9PC 2NBUA 2V1YA 5JH5C 3NHEB 2IBIB 2LI5A 2JT4B 3AU5A 4FJZA 4W9KA 3QARA 4E3CA 4II2B 3L10B 4LDTB 5CX3A 2NPTB 4HDQA 4TQ1A 2O6VD 2DZMA 2MBBB 4BOZB 2Z0DB 5BO4B 3ZDMC 1V2YA 1E8YA 2DZJA 2M1MA 4BKSA 1Q1OA 3VH3B 4TKNA 2BPSA 4K7WA 2N9EB 4MM3A 3NZSA 3JVZX 2GMIC 1KJTA 3QQ8B 4PS7A 2WYQA 1SGHA 1WF9A 3A33B 5DPTA 2Y5BB 3TIXA 3DPDA 4OVUA 4K7SA 4IWOA 4JQWC 4F1SA 2LASA 4GOCA 3NS8A 2DZIA 2KK8A 3VH4B 2LWPA 4WJOA 2M8SA 2PJHA 5CHVC 3V62A 3AU4A 2MP2B 4MGIE 2JXXA 2JZZA 4K81A 4DHJD 4M8NA 4MGKE 1P98A 3MHSD 3N30A 2BKFA 3PRMB 5AZGA 4TQ0A 4BFRA 2YVCA 1VCBA 4FULA 2LXAA 3A9KA 2N9XA 1GNUA 1WH3A 4HCPB 3QWZB 1JRUA 3WIMA 2DHZA 5LXHA 1T0YA 3IG3A 4A20A 3N32A 2IY1B 1KM7A 3EECA
chains in the Genus database with same CATH superfamily
3BVGA 5FR3A 3ZGZA 2IO0B 1NBFC 2D10A 4R3DA 1HZ6A 4KKIA 3P4SB 3N1XC 2MRPA 4A6QA 5CTRC 2V3PA 1ZXHA 2N7DA 4IM2A 3Q3FA 3NVWA 1IGCA 3IAM1 1WM2A 1ESFA 2WDRB 3ZVVA 4WJPA 3HVZA 1SXTA 1WXVA 2KWDA 2CHXA 2KDEB 1NYQA 5CHFA 3KYDD 3H7PB 1S1QB 2DZKA 1PQSA 1N61A 2M0XA 3BVMA 1ENFA 4FADA 3DBSA 2EELA 3P42A 1BUIC 1V1PB 2IZVB 2JWZA 5E6NA 4IUMB 3HK0A 1JROA 4B0MA 3OLMD 3DVNU 2C7HA 5E6OA 2L8JA 2KX3A 4WJQA 2WXGA 3AEAB 3PLVA 3VDZA 5C3JB 1PFDA 2BS2B 2L76A 3T3OA 3IBEA 4FLHA 3CMMB 4EOYA 2CS4A 3A1QB 3RD2A 4GLSC 1LQBA 3SDLC 5LNK1 1GAQB 2I1JA 1ZP0B 3VTUA 1FRRA 2BVCA 1YN3A 1ACCA 3PZ8A 3U52E 3O13A 2RGFA 3ZNID 2IY0B 4ARIA 1QILA 1C4CA 4JLCA 5KHOA 1WY8A 1WSPA 4JX1C 1X1MA 4BZAA 1PGXA 3RULA 4IOIE 2KDBA 2WXOA 3HUIA 1MI0A 3A9JB 3FC4A 4AJYB 2R2QA 4MACA 2ONQA 3ETRA 1KLVA 4EZLA 3AI5A 2WX1A 4P1CC 2KJHB 3KW5B 4WAFA 2K8HA 4I6NB 3KVFB 3ZO5B 3O65B 1XLQA 1C1YB 4DXAB 1WGHA 5J18A 4DHJB 2Y5PA 2KVZA 1U4AA 2KC2A 2OJRA 2MBQA 2WXLA 1QKZA 4NAMA 1UBIA 5D6JB 3SHQA 3E56A 3L08A 2KTFA 2O6VA 2AQ1B 3A4RA 3T3NA 1FD6A 2D07B 5C2TB 2N4FA 1KF6B 2V0GA 4RGOS 4KIKB 1YNTE 2DX5B 5JXVA 2RDBC 4M0WA 4M00A 2K22A 3VRAB 4XYCA 4LDTD 3URYA 4IDIA 4UDUC 1RWSA 2K3UA 3WAOA 1GC7A 3FILA 2LGDA 3ML9A 1OEYA 1LXDA 2G4SA 3CWIA 4TMAB 3M3JA 1IPGA 2V4LA 4GN1A 1FNUA 3VUYA 1IGDA 1E8WA 4FJVB 2PW9A 2MCNB 4IWQA 2KN4A 4JL9A 4W9HA 2MBOA 2KACA 2KTRA 3B1LX 3AE5B 3AULA 1DOIA 3VTWA 3SEBA 1F9JA 1TJEA 1SEBD 4WH4A 5EDSA 3IT6B 3C8YA 2AX5A 3R2TA 1P1AA 1WR1A 3GOEA 3RCZA 4WWNA 1IYFA 3PZDA 3H9DA 2D5GA 2XNAC 3PRPB 2BBCA 4WAAA 5MPOA 2DBYA 4NAWA 2AEHA 4BBNC 5IOIA 1N60A 1E10A 4DHZB 2KDIA 2KQ4X 1HTOA 1E7UA 2A4ZA 4HXDA 1VRAB 3PO0A 2RPVA 3V6EB 1LO5D 1MG8A 2V3SA 1TKYA 1GJZA 3N9YC 1Q10A 2K39A 4DBGA 3ZNHB 4GU2A 2W55A 4OHJA 5HI1A 1FIQA 1WE6A 1JWSD 2KC1A 3BIID 2ZZPB 4L23A 4W9JA 1WI0A 5DCNA 2H89B 3NJTA 4W9GA 1SJHD 2PMVA 1A5RA 1YQ4B 2GBKA 2LVPA 2ON8A 4KX6B 3HIZA 4S17A 2INCC 2JX5A 2BS4B 4TV3A 4YSYB 1I4PA 1TS5A 3K9PB 4L1BA 1V6EA 4HKQA 3JSVB 2BWES 1D6EC 3IFWB 5DPWA 2G4DB 3VQIA 1R4NI 1PGBA 2V3NA 4DDID 4WIPA 2GBNA 3ONSA 1F0ZA 4ANXA 3AB5A 5EE3A 4HJKA 2ICIA 2DLBA 1RFKA 3PGEA 4MM3B 2JSVX 2GBRA 3VTVA 3AEDB 5LLIA 2NS5A 1IUEA 3QA8A 3LJ3A 1WMHA 4WQOB 1UD7A 2ZNVB 3U8ZA 1KLUD 4NJCA 4NJ6A 5HHDG 5IKCM 1SBBB 2VRRB 2H88B 1SSNA 2N7JA 1KOTA 2LHDA 4XWWA 1BXTA 2INPE 3AE4B 2JT4B 1FFVA 3QARA 4E3CA 3NZ3A 4AS1A 4P6VF 4LDTB 2NPTB 4TQ1A 3KLSX 2MBBB 4XDDA 1CZPA 3JVZX 4PS7A 1N62A 1UNSA 1WF9A 2HDEA 3DPDA 4K7SA 4M01A 3Q3OC 2LASA 4WJOA 3NUHB 2FE8A 4QAYA 2JXXA 2JZZA 2WU5B 4N59A 3PRMB 2YVCA 4WQMA 3U2SC 1C79A 1WH3A 1JRUA 1QOGA 2DHZA 2UU7A 1QOFA 1KM7A 3NOBA 2JRIB 4G50A 4W9LA 1BMLC 2CJOA 3HM3A 4MJSB 3P2BA 1YD8U 4LNFA 2MX2A 3AECB 2ZCCA 1TKEA 4AWJA 1GB1A 3U30A 2NBVB 4ANWA 1YOVB 3QC8B 4NZLB 2MP2A 3BYTB 4KDIC 4RH6A 4FBJB 4L2YA 1D4BA 1K51A 1AN8A 4MDKE 1P9DU 3DBHB 2N9KA 2BYTA 2L00B 2L7RA 4GDLB 4PS8A 3PSEB 3L16A 2REXA 3BWUD 1F52A 1RYJA 3DVGX 2DENB 4M02A 4HEA1 1M94A 1FCCC 3W5UB 3N20C 1JALA 2PKOA 2RMMA 4K7UA 2CR5A 4XZ4A 3ZXRA 5G2NA 2KNBA 2PE9A 3PLUA 2JQRB 1L0XB 3KYCD 4II3B 5AZHA 2K5PA 2HTHA 2KOXA 2NTSA 5G5HA 3APFA 3PS6A 3DQVA 2WDTB 4LNIA 1S3SG 2JWUA 2NTTA 2KO3A 3DCGA 1D5ZC 1XQQA 2WS3B 3DBHI 1FM0D 3H7PA 2ZJDA 4OVVA 4BOSC 3U7DA 3EUB2 1JMLA 2R2OA 4BVUC 2WXJA 4HDOA 4ARCA 3RN9C 4FJYA 2KWCA 3DBLB 1HZ5A 2VZKD 4LJOB 4LNOA 5BMHA 1V1PA 3H6NA 3I57A 4W9IA 2CU1A 4HPLB 3UF8A 1TY2A 4B9KA 4Q2JA 1EU3A 3U7ZA 4EEWA 2MWSB 1FXTB 2WXMA 1NVID 2W3SA 4XX5A 2M4NA 2KKCA 4FHJA 3A1QA 4MH0E 2ACZB 3MTNB 1TS4A 4XGAB 4F8CB 1V8CA 4KSLC 2K25A 2DNFA 1TS2A 3TEXA 5E6PA 3AEFB 4XDCA 3HM6X 3B2FA 3MC8A 1WYGA 4YXDB 4JPSA 2K8CA 2QSDA 4M8MA 3N1YC 2KHWB 3DBLI 4BKSD 2MJEA 3AE9B 1ZPSA 1L2NA 2QIEB 2ZNVC 1NENB 2D3AA 2LUEA 4REZA 1UGMA 1SE9A 4RM9A 3IT4B 4MEMA 1ZKHA 4ZYNA 3RI7C 2W54A 5G55A 1YN4A 1Y56A 1JW9D 4B0EA 2LRUA 2GLSA 3RUIB 1MPEA 4YTNB 4EFOA 2BF8B 2PIAA 3ZIMA 5DPSA 1H4RA 4HCNB 1I42A 2BTEA 3PHXB 3A9JA 2IO2B 2JVCA 2KFJA 2WLBA 1E8ZA 1PUTA 3B0AA 4KKJA 4ZDVA 2B3AA 4WWOA 2KLCA 4IW0A 1STEA 4YT0B 3BINA 3PREA 1UBQA 3IHPC 1TKGA 3ABVB 1UWMA 4OZBA 4ICUA 3Q3NC 4EZJA 2J42A 3L54A 3ZTDA 3HHMA 4S0RA 1TYGB 4J3OD 3ZTCA 4ACFA 3DVGY 4W9FA 2K1FA 2QCZA 1QF6A 2D3GA 4J6IA 4A55A 3EA6A 3MHZA 4IM3A 2AYOB 4GXBA 5IAAC 1E8XA 4W9DA 1E7VA 1EF1A 4G3XB 4EKUA 2K6DB 4GB9A 1MFWA 3APDA 4KIKA 1FCLA 1Z2MA 2UYZB 4JWSC 1C9FA 2J52A 3DBRB 1SJED 2WU2B 3MC9A 1XCTL 1ET9A 2NR2A 3DOWA 1C77A 1XXGA 1XCQL 3M95A 5H92C 2WDVB 3RT3B 4NJ7A 4AQ7A 4EE2A 3WA0A 1JRPA 4D2KA 1HQRD 1YX6B 1RRBA 1J19A 2WP9B 3RYTA 3HVDA 3JW0X 2LRWA 2CU3A 3NRZA 3GB1A 2KFKB 1KRHA 1OGWA 2CHWA 2TSSA 2VZKB 4C56C 1Z5SB 5D94A 2D3BA 2JY6A 1QLBB 1TY0A 4P1BC 5HG2A 1CQVA 3QAQA 5EE1A 3IXSA 3PHWB 3TL5A 2UWQA 3ZLZA 2GBJA 5D3DA 2LGSA 1BT0A 3DBRI 4RGMA 5J2RA 1XLNA 3RNEC 3FKYA 3BK1A 3AV8A 3W5VB 3DDCB 2Y5CA 1WM3A 3Q3JA 3PPAA 4HVBA 2JU6X 1XLPA 2KMMA 3BZDB 5H8YE 1L7YA 1IBXB 2M56B 4YSXB 4DDGD 1OQYA 2C9WB 4KDLB 4A9AA 1E90A 1V86A 1J8CA 4LK0M 3Q8EA 1K50A 4KGSA 1JCKB 1XD3B 1M4VA 3QK0A 4AJWA 4N58A 3GS2A 3R7QA 2LGXA 3VXWA 1N5XA 5GMVA 3RNGC 2L05A 1EUVB 1EWYC 1WJNA 1YJJA 1XLOA 3LB8C 1EM7A 5DPRA 3W9CB 3KQ4A 3A9KB 1UELA 2KMCA 3JSVA 1WRDB 4K3BA 1YJIA 1AW7A 2N9PC 2NBUA 2V1YA 3I5JC 4W9KA 2ZW1A 4II2B 3L10B 1D5MC 3TEZA 2AQ3B 5CX3A 4HDQA 2DZMA 3AE7B 1WGKA 2DZJA 1Q1OA 5BMGA 4TKNA 2BPSA 4MM3A 2N9EB 4RGNA 1T0SC 2WHIA 1SGHA 1UUPA 4IWOA 2QDFA 5BMIA 2KK8A 1QT9A 1R4NB 3AU4A 4ZRQA 2MEKA 4YTMB 5FK9C 5AZGA 1QOBA 4TQ0A 4BFRA 1VCBA 2EKIA 2N9XA 1VLBA 4HCPB 3TUOA 1T0YA 1MG4A 3IG3A 3N32A 2SAKA 4OZAA 2IY1B 1OFFA 1ZW7A 2G45B 2OJWA 3H7SA 2NPTA 2JF5A 2L32A 3CF6E 2LMCA 1WX7A 3W1YA 1V49A 5JHBA 1V5TA 3VUWA 4URKA 1QZEA 3UQAA 2MBHA 4ASWC 3NVVA 3L4PA 4DXFA 2KN5A 2PVOD 3SD5A 5BYQA 4ANUA 2ZVNA 3DVNV 2OHFA 2A5UA 2G1EA 2FCNA 1YJ1A 1E0ZA 3DWMA 2HE7A 1TTNA 2BKRB 2KWUB 3VRBB 1WE7A 2JPHA 2RSUA 4US9A 3B9JA 4WWPA 5JZEB 4MJSA 3APCA 3KUCB 3ALBA 4WWMA 4FN2A 1YQ3B 3MJWA 1G6JA 2ZEQA 1HA5A 1P7FA 2PEAA 3B08A 1YN5A 3Q2AC 1ISNA 2DAFA 4ZRJA 2WXRA 5D2MB 1OTRB 2MH7A 1WXSA 1QQRA 3AXCA 4K1RB 2QHOA 2KJRA 4KVGB 3Q8CA 3OWEB 4EUTA 5IN7A 1IP9A 4WURA 5EE0A 1UF0A 1LM8B 4GDLA 3KUDB 2FAZA 2ZCBA 2J0MA 2N0SB 5C1ZA 4MT5A 2FIFA 3RNFC 1I35A 4C4VB 1YMHE 2D2QA 4MH8A 4LTUA 3EFUA 5HFYA 1V9JA 1JWAD 3ZNGC 2O2VB 4HPPA 2FCSA 3T9LA 4MGZE 2PE6B 3NG0A 4A8XC 4DXGA 4DWFA 1YX5B 3R3MA 3VVWB 4IC7B 3PVLA 1RM6C 4DQOC 3QJZA 3I63C 3AE2B 4NQLB 1T3QA 3ZRCA 2PTLA 3VAWA 4GDKB 2PLPA 3D32A 4E71A 1WJUA 2KLGA 2EKEC 1SF0A 2Z59B 2BT6A 2C5LC 3V05A 5TR5A 4YWGG 4NQKE 1K8RB 2X8XX 2ASQA 3H1UA 2L1AA 5C23A 1FPYA 2IO1B 1P3QU 2LJIA 1SIFA 4MELA 2ZW0A 1WJ4A 1C3TA 2NMQA 1WGDA 4OZCA 1Y8RC 3QX1A 2NCNA 2WXIA 2SEBD 3V6CB 5KHQA 1TZ1A 2W82A 3SR6A 3VUXA 1VD2A 2N7EA 2LVOA 3PTFC 3Q8BA 4JWUC 2IGDA 4C80A 5AUKA 4B95A 2J7QB 3AMZA 4ZRPA 4JGHB 2KMAA 1R4MB 1NDDA 3L13A 2XEWA 1GG3A 1ZGUB 3EC8A 1NI3A 2KZRA 1FNVA 4XC2A 4PYUA 1LGRA 1QOAA 2LVQA 1V5OA 3KWVA 4GGQA 5TSSA 4NNJB 4KZCA 3RNCC 3MFGA 3GE3C 2CJNA 2BYVE 2KX0A 1AYFA 3IAS1 3ZQ4A 1WR6E 2FUG1 2JZ3B 1L6UA 1L4ZB 2ZPYA 2DYMA 3N1ZC 2WNMA 2J4XA 3V60A 3EGRA 2MLBA 1CMXB 3ZUNA 3QCAA 5T8IA 5GXGB 5AZFA 4OW0A 3GP7A 4GSWA 3PRZA 1FXIA 2WXPA 3HRDD 1R4MI 2KANA 1XO3A 4JIOU 2KD0A 2WDQB 2HD5B 1H8CA 4RGTA 2XK5B 1P7EA 3GE8C 1WGGA 1DOXA 2GOWA 1V80A 3QHTA 2MJDA 4DHZE 1WXQA 2YEPF 3FAHA 1J7AA 1ZOYB 4USAA 2LFIA 1ZDXA 2YLMA 3JYUA 3K9OB 2C7NB 4PT5A 2JYEA 5E6JA 3BYYB 4EZKA 1UWXA 1PYWD 4G0NB 3QIJA 2W9NA 3MP9A 2JYTA 3UIOB 1MVKA 3ML8A 1NEKB 3PZ7A 4MSQB 1VJKA 1NI2A 2JUOA 3TCAA 1HTQA 2DYBA 3LYYA 2IPKD 2LUMA 2JRHA 2L0TA 4LLGM 2FIDA 2VH2A 5BYRA 2RD0A 1NYRA 3W1SC 4FA6A 4I6LB 3P63A 5G5GA 2D11A 2IGHA 1TBEA 2BB6A 4HWIB 2MW5A 5IA7A 4DK5A 1C4PA 2L52A 3VFKA 2J0KA 3OJ3A 4P16A 1J7CA 3BY4B 1J0GA 4KSKC 3CSTA 2B76B 1R7SA 2EMTA 2I1KA 4GMVA 5HKHA 2KFKA 1E6EB 4RM8A 3C0RB 1I4HA 2KDFB 4PK1A 1DYQA 4AOFA 4ANVA 3KH0A 1YIWA 1EU4A 3RNAC 2MA9B 1XT9B 1XEEA 3M62B 1F1HA 2AWTA 4HK2A 1N6ZA 3ZJUA 3WAMA 2RPQA 2JZPA 1GOZA 3WANA 2GRIA 4A3OA 2BYFA 5J17A 2M17A 2GBMA 2RR9A 2DYOA 1A70A 3ZW3A 1B9RA 3RZWC 1F2RI 4KZ0A 2HJ8A 2MSED 3ZJTA 2N9LA 4RMAA 1UZXB 1MJDA 2WXHA 3AU5A 2QEJC 2IJ0A 1IBXA 2O6VD 3ZDMC 1E8YA 2M1MA 4BKSA 3RPFC 2WQYB 3VH3B 3E9SA 3NZSA 2GMIC 2I38A 3QQ8B 2WYQA 3DHHC 4HJGE 2Y5BB 2Q5WD 4A90A 4OVZA 4GOCA 1MHXA 2DZIA 1OQQA 2IDYA 5CHVC 3V62A 3CIRB 1SE3A 2YEPB 4HROA 1B1ZA 4K81A 4M8NA 2BB5A 4RF1A 2KAJA 3N30A 2BKFA 1L0YB 4K3CA 3A9KA 3V3XA 1GNUA 5LXHA 3QWZB 4ZHOA 1WWTA 4A20A 1FMAD 3EECA 1I4XA 3X23A 3L17A 4BKGA 2INDC 1ZE3D 1EO6A 2V9HA 3AE6B 5I4DA 1SIJA 3R2IA 1Q5WB 1C78A 3P4QB 2GI9A 2V4IB 2DAJA 1OEYJ 1FFUA 4YL8A 2C7MB 3TMPB 3PT2B 1T6BX 3OJ4B 4FXCA 4KGTA 4BKTA 1TZOA 3CSFA 1I4QA 2LZ6A 2PPHA 4W9EA 3SFEB 1FO4A 2KT7A 4C00A 1SE4A 2INNE 4ZHPA 4RCOA 5D3IB 1EF5A 1PGAA 4CYEA 2FUHB 2Z0EB 1T5XD 2AL3A 3N3KB 3ZXVA 3LXFA 2JXTA 2LGYA 4ZRKA 2BS3B 2HJ1A 1F77A 3AEBB 1WXMA 3M63B 4C7ZA 2QILA 2LJ5A 1HEZE 2LD9A 3BK2A 4YSZB 2BYEA 3TBLD 1E7PB 1JWUD 2L3ZA 3EFCA 3NZUA 3DHGC 4O1NA 2MJ3A 4CHKA 2IYDB 4ZOHC 1RFAA 4CO7A 2KVRA 4HLEA 1YQBA 2E3TA 2Z8LA 3AE3B 4A3PA 1N63A 1J7BA 2IO3B 3I3TB 4LCDE 2KQ7A 2L0FA 1VZ7A 1VZ8A 2AL6A 1HXYD 3DWGC 1GUAB 3ENEA 1WGRA 3OAWA 2BGFA 3T8MA 5CHWA 5FKAC 2XN9C 3Q8FA 2K8BA 4ZYSA 1I4GA 1C4AA 1JQ4A 2WX0A 3GZNB 1F2RC 4HRSA 1T0RC 4IWPA 2MQJA 1SE2A 3R66C 3RMKC 2N1WA 3RZFA 2L83A 5IP4D 3TEYA 1P0RA 3NVZA 3P4PB 1D5XC 4X57B 3U4EG 1WX8A 4HKZE 3W1SA 4IG7B 3WCQA 2O6VB 1E9MA 3NVYA 1WJ6A 4LNKA 3PV1A 2WXNA 2KYWA 1ZXIA 2ZPNA 3ZRFA 4M0WB 3P4RB 1VDVA 2NVUI 3R7RA 1WX9A 1EWCA 1DGJA 1WZ3A 4C4VA 1V81A 3ECIA 4XE0A 3FILB 3I9V1 3W2DA 1UH6A 4N6EB 3A4SC 1WGYA 4JE3B 5AEKB 5FR6A 1VZ6A 1WXAA 3DHIC 2O2VA 4GIVA 3GZNI 3AN1A 2EMSA 2PVGC 2QC8A 3UI3A 3UQBA 5D7GA 2LXCA 5JHAA 2KTRB 4ITKA 2IGGA 3Q69A 1VR9A 1WZ0A 1WRIA 4KGRA 2QMTA 4P7IA 2FNJB 4GDKA 2HTME 1RLFA 5L95C 1GPXA 1JWBD 4LNNA 1L4DB 1FRDA 1LFDA 3B2GA 4G11A 3SFDB 4NY0A 4XWTA 2K6QA 2FCMA 3C19A 1ROEA 3MJ5A 2FBWB 3ZKJC 1L5PA 1GB4A 4NAWB 3S2AA 4CQNA 1CJEA 4PYZA 4RF0A 4B6WA 1KH0A 4KV2A 3AH7A 2CKHB 3TSSA 3AEEB 2J53A 2I2YA 3AEGB 4PS3A 1HE8A 2K0PA 2FCQA 2AQ2B 2CHZA 1XF5L 3KUZA 1ZDVA 1E5WA 1MHHE 2C60A 4AP4C 4ICVA 4AUQC 3X0WA 1AWDA 2R61A 1CK1A 2KXJA 4TUUA 1DOYA 1C76A 1ET6A 4E74A 1AARA 3WALA 1D3ZA 4F7ZA 2X38A 3Q3MC 2ZVOA 2LGIA 3ZNZB 2M0AA 1WYWB 2NBWB 2KDMA 1L6VA 3AE1B 5AUIA 1K53A 3UIPB 2Y3AA 3NY5A 2WXQA 5EE9A 3UINB 4FHKA 1FXAA 3ZDTA 1V97A 2RDGA 1FNWA 3MC0B 3NS1A 2WXFA 2MHJA 5LXIB 2VH1A 1TGZB 1FEHA 2XK5A 3VHTC 4ZRIA 1WIAA 1I4RA 1WMHB 3SU8X 4MGYE 3OG5A 1PDXA 4C7YA 1TS3A 1T0QC 3L0WB 4BBNF 3ZYYX 3AE8B 3RFZB 3TJPA 2LHEA 5L83A 1WFYA 3J9CA 1GC6A 2J0JA 4IM0A 1OQRA 3VR9B 4WJNA 2BWFA 4NPNA 3WAPA 2BW2A 3P1MA 4H2AA 2QJLA 4HPMB 2WWZA 2OOBB 4N9F4 3ZJVA 1N5WA 3LDZE 3V61A 3Q6BA 4IKGA 4BAXA 4TSSA 1RAXA 4W9CA 3BVZA 1Q0WB 3EHVA 2M19A 2WGSA 1KLGD 2MBEA 4YTPB 3IVFA 3UGBB 2XBBC 3KWLA 2KQSA 2G3QB 1I7HA 2E6XA 2KWVB 5IO9A 4MSMB 4I6PA 2K9XA 2GB1A 4LJPB 2N1VA 2KJ6A 5JH5C 3AM9A 3NHEB 2IBIB 2LI5A 4FJZA 1TIFA 3RNBC 2W3RA 1KTKA 4BOZB 2Z0DB 5BO4B 1V2YA 1UGJA 4RNAA 4K7WA 3Q8AA 1KJTA 3A33B 3TIXA 1KFYB 3Q14C 4RFBA 5DPTA 5BYSA 4OVUA 2G9HD 3VR8B 1JWMD 3R8BA 2BQQA 4JQWC 4F1SA 3NS8A 2OEDA 3VH4B 2LWPA 2M8SA 2PJHA 2MP2B 4MGIE 2DWQA 1SB3C 4DHJD 1K52A 2D3CA 1L0VB 4MGKE 1P98A 3MHSD 4FULA 2LXAA 3TEWA 3WIMA 4US8A 2LEKA 1ZUD2 2WXKA 2RDHA 1TT5B 1V1OA 3H8HA
chains in the Genus database with same CATH topology
2JRIB 1ZW7A 2G45B 2IO0B 3L17A 3X23A 4BKGA 4G50A 3H7SA 2NPTA 2JF5A 1EO6A 4W9LA 3HM3A 1Q5WB 4MJSB 3P2BA 3CF6E 1NBFC 1YD8U 2D10A 2MX2A 1WX7A 2DAJA 3W1YA 1V49A 5JHBA 1OEYJ 4YL8A 2C7MB 1V5TA 3VUWA 4URKA 3TMPB 3PT2B 1QZEA 2MRPA 2MBHA 2ZCCA 3OJ4B 3UQAA 4ASWC 5CTRC 4BKTA 4AWJA 2KN5A 2N7DA 3CSFA 3U30A 2NBVB 4IM2A 4ANWA 3SD5A 3Q3FA 4ANUA 2LZ6A 2PPHA 2ZVNA 4W9EA 3QC8B 3DVNV 1WM2A 2MP2A 2A5UA 4KDIC 2FCNA 3ZVVA 1YJ1A 4FBJB 4WJPA 2HE7A 1WXVA 1TTNA 4MDKE 1P9DU 2BKRB 2CHXA 2KDEB 1EF5A 2KWUB 5CHFA 2L00B 3KYDD 2L7RA 2FUHB 2Z0EB 4GDLB 4PS8A 3PSEB 4CYEA 2AL3A 3H7PB 3L16A 3N3KB 1S1QB 1WE7A 2DZKA 2REXA 1PQSA 2LGYA 4ZRKA 2JPHA 2M0XA 3DVGX 2DENB 2RSUA 1M94A 1WXMA 3M63B 4WWPA 5JZEB 4FADA 3DBSA 2LJ5A 2IZVB 4MJSA 2JWZA 5E6NA 3APCA 4IUMB 3KUCB 3ALBA 2LD9A 3HK0A 4FN2A 3MJWA 1G6JA 2ZEQA 4K7UA 3OLMD 3DVNU 2BYEA 2CR5A 2C7HA 2PEAA 3B08A 3TBLD 5E6OA 2L8JA 2KX3A 4WJQA 4XZ4A 1ISNA 2L3ZA 2DAFA 4ZRJA 5G2NA 3PLVA 2KNBA 2PE9A 3NZUA 3PLUA 5D2MB 3KYCD 4II3B 1OTRB 3VDZA 5AZHA 1WXSA 4CHKA 2HTHA 2IYDB 2KOXA 3AXCA 4K1RB 2QHOA 1RFAA 2L76A 4CO7A 2KJRA 2KVRA 3IBEA 4FLHA 1YQBA 3APFA 3CMMB 3PS6A 2CS4A 2WDTB 3A1QB 3DQVA 4KVGB 4EOYA 4EUTA 1IP9A 3RD2A 4A3PA 1S3SG 3DCGA 2KO3A 1LQBA 3SDLC 1XQQA 2IO3B 3I3TB 3DBHI 4LCDE 1LM8B 2KQ7A 2L0FA 2I1JA 4GDLA 3KUDB 3H7PA 2FAZA 2ZCBA 2ZJDA 2J0MA 4OVVA 3U7DA 3VTUA 4BOSC 5C1ZA 2AL6A 2R2OA 4BVUC 2FIFA 4HDOA 1I35A 1GUAB 3ENEA 1WGRA 2D2QA 3OAWA 4FJYA 2KWCA 2BGFA 3T8MA 4LJOB 5CHWA 2K8BA 2RGFA 3ZNID 2IY0B 3EFUA 1V9JA 3H6NA 4JLCA 5KHOA 3ZNGC 1WY8A 2O2VB 2WX0A 4IWPA 3NOBA 4W9IA 2CU1A 2FCSA 4HPLB 2MQJA 3T9LA 3UF8A 3R66C 4MGZE 4B9KA 2N1WA 2PE6B 3RZFA 5DPWA 1P0RA 1X1MA 4DWFA 4EEWA 1YX5B 2MWSB 3R3MA 1WX8A 4IC7B 1FXTB 4X57B 3VVWB 3W1SA 4XX5A 3PVLA 3RULA 2KDBA 3QJZA 2M4NA 2O6VB 4IG7B 4NQLB 2KKCA 4FHJA 3A1QA 4MH0E 1WJ6A 3MTNB 3ZRCA 4F8CB 3A9JB 3VAWA 4GDKB 4KSLC 2K25A 4AJYB 2R2QA 3D32A 3PV1A 1WJUA 4E71A 5E6PA 2KLGA 2ZPNA 1KLVA 2EKEC 2Z59B 2C5LC 3HM6X 3AI5A 4EZLA 5TR5A 2WX1A 3ZRFA 2KJHB 4M0WB 4NQKE 2NVUI 2K8CA 3R7RA 1WX9A 3KW5B 1K8RB 2ASQA 1WZ3A 1V81A 2K8HA 3H1UA 3KVFB 4I6NB 5C23A 2IO1B 3ECIA 3ZO5B 3O65B 1P3QU 4M8MA 1SIFA 1UH6A 2KHWB 3DBLI 4MELA 4BKSD 1C1YB 1WJ4A 3A4SC 4DXAB 1C3TA 1WGYA 1WGDA 5AEKB 5FR6A 1L2NA 1WGHA 2ZNVC 5J18A 4DHJB 2LUEA 1WXAA 1UGMA 1SE9A 1Y8RC 2NCNA 3QX1A 4RM9A 3V6CB 2O2VA 5KHQA 4MEMA 1TZ1A 1ZKHA 4GIVA 4ZYNA 3GZNI 5G55A 1U4AA 2EMSA 2KC2A 2OJRA 2MBQA 2LRUA 3VUXA 3UQBA 1UBIA 5D7GA 5D6JB 3RUIB 2LXCA 1VD2A 3SHQA 3L08A 5JHAA 4EFOA 2KTFA 2BF8B 2KTRB 2N7EA 2LVOA 3PTFC 5DPSA 3ZIMA 2O6VA 1H4RA 3A4RA 4HCNB 4B95A 2D07B 1WZ0A 2J7QB 1I42A 2N4FA 4JGHB 3PHXB 2KMAA 3A9JA 4P7IA 2IO2B 1NDDA 2FNJB 4GDKA 3L13A 2JVCA 4KIKB 2KFJA 1RLFA 2DX5B 2XEWA 4HLEA 1GG3A 1E8ZA 5L95C 1ZGUB 3B0AA 3EC8A 2KZRA 4ZDVA 2B3AA 4LDTD 4XC2A 1LFDA 4WWOA 2KLCA 4G11A 4IW0A 4PYUA 2LVQA 4NY0A 3BINA 3PREA 2K6QA 1UBQA 1GC7A 3WAOA 1V5OA 2FCMA 3IHPC 2LGDA 4GGQA 3ML9A 1OEYA 3ZKJC 1LXDA 4NAWB 2G4SA 4NNJB 4KZCA 4ICUA 3S2AA 4EZJA 3M3JA 1IPGA 2V4LA 3L54A 4GN1A 3ZTDA 2BYVE 2KX0A 3HHMA 3VUYA 4PYZA 1WR6E 4B6WA 3ZTCA 2JZ3B 3DVGY 1E8WA 4W9FA 2ZPYA 4FJVB 2K1FA 2DYMA 4KV2A 2MCNB 2CKHB 4IWQA 3V60A 2D3GA 4JL9A 4J6IA 4W9HA 2MBOA 1CMXB 2MLBA 4IM3A 3ZUNA 3QCAA 2KTRA 2AYOB 3B1LX 5AZFA 3AULA 4GSWA 4GXBA 3VTWA 5IAAC 3PRZA 1F9JA 4PS3A 1E8XA 4W9DA 1HE8A 1E7VA 1EF1A 4G3XB 4EKUA 5EDSA 2K6DB 1R4MI 2FCQA 4GB9A 2KANA 4KIKA 3APDA 2CHZA 3KUZA 1Z2MA 2UYZB 4JIOU 1E5WA 2KD0A 2HD5B 2C60A 4AP4C 4ICVA 4AUQC 1P1AA 1WR1A 3X0WA 1H8CA 3GOEA 2KXJA 2XK5B 4TUUA 4WWNA 3RCZA 1IYFA 3PZDA 1WGGA 3H9DA 2GOWA 1V80A 3PRPB 3QHTA 4WAAA 2NR2A 1AARA 3DOWA 3WALA 4DHZE 4E74A 4F7ZA 1D3ZA 4NAWA 2AEHA 2YLMA 4BBNC 3JYUA 3K9OB 2C7NB 4DHZB 3M95A 2KDIA 3RT3B 4NJ7A 3WA0A 1E7UA 2A4ZA 4HXDA 2ZVOA 3ZNZB 1WYWB 1YX6B 4EZKA 2NBWB 1RRBA 1J19A 3RYTA 4G0NB 3JW0X 3QIJA 3V6EB 2W9NA 2LRWA 3UIPB 2KFKB 1MG8A 1OGWA 2CHWA 2V3SA 3NY5A 3UIOB 1GJZA 3UINB 3ML8A 1Z5SB 4FHKA 5D94A 2JY6A 2K39A 3ZDTA 4DBGA 3ZNHB 4GU2A 3QAQA 4MSQB 3PHWB 1NI2A 2JUOA 3TCAA 1WE6A 3TL5A 2KC1A 2UWQA 3ZLZA 2ZZPB 5LXIB 4W9JA 1WI0A 2GBJA 5DCNA 1TGZB 2DYBA 4W9GA 1BT0A 3DBRI 2XK5A 5J2RA 2JRHA 3VHTC 4ZRIA 2L0TA 1A5RA 1WIAA 2FIDA 2GBKA 1WMHB 2LVPA 3DDCB 2RD0A 3HIZA 3W1SC 4FA6A 4I6LB 3SU8X 4MGYE 4TV3A 2D11A 1TBEA 1WM3A 3Q3JA 3L0WB 3K9PB 3PPAA 4BBNF 4HVBA 1V6EA 2MW5A 3JSVB 4HWIB 2BWES 5IA7A 4DK5A 3TJPA 3IFWB 5L83A 1WFYA 2G4DB 3VFKA 1GC6A 2J0JA 4IM0A 2J0KA 3OJ3A 3VQIA 1R4NI 4WJNA 2BWFA 3BY4B 1J0GA 4KSKC 3CSTA 1L7YA 4NPNA 4DDID 3WAPA 2EMTA 2I1KA 4GMVA 1OQYA 2GBNA 2C9WB 3ONSA 4DDGD 4ANXA 2KFKA 4HPMB 5HKHA 4RM8A 4KDLB 2WWZA 1E90A 2OOBB 3C0RB 4HJKA 1V86A 4N9F4 2KDFB 1J8CA 1XD3B 3LDZE 3PGEA 3V61A 4AOFA 3QK0A 4AJWA 4ANVA 3KH0A 1RAXA 4W9CA 3R7QA 1YIWA 1Q0WB 2LGXA 3EHVA 2MA9B 1XT9B 2GBRA 3VXWA 5GMVA 3M62B 2MBEA 2L05A 1EUVB 3IVFA 1WJNA 2AWTA 4HK2A 3UGBB 3VTVA 5LLIA 2NS5A 2XBBC 3WAMA 3QA8A 2KQSA 2RPQA 1WMHA 2G3QB 2KWVB 3LJ3A 4WQOB 5DPRA 1UD7A 4MSMB 3WANA 4A3OA 2ZNVB 4I6PA 2BYFA 3U8ZA 5J17A 2M17A 2GBMA 2RR9A 4NJ6A 2DYOA 2VRRB 3ZW3A 3A9KB 3RZWC 4LJPB 1UELA 2KMCA 3JSVA 4KZ0A 2N1VA 2HJ8A 2MSED 1WRDB 4RMAA 1UZXB 1KOTA 2KJ6A 2N9PC 2NBUA 2V1YA 5JH5C 3NHEB 2IBIB 2LI5A 2JT4B 3AU5A 4FJZA 4W9KA 3QARA 4E3CA 4II2B 3L10B 4LDTB 5CX3A 2NPTB 4HDQA 4TQ1A 2O6VD 2DZMA 2MBBB 4BOZB 2Z0DB 5BO4B 3ZDMC 1V2YA 1E8YA 2DZJA 2M1MA 4BKSA 1Q1OA 3VH3B 4TKNA 2BPSA 4K7WA 2N9EB 4MM3A 3NZSA 3JVZX 2GMIC 1KJTA 3QQ8B 4PS7A 2WYQA 1SGHA 1WF9A 3A33B 5DPTA 2Y5BB 3TIXA 3DPDA 4OVUA 4K7SA 4IWOA 4JQWC 4F1SA 2LASA 4GOCA 3NS8A 2DZIA 2KK8A 3VH4B 2LWPA 4WJOA 2M8SA 2PJHA 5CHVC 3V62A 3AU4A 2MP2B 4MGIE 2JXXA 2JZZA 4K81A 4DHJD 4M8NA 4MGKE 1P98A 3MHSD 3N30A 2BKFA 3PRMB 5AZGA 4TQ0A 4BFRA 2YVCA 1VCBA 4FULA 2LXAA 3A9KA 2N9XA 1GNUA 1WH3A 4HCPB 3QWZB 1JRUA 3WIMA 2DHZA 5LXHA 1T0YA 3IG3A 4A20A 3N32A 2IY1B 1KM7A 3EECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI B;  1ZW7 A;  2G45 B;  2IO0 B;  3L17 A;  3X23 A;  4BKG A;  4G50 A;  3H7S A;  2NPT A;  2JF5 A;  1EO6 A;  4W9L A;  3HM3 A;  1Q5W B;  4MJS B;  3P2B A;  3CF6 E;  1NBF C;  1YD8 U;  2D10 A;  2MX2 A;  1WX7 A;  2DAJ A;  3W1Y A;  1V49 A;  5JHB A;  1OEY J;  4YL8 A;  2C7M B;  1V5T A;  3VUW A;  4URK A;  3TMP B;  3PT2 B;  1QZE A;  2MRP A;  2MBH A;  2ZCC A;  3OJ4 B;  3UQA A;  4ASW C;  5CTR C;  4BKT A;  4AWJ A;  2KN5 A;  2N7D A;  3CSF A;  3U30 A;  2NBV B;  4IM2 A;  4ANW A;  3SD5 A;  3Q3F A;  4ANU A;  2LZ6 A;  2PPH A;  2ZVN A;  4W9E A;  3QC8 B;  3DVN V;  1WM2 A;  2MP2 A;  2A5U A;  4KDI C;  2FCN A;  3ZVV A;  1YJ1 A;  4FBJ B;  4WJP A;  2HE7 A;  1WXV A;  1TTN A;  4MDK E;  1P9D U;  2BKR B;  2CHX A;  2KDE B;  1EF5 A;  2KWU B;  5CHF A;  2L00 B;  3KYD D;  2L7R A;  2FUH B;  2Z0E B;  4GDL B;  4PS8 A;  3PSE B;  4CYE A;  2AL3 A;  3H7P B;  3L16 A;  3N3K B;  1S1Q B;  1WE7 A;  2DZK A;  2REX A;  1PQS A;  2LGY A;  4ZRK A;  2JPH A;  2M0X A;  3DVG X;  2DEN B;  2RSU A;  1M94 A;  1WXM A;  3M63 B;  4WWP A;  5JZE B;  4FAD A;  3DBS A;  2LJ5 A;  2IZV B;  4MJS A;  2JWZ A;  5E6N A;  3APC A;  4IUM B;  3KUC B;  3ALB A;  2LD9 A;  3HK0 A;  4FN2 A;  3MJW A;  1G6J A;  2ZEQ A;  4K7U A;  3OLM D;  3DVN U;  2BYE A;  2CR5 A;  2C7H A;  2PEA A;  3B08 A;  3TBL D;  5E6O A;  2L8J A;  2KX3 A;  4WJQ A;  4XZ4 A;  1ISN A;  2L3Z A;  2DAF A;  4ZRJ A;  5G2N A;  3PLV A;  2KNB A;  2PE9 A;  3NZU A;  3PLU A;  5D2M B;  3KYC D;  4II3 B;  1OTR B;  3VDZ A;  5AZH A;  1WXS A;  4CHK A;  2HTH A;  2IYD B;  2KOX A;  3AXC A;  4K1R B;  2QHO A;  1RFA A;  2L76 A;  4CO7 A;  2KJR A;  2KVR A;  3IBE A;  4FLH A;  1YQB A;  3APF A;  3CMM B;  3PS6 A;  2CS4 A;  2WDT B;  3A1Q B;  3DQV A;  4KVG B;  4EOY A;  4EUT A;  1IP9 A;  3RD2 A;  4A3P A;  1S3S G;  3DCG A;  2KO3 A;  1LQB A;  3SDL C;  1XQQ A;  2IO3 B;  3I3T B;  3DBH I;  4LCD E;  1LM8 B;  2KQ7 A;  2L0F A;  2I1J A;  4GDL A;  3KUD B;  3H7P A;  2FAZ A;  2ZCB A;  2ZJD A;  2J0M A;  4OVV A;  3U7D A;  3VTU A;  4BOS C;  5C1Z A;  2AL6 A;  2R2O A;  4BVU C;  2FIF A;  4HDO A;  1I35 A;  1GUA B;  3ENE A;  1WGR A;  2D2Q A;  3OAW A;  4FJY A;  2KWC A;  2BGF A;  3T8M A;  4LJO B;  5CHW A;  2K8B A;  2RGF A;  3ZNI D;  2IY0 B;  3EFU A;  1V9J A;  3H6N A;  4JLC A;  5KHO A;  3ZNG C;  1WY8 A;  2O2V B;  2WX0 A;  4IWP A;  3NOB A;  4W9I A;  2CU1 A;  2FCS A;  4HPL B;  2MQJ A;  3T9L A;  3UF8 A;  3R66 C;  4MGZ E;  4B9K A;  2N1W A;  2PE6 B;  3RZF A;  5DPW A;  1P0R A;  1X1M A;  4DWF A;  4EEW A;  1YX5 B;  2MWS B;  3R3M A;  1WX8 A;  4IC7 B;  1FXT B;  4X57 B;  3VVW B;  3W1S A;  4XX5 A;  3PVL A;  3RUL A;  2KDB A;  3QJZ A;  2M4N A;  2O6V B;  4IG7 B;  4NQL B;  2KKC A;  4FHJ A;  3A1Q A;  4MH0 E;  1WJ6 A;  3MTN B;  3ZRC A;  4F8C B;  3A9J B;  3VAW A;  4GDK B;  4KSL C;  2K25 A;  4AJY B;  2R2Q A;  3D32 A;  3PV1 A;  1WJU A;  4E71 A;  5E6P A;  2KLG A;  2ZPN A;  1KLV A;  2EKE C;  2Z59 B;  2C5L C;  3HM6 X;  3AI5 A;  4EZL A;  5TR5 A;  2WX1 A;  3ZRF A;  2KJH B;  4M0W B;  4NQK E;  2NVU I;  2K8C A;  3R7R A;  1WX9 A;  3KW5 B;  1K8R B;  2ASQ A;  1WZ3 A;  1V81 A;  2K8H A;  3H1U A;  3KVF B;  4I6N B;  5C23 A;  2IO1 B;  3ECI A;  3ZO5 B;  3O65 B;  1P3Q U;  4M8M A;  1SIF A;  1UH6 A;  2KHW B;  3DBL I;  4MEL A;  4BKS D;  1C1Y B;  1WJ4 A;  3A4S C;  4DXA B;  1C3T A;  1WGY A;  1WGD A;  5AEK B;  5FR6 A;  1L2N A;  1WGH A;  2ZNV C;  5J18 A;  4DHJ B;  2LUE A;  1WXA A;  1UGM A;  1SE9 A;  1Y8R C;  2NCN A;  3QX1 A;  4RM9 A;  3V6C B;  2O2V A;  5KHQ A;  4MEM A;  1TZ1 A;  1ZKH A;  4GIV A;  4ZYN A;  3GZN I;  5G55 A;  1U4A A;  2EMS A;  2KC2 A;  2OJR A;  2MBQ A;  2LRU A;  3VUX A;  3UQB A;  1UBI A;  5D7G A;  5D6J B;  3RUI B;  2LXC A;  1VD2 A;  3SHQ A;  3L08 A;  5JHA A;  4EFO A;  2KTF A;  2BF8 B;  2KTR B;  2N7E A;  2LVO A;  3PTF C;  5DPS A;  3ZIM A;  2O6V A;  1H4R A;  3A4R A;  4HCN B;  4B95 A;  2D07 B;  1WZ0 A;  2J7Q B;  1I42 A;  2N4F A;  4JGH B;  3PHX B;  2KMA A;  3A9J A;  4P7I A;  2IO2 B;  1NDD A;  2FNJ B;  4GDK A;  3L13 A;  2JVC A;  4KIK B;  2KFJ A;  1RLF A;  2DX5 B;  2XEW A;  4HLE A;  1GG3 A;  1E8Z A;  5L95 C;  1ZGU B;  3B0A A;  3EC8 A;  2KZR A;  4ZDV A;  2B3A A;  4LDT D;  4XC2 A;  1LFD A;  4WWO A;  2KLC A;  4G11 A;  4IW0 A;  4PYU A;  2LVQ A;  4NY0 A;  3BIN A;  3PRE A;  2K6Q A;  1UBQ A;  1GC7 A;  3WAO A;  1V5O A;  2FCM A;  3IHP C;  2LGD A;  4GGQ A;  3ML9 A;  1OEY A;  3ZKJ C;  1LXD A;  4NAW B;  2G4S A;  4NNJ B;  4KZC A;  4ICU A;  3S2A A;  4EZJ A;  3M3J A;  1IPG A;  2V4L A;  3L54 A;  4GN1 A;  3ZTD A;  2BYV E;  2KX0 A;  3HHM A;  3VUY A;  4PYZ A;  1WR6 E;  4B6W A;  3ZTC A;  2JZ3 B;  3DVG Y;  1E8W A;  4W9F A;  2ZPY A;  4FJV B;  2K1F A;  2DYM A;  4KV2 A;  2MCN B;  2CKH B;  4IWQ A;  3V60 A;  2D3G A;  4JL9 A;  4J6I A;  4W9H A;  2MBO A;  1CMX B;  2MLB A;  4IM3 A;  3ZUN A;  3QCA A;  2KTR A;  2AYO B;  3B1L X;  5AZF A;  3AUL A;  4GSW A;  4GXB A;  3VTW A;  5IAA C;  3PRZ A;  1F9J A;  4PS3 A;  1E8X A;  4W9D A;  1HE8 A;  1E7V A;  1EF1 A;  4G3X B;  4EKU A;  5EDS A;  2K6D B;  1R4M I;  2FCQ A;  4GB9 A;  2KAN A;  4KIK A;  3APD A;  2CHZ A;  3KUZ A;  1Z2M A;  2UYZ B;  4JIO U;  1E5W A;  2KD0 A;  2HD5 B;  2C60 A;  4AP4 C;  4ICV A;  4AUQ C;  1P1A A;  1WR1 A;  3X0W A;  1H8C A;  3GOE A;  2KXJ A;  2XK5 B;  4TUU A;  4WWN A;  3RCZ A;  1IYF A;  3PZD A;  1WGG A;  3H9D A;  2GOW A;  1V80 A;  3PRP B;  3QHT A;  4WAA A;  2NR2 A;  1AAR A;  3DOW A;  3WAL A;  4DHZ E;  4E74 A;  4F7Z A;  1D3Z A;  4NAW A;  2AEH A;  2YLM A;  4BBN C;  3JYU A;  3K9O B;  2C7N B;  4DHZ B;  3M95 A;  2KDI A;  3RT3 B;  4NJ7 A;  3WA0 A;  1E7U A;  2A4Z A;  4HXD A;  2ZVO A;  3ZNZ B;  1WYW B;  1YX6 B;  4EZK A;  2NBW B;  1RRB A;  1J19 A;  3RYT A;  4G0N B;  3JW0 X;  3QIJ A;  3V6E B;  2W9N A;  2LRW A;  3UIP B;  2KFK B;  1MG8 A;  1OGW A;  2CHW A;  2V3S A;  3NY5 A;  3UIO B;  1GJZ A;  3UIN B;  3ML8 A;  1Z5S B;  4FHK A;  5D94 A;  2JY6 A;  2K39 A;  3ZDT A;  4DBG A;  3ZNH B;  4GU2 A;  3QAQ A;  4MSQ B;  3PHW B;  1NI2 A;  2JUO A;  3TCA A;  1WE6 A;  3TL5 A;  2KC1 A;  2UWQ A;  3ZLZ A;  2ZZP B;  5LXI B;  4W9J A;  1WI0 A;  2GBJ A;  5DCN A;  1TGZ B;  2DYB A;  4W9G A;  1BT0 A;  3DBR I;  2XK5 A;  5J2R A;  2JRH A;  3VHT C;  4ZRI A;  2L0T A;  1A5R A;  1WIA A;  2FID A;  2GBK A;  1WMH B;  2LVP A;  3DDC B;  2RD0 A;  3HIZ A;  3W1S C;  4FA6 A;  4I6L B;  3SU8 X;  4MGY E;  4TV3 A;  2D11 A;  1TBE A;  1WM3 A;  3Q3J A;  3L0W B;  3K9P B;  3PPA A;  4BBN F;  4HVB A;  1V6E A;  2MW5 A;  3JSV B;  4HWI B;  2BWE S;  5IA7 A;  4DK5 A;  3TJP A;  3IFW B;  5L83 A;  1WFY A;  2G4D B;  3VFK A;  1GC6 A;  2J0J A;  4IM0 A;  2J0K A;  3OJ3 A;  3VQI A;  1R4N I;  4WJN A;  2BWF A;  3BY4 B;  1J0G A;  4KSK C;  3CST A;  1L7Y A;  4NPN A;  4DDI D;  3WAP A;  2EMT A;  2I1K A;  4GMV A;  1OQY A;  2GBN A;  2C9W B;  3ONS A;  4DDG D;  4ANX A;  2KFK A;  4HPM B;  5HKH A;  4RM8 A;  4KDL B;  2WWZ A;  1E90 A;  2OOB B;  3C0R B;  4HJK A;  1V86 A;  4N9F 4;  2KDF B;  1J8C A;  1XD3 B;  3LDZ E;  3PGE A;  3V61 A;  4AOF A;  3QK0 A;  4AJW A;  4ANV A;  3KH0 A;  1RAX A;  4W9C A;  3R7Q A;  1YIW A;  1Q0W B;  2LGX A;  3EHV A;  2MA9 B;  1XT9 B;  2GBR A;  3VXW A;  5GMV A;  3M62 B;  2MBE A;  2L05 A;  1EUV B;  3IVF A;  1WJN A;  2AWT A;  4HK2 A;  3UGB B;  3VTV A;  5LLI A;  2NS5 A;  2XBB C;  3WAM A;  3QA8 A;  2KQS A;  2RPQ A;  1WMH A;  2G3Q B;  2KWV B;  3LJ3 A;  4WQO B;  5DPR A;  1UD7 A;  4MSM B;  3WAN A;  4A3O A;  2ZNV B;  4I6P A;  2BYF A;  3U8Z A;  5J17 A;  2M17 A;  2GBM A;  2RR9 A;  4NJ6 A;  2DYO A;  2VRR B;  3ZW3 A;  3A9K B;  3RZW C;  4LJP B;  1UEL A;  2KMC A;  3JSV A;  4KZ0 A;  2N1V A;  2HJ8 A;  2MSE D;  1WRD B;  4RMA A;  1UZX B;  1KOT A;  2KJ6 A;  2N9P C;  2NBU A;  2V1Y A;  5JH5 C;  3NHE B;  2IBI B;  2LI5 A;  2JT4 B;  3AU5 A;  4FJZ A;  4W9K A;  3QAR A;  4E3C A;  4II2 B;  3L10 B;  4LDT B;  5CX3 A;  2NPT B;  4HDQ A;  4TQ1 A;  2O6V D;  2DZM A;  2MBB B;  4BOZ B;  2Z0D B;  5BO4 B;  3ZDM C;  1V2Y A;  1E8Y A;  2DZJ A;  2M1M A;  4BKS A;  1Q1O A;  3VH3 B;  4TKN A;  2BPS A;  4K7W A;  2N9E B;  4MM3 A;  3NZS A;  3JVZ X;  2GMI C;  1KJT A;  3QQ8 B;  4PS7 A;  2WYQ A;  1SGH A;  1WF9 A;  3A33 B;  5DPT A;  2Y5B B;  3TIX A;  3DPD A;  4OVU A;  4K7S A;  4IWO A;  4JQW C;  4F1S A;  2LAS A;  4GOC A;  3NS8 A;  2DZI A;  2KK8 A;  3VH4 B;  2LWP A;  4WJO A;  2M8S A;  2PJH A;  5CHV C;  3V62 A;  3AU4 A;  2MP2 B;  4MGI E;  2JXX A;  2JZZ A;  4K81 A;  4DHJ D;  4M8N A;  4MGK E;  1P98 A;  3MHS D;  3N30 A;  2BKF A;  3PRM B;  5AZG A;  4TQ0 A;  4BFR A;  2YVC A;  1VCB A;  4FUL A;  2LXA A;  3A9K A;  2N9X A;  1GNU A;  1WH3 A;  4HCP B;  3QWZ B;  1JRU A;  3WIM A;  2DHZ A;  5LXH A;  1T0Y A;  3IG3 A;  4A20 A;  3N32 A;  2IY1 B;  1KM7 A;  3EEC A; 
#chains in the Genus database with same CATH topology
 3BVG A;  5FR3 A;  3ZGZ A;  2IO0 B;  1NBF C;  2D10 A;  4R3D A;  1HZ6 A;  4KKI A;  3P4S B;  3N1X C;  2MRP A;  4A6Q A;  5CTR C;  2V3P A;  1ZXH A;  2N7D A;  4IM2 A;  3Q3F A;  3NVW A;  1IGC A;  3IAM 1;  1WM2 A;  1ESF A;  2WDR B;  3ZVV A;  4WJP A;  3HVZ A;  1SXT A;  1WXV A;  2KWD A;  2CHX A;  2KDE B;  1NYQ A;  5CHF A;  3KYD D;  3H7P B;  1S1Q B;  2DZK A;  1PQS A;  1N61 A;  2M0X A;  3BVM A;  1ENF A;  4FAD A;  3DBS A;  2EEL A;  3P42 A;  1BUI C;  1V1P B;  2IZV B;  2JWZ A;  5E6N A;  4IUM B;  3HK0 A;  1JRO A;  4B0M A;  3OLM D;  3DVN U;  2C7H A;  5E6O A;  2L8J A;  2KX3 A;  4WJQ A;  2WXG A;  3AEA B;  3PLV A;  3VDZ A;  5C3J B;  1PFD A;  2BS2 B;  2L76 A;  3T3O A;  3IBE A;  4FLH A;  3CMM B;  4EOY A;  2CS4 A;  3A1Q B;  3RD2 A;  4GLS C;  1LQB A;  3SDL C;  5LNK 1;  1GAQ B;  2I1J A;  1ZP0 B;  3VTU A;  1FRR A;  2BVC A;  1YN3 A;  1ACC A;  3PZ8 A;  3U52 E;  3O13 A;  2RGF A;  3ZNI D;  2IY0 B;  4ARI A;  1QIL A;  1C4C A;  4JLC A;  5KHO A;  1WY8 A;  1WSP A;  4JX1 C;  1X1M A;  4BZA A;  1PGX A;  3RUL A;  4IOI E;  2KDB A;  2WXO A;  3HUI A;  1MI0 A;  3A9J B;  3FC4 A;  4AJY B;  2R2Q A;  4MAC A;  2ONQ A;  3ETR A;  1KLV A;  4EZL A;  3AI5 A;  2WX1 A;  4P1C C;  2KJH B;  3KW5 B;  4WAF A;  2K8H A;  4I6N B;  3KVF B;  3ZO5 B;  3O65 B;  1XLQ A;  1C1Y B;  4DXA B;  1WGH A;  5J18 A;  4DHJ B;  2Y5P A;  2KVZ A;  1U4A A;  2KC2 A;  2OJR A;  2MBQ A;  2WXL A;  1QKZ A;  4NAM A;  1UBI A;  5D6J B;  3SHQ A;  3E56 A;  3L08 A;  2KTF A;  2O6V A;  2AQ1 B;  3A4R A;  3T3N A;  1FD6 A;  2D07 B;  5C2T B;  2N4F A;  1KF6 B;  2V0G A;  4RGO S;  4KIK B;  1YNT E;  2DX5 B;  5JXV A;  2RDB C;  4M0W A;  4M00 A;  2K22 A;  3VRA B;  4XYC A;  4LDT D;  3URY A;  4IDI A;  4UDU C;  1RWS A;  2K3U A;  3WAO A;  1GC7 A;  3FIL A;  2LGD A;  3ML9 A;  1OEY A;  1LXD A;  2G4S A;  3CWI A;  4TMA B;  3M3J A;  1IPG A;  2V4L A;  4GN1 A;  1FNU A;  3VUY A;  1IGD A;  1E8W A;  4FJV B;  2PW9 A;  2MCN B;  4IWQ A;  2KN4 A;  4JL9 A;  4W9H A;  2MBO A;  2KAC A;  2KTR A;  3B1L X;  3AE5 B;  3AUL A;  1DOI A;  3VTW A;  3SEB A;  1F9J A;  1TJE A;  1SEB D;  4WH4 A;  5EDS A;  3IT6 B;  3C8Y A;  2AX5 A;  3R2T A;  1P1A A;  1WR1 A;  3GOE A;  3RCZ A;  4WWN A;  1IYF A;  3PZD A;  3H9D A;  2D5G A;  2XNA C;  3PRP B;  2BBC A;  4WAA A;  5MPO A;  2DBY A;  4NAW A;  2AEH A;  4BBN C;  5IOI A;  1N60 A;  1E10 A;  4DHZ B;  2KDI A;  2KQ4 X;  1HTO A;  1E7U A;  2A4Z A;  4HXD A;  1VRA B;  3PO0 A;  2RPV A;  3V6E B;  1LO5 D;  1MG8 A;  2V3S A;  1TKY A;  1GJZ A;  3N9Y C;  1Q10 A;  2K39 A;  4DBG A;  3ZNH B;  4GU2 A;  2W55 A;  4OHJ A;  5HI1 A;  1FIQ A;  1WE6 A;  1JWS D;  2KC1 A;  3BII D;  2ZZP B;  4L23 A;  4W9J A;  1WI0 A;  5DCN A;  2H89 B;  3NJT A;  4W9G A;  1SJH D;  2PMV A;  1A5R A;  1YQ4 B;  2GBK A;  2LVP A;  2ON8 A;  4KX6 B;  3HIZ A;  4S17 A;  2INC C;  2JX5 A;  2BS4 B;  4TV3 A;  4YSY B;  1I4P A;  1TS5 A;  3K9P B;  4L1B A;  1V6E A;  4HKQ A;  3JSV B;  2BWE S;  1D6E C;  3IFW B;  5DPW A;  2G4D B;  3VQI A;  1R4N I;  1PGB A;  2V3N A;  4DDI D;  4WIP A;  2GBN A;  3ONS A;  1F0Z A;  4ANX A;  3AB5 A;  5EE3 A;  4HJK A;  2ICI A;  2DLB A;  1RFK A;  3PGE A;  4MM3 B;  2JSV X;  2GBR A;  3VTV A;  3AED B;  5LLI A;  2NS5 A;  1IUE A;  3QA8 A;  3LJ3 A;  1WMH A;  4WQO B;  1UD7 A;  2ZNV B;  3U8Z A;  1KLU D;  4NJC A;  4NJ6 A;  5HHD G;  5IKC M;  1SBB B;  2VRR B;  2H88 B;  1SSN A;  2N7J A;  1KOT A;  2LHD A;  4XWW A;  1BXT A;  2INP E;  3AE4 B;  2JT4 B;  1FFV A;  3QAR A;  4E3C A;  3NZ3 A;  4AS1 A;  4P6V F;  4LDT B;  2NPT B;  4TQ1 A;  3KLS X;  2MBB B;  4XDD A;  1CZP A;  3JVZ X;  4PS7 A;  1N62 A;  1UNS A;  1WF9 A;  2HDE A;  3DPD A;  4K7S A;  4M01 A;  3Q3O C;  2LAS A;  4WJO A;  3NUH B;  2FE8 A;  4QAY A;  2JXX A;  2JZZ A;  2WU5 B;  4N59 A;  3PRM B;  2YVC A;  4WQM A;  3U2S C;  1C79 A;  1WH3 A;  1JRU A;  1QOG A;  2DHZ A;  2UU7 A;  1QOF A;  1KM7 A;  3NOB A;  2JRI B;  4G50 A;  4W9L A;  1BML C;  2CJO A;  3HM3 A;  4MJS B;  3P2B A;  1YD8 U;  4LNF A;  2MX2 A;  3AEC B;  2ZCC A;  1TKE A;  4AWJ A;  1GB1 A;  3U30 A;  2NBV B;  4ANW A;  1YOV B;  3QC8 B;  4NZL B;  2MP2 A;  3BYT B;  4KDI C;  4RH6 A;  4FBJ B;  4L2Y A;  1D4B A;  1K51 A;  1AN8 A;  4MDK E;  1P9D U;  3DBH B;  2N9K A;  2BYT A;  2L00 B;  2L7R A;  4GDL B;  4PS8 A;  3PSE B;  3L16 A;  2REX A;  3BWU D;  1F52 A;  1RYJ A;  3DVG X;  2DEN B;  4M02 A;  4HEA 1;  1M94 A;  1FCC C;  3W5U B;  3N20 C;  1JAL A;  2PKO A;  2RMM A;  4K7U A;  2CR5 A;  4XZ4 A;  3ZXR A;  5G2N A;  2KNB A;  2PE9 A;  3PLU A;  2JQR B;  1L0X B;  3KYC D;  4II3 B;  5AZH A;  2K5P A;  2HTH A;  2KOX A;  2NTS A;  5G5H A;  3APF A;  3PS6 A;  3DQV A;  2WDT B;  4LNI A;  1S3S G;  2JWU A;  2NTT A;  2KO3 A;  3DCG A;  1D5Z C;  1XQQ A;  2WS3 B;  3DBH I;  1FM0 D;  3H7P A;  2ZJD A;  4OVV A;  4BOS C;  3U7D A;  3EUB 2;  1JML A;  2R2O A;  4BVU C;  2WXJ A;  4HDO A;  4ARC A;  3RN9 C;  4FJY A;  2KWC A;  3DBL B;  1HZ5 A;  2VZK D;  4LJO B;  4LNO A;  5BMH A;  1V1P A;  3H6N A;  3I57 A;  4W9I A;  2CU1 A;  4HPL B;  3UF8 A;  1TY2 A;  4B9K A;  4Q2J A;  1EU3 A;  3U7Z A;  4EEW A;  2MWS B;  1FXT B;  2WXM A;  1NVI D;  2W3S A;  4XX5 A;  2M4N A;  2KKC A;  4FHJ A;  3A1Q A;  4MH0 E;  2ACZ B;  3MTN B;  1TS4 A;  4XGA B;  4F8C B;  1V8C A;  4KSL C;  2K25 A;  2DNF A;  1TS2 A;  3TEX A;  5E6P A;  3AEF B;  4XDC A;  3HM6 X;  3B2F A;  3MC8 A;  1WYG A;  4YXD B;  4JPS A;  2K8C A;  2QSD A;  4M8M A;  3N1Y C;  2KHW B;  3DBL I;  4BKS D;  2MJE A;  3AE9 B;  1ZPS A;  1L2N A;  2QIE B;  2ZNV C;  1NEN B;  2D3A A;  2LUE A;  4REZ A;  1UGM A;  1SE9 A;  4RM9 A;  3IT4 B;  4MEM A;  1ZKH A;  4ZYN A;  3RI7 C;  2W54 A;  5G55 A;  1YN4 A;  1Y56 A;  1JW9 D;  4B0E A;  2LRU A;  2GLS A;  3RUI B;  1MPE A;  4YTN B;  4EFO A;  2BF8 B;  2PIA A;  3ZIM A;  5DPS A;  1H4R A;  4HCN B;  1I42 A;  2BTE A;  3PHX B;  3A9J A;  2IO2 B;  2JVC A;  2KFJ A;  2WLB A;  1E8Z A;  1PUT A;  3B0A A;  4KKJ A;  4ZDV A;  2B3A A;  4WWO A;  2KLC A;  4IW0 A;  1STE A;  4YT0 B;  3BIN A;  3PRE A;  1UBQ A;  3IHP C;  1TKG A;  3ABV B;  1UWM A;  4OZB A;  4ICU A;  3Q3N C;  4EZJ A;  2J42 A;  3L54 A;  3ZTD A;  3HHM A;  4S0R A;  1TYG B;  4J3O D;  3ZTC A;  4ACF A;  3DVG Y;  4W9F A;  2K1F A;  2QCZ A;  1QF6 A;  2D3G A;  4J6I A;  4A55 A;  3EA6 A;  3MHZ A;  4IM3 A;  2AYO B;  4GXB A;  5IAA C;  1E8X A;  4W9D A;  1E7V A;  1EF1 A;  4G3X B;  4EKU A;  2K6D B;  4GB9 A;  1MFW A;  3APD A;  4KIK A;  1FCL A;  1Z2M A;  2UYZ B;  4JWS C;  1C9F A;  2J52 A;  3DBR B;  1SJE D;  2WU2 B;  3MC9 A;  1XCT L;  1ET9 A;  2NR2 A;  3DOW A;  1C77 A;  1XXG A;  1XCQ L;  3M95 A;  5H92 C;  2WDV B;  3RT3 B;  4NJ7 A;  4AQ7 A;  4EE2 A;  3WA0 A;  1JRP A;  4D2K A;  1HQR D;  1YX6 B;  1RRB A;  1J19 A;  2WP9 B;  3RYT A;  3HVD A;  3JW0 X;  2LRW A;  2CU3 A;  3NRZ A;  3GB1 A;  2KFK B;  1KRH A;  1OGW A;  2CHW A;  2TSS A;  2VZK B;  4C56 C;  1Z5S B;  5D94 A;  2D3B A;  2JY6 A;  1QLB B;  1TY0 A;  4P1B C;  5HG2 A;  1CQV A;  3QAQ A;  5EE1 A;  3IXS A;  3PHW B;  3TL5 A;  2UWQ A;  3ZLZ A;  2GBJ A;  5D3D A;  2LGS A;  1BT0 A;  3DBR I;  4RGM A;  5J2R A;  1XLN A;  3RNE C;  3FKY A;  3BK1 A;  3AV8 A;  3W5V B;  3DDC B;  2Y5C A;  1WM3 A;  3Q3J A;  3PPA A;  4HVB A;  2JU6 X;  1XLP A;  2KMM A;  3BZD B;  5H8Y E;  1L7Y A;  1IBX B;  2M56 B;  4YSX B;  4DDG D;  1OQY A;  2C9W B;  4KDL B;  4A9A A;  1E90 A;  1V86 A;  1J8C A;  4LK0 M;  3Q8E A;  1K50 A;  4KGS A;  1JCK B;  1XD3 B;  1M4V A;  3QK0 A;  4AJW A;  4N58 A;  3GS2 A;  3R7Q A;  2LGX A;  3VXW A;  1N5X A;  5GMV A;  3RNG C;  2L05 A;  1EUV B;  1EWY C;  1WJN A;  1YJJ A;  1XLO A;  3LB8 C;  1EM7 A;  5DPR A;  3W9C B;  3KQ4 A;  3A9K B;  1UEL A;  2KMC A;  3JSV A;  1WRD B;  4K3B A;  1YJI A;  1AW7 A;  2N9P C;  2NBU A;  2V1Y A;  3I5J C;  4W9K A;  2ZW1 A;  4II2 B;  3L10 B;  1D5M C;  3TEZ A;  2AQ3 B;  5CX3 A;  4HDQ A;  2DZM A;  3AE7 B;  1WGK A;  2DZJ A;  1Q1O A;  5BMG A;  4TKN A;  2BPS A;  4MM3 A;  2N9E B;  4RGN A;  1T0S C;  2WHI A;  1SGH A;  1UUP A;  4IWO A;  2QDF A;  5BMI A;  2KK8 A;  1QT9 A;  1R4N B;  3AU4 A;  4ZRQ A;  2MEK A;  4YTM B;  5FK9 C;  5AZG A;  1QOB A;  4TQ0 A;  4BFR A;  1VCB A;  2EKI A;  2N9X A;  1VLB A;  4HCP B;  3TUO A;  1T0Y A;  1MG4 A;  3IG3 A;  3N32 A;  2SAK A;  4OZA A;  2IY1 B;  1OFF A;  1ZW7 A;  2G45 B;  2OJW A;  3H7S A;  2NPT A;  2JF5 A;  2L32 A;  3CF6 E;  2LMC A;  1WX7 A;  3W1Y A;  1V49 A;  5JHB A;  1V5T A;  3VUW A;  4URK A;  1QZE A;  3UQA A;  2MBH A;  4ASW C;  3NVV A;  3L4P A;  4DXF A;  2KN5 A;  2PVO D;  3SD5 A;  5BYQ A;  4ANU A;  2ZVN A;  3DVN V;  2OHF A;  2A5U A;  2G1E A;  2FCN A;  1YJ1 A;  1E0Z A;  3DWM A;  2HE7 A;  1TTN A;  2BKR B;  2KWU B;  3VRB B;  1WE7 A;  2JPH A;  2RSU A;  4US9 A;  3B9J A;  4WWP A;  5JZE B;  4MJS A;  3APC A;  3KUC B;  3ALB A;  4WWM A;  4FN2 A;  1YQ3 B;  3MJW A;  1G6J A;  2ZEQ A;  1HA5 A;  1P7F A;  2PEA A;  3B08 A;  1YN5 A;  3Q2A C;  1ISN A;  2DAF A;  4ZRJ A;  2WXR A;  5D2M B;  1OTR B;  2MH7 A;  1WXS A;  1QQR A;  3AXC A;  4K1R B;  2QHO A;  2KJR A;  4KVG B;  3Q8C A;  3OWE B;  4EUT A;  5IN7 A;  1IP9 A;  4WUR A;  5EE0 A;  1UF0 A;  1LM8 B;  4GDL A;  3KUD B;  2FAZ A;  2ZCB A;  2J0M A;  2N0S B;  5C1Z A;  4MT5 A;  2FIF A;  3RNF C;  1I35 A;  4C4V B;  1YMH E;  2D2Q A;  4MH8 A;  4LTU A;  3EFU A;  5HFY A;  1V9J A;  1JWA D;  3ZNG C;  2O2V B;  4HPP A;  2FCS A;  3T9L A;  4MGZ E;  2PE6 B;  3NG0 A;  4A8X C;  4DXG A;  4DWF A;  1YX5 B;  3R3M A;  3VVW B;  4IC7 B;  3PVL A;  1RM6 C;  4DQO C;  3QJZ A;  3I63 C;  3AE2 B;  4NQL B;  1T3Q A;  3ZRC A;  2PTL A;  3VAW A;  4GDK B;  2PLP A;  3D32 A;  4E71 A;  1WJU A;  2KLG A;  2EKE C;  1SF0 A;  2Z59 B;  2BT6 A;  2C5L C;  3V05 A;  5TR5 A;  4YWG G;  4NQK E;  1K8R B;  2X8X X;  2ASQ A;  3H1U A;  2L1A A;  5C23 A;  1FPY A;  2IO1 B;  1P3Q U;  2LJI A;  1SIF A;  4MEL A;  2ZW0 A;  1WJ4 A;  1C3T A;  2NMQ A;  1WGD A;  4OZC A;  1Y8R C;  3QX1 A;  2NCN A;  2WXI A;  2SEB D;  3V6C B;  5KHQ A;  1TZ1 A;  2W82 A;  3SR6 A;  3VUX A;  1VD2 A;  2N7E A;  2LVO A;  3PTF C;  3Q8B A;  4JWU C;  2IGD A;  4C80 A;  5AUK A;  4B95 A;  2J7Q B;  3AMZ A;  4ZRP A;  4JGH B;  2KMA A;  1R4M B;  1NDD A;  3L13 A;  2XEW A;  1GG3 A;  1ZGU B;  3EC8 A;  1NI3 A;  2KZR A;  1FNV A;  4XC2 A;  4PYU A;  1LGR A;  1QOA A;  2LVQ A;  1V5O A;  3KWV A;  4GGQ A;  5TSS A;  4NNJ B;  4KZC A;  3RNC C;  3MFG A;  3GE3 C;  2CJN A;  2BYV E;  2KX0 A;  1AYF A;  3IAS 1;  3ZQ4 A;  1WR6 E;  2FUG 1;  2JZ3 B;  1L6U A;  1L4Z B;  2ZPY A;  2DYM A;  3N1Z C;  2WNM A;  2J4X A;  3V60 A;  3EGR A;  2MLB A;  1CMX B;  3ZUN A;  3QCA A;  5T8I A;  5GXG B;  5AZF A;  4OW0 A;  3GP7 A;  4GSW A;  3PRZ A;  1FXI A;  2WXP A;  3HRD D;  1R4M I;  2KAN A;  1XO3 A;  4JIO U;  2KD0 A;  2WDQ B;  2HD5 B;  1H8C A;  4RGT A;  2XK5 B;  1P7E A;  3GE8 C;  1WGG A;  1DOX A;  2GOW A;  1V80 A;  3QHT A;  2MJD A;  4DHZ E;  1WXQ A;  2YEP F;  3FAH A;  1J7A A;  1ZOY B;  4USA A;  2LFI A;  1ZDX A;  2YLM A;  3JYU A;  3K9O B;  2C7N B;  4PT5 A;  2JYE A;  5E6J A;  3BYY B;  4EZK A;  1UWX A;  1PYW D;  4G0N B;  3QIJ A;  2W9N A;  3MP9 A;  2JYT A;  3UIO B;  1MVK A;  3ML8 A;  1NEK B;  3PZ7 A;  4MSQ B;  1VJK A;  1NI2 A;  2JUO A;  3TCA A;  1HTQ A;  2DYB A;  3LYY A;  2IPK D;  2LUM A;  2JRH A;  2L0T A;  4LLG M;  2FID A;  2VH2 A;  5BYR A;  2RD0 A;  1NYR A;  3W1S C;  4FA6 A;  4I6L B;  3P63 A;  5G5G A;  2D11 A;  2IGH A;  1TBE A;  2BB6 A;  4HWI B;  2MW5 A;  5IA7 A;  4DK5 A;  1C4P A;  2L52 A;  3VFK A;  2J0K A;  3OJ3 A;  4P16 A;  1J7C A;  3BY4 B;  1J0G A;  4KSK C;  3CST A;  2B76 B;  1R7S A;  2EMT A;  2I1K A;  4GMV A;  5HKH A;  2KFK A;  1E6E B;  4RM8 A;  3C0R B;  1I4H A;  2KDF B;  4PK1 A;  1DYQ A;  4AOF A;  4ANV A;  3KH0 A;  1YIW A;  1EU4 A;  3RNA C;  2MA9 B;  1XT9 B;  1XEE A;  3M62 B;  1F1H A;  2AWT A;  4HK2 A;  1N6Z A;  3ZJU A;  3WAM A;  2RPQ A;  2JZP A;  1GOZ A;  3WAN A;  2GRI A;  4A3O A;  2BYF A;  5J17 A;  2M17 A;  2GBM A;  2RR9 A;  2DYO A;  1A70 A;  3ZW3 A;  1B9R A;  3RZW C;  1F2R I;  4KZ0 A;  2HJ8 A;  2MSE D;  3ZJT A;  2N9L A;  4RMA A;  1UZX B;  1MJD A;  2WXH A;  3AU5 A;  2QEJ C;  2IJ0 A;  1IBX A;  2O6V D;  3ZDM C;  1E8Y A;  2M1M A;  4BKS A;  3RPF C;  2WQY B;  3VH3 B;  3E9S A;  3NZS A;  2GMI C;  2I38 A;  3QQ8 B;  2WYQ A;  3DHH C;  4HJG E;  2Y5B B;  2Q5W D;  4A90 A;  4OVZ A;  4GOC A;  1MHX A;  2DZI A;  1OQQ A;  2IDY A;  5CHV C;  3V62 A;  3CIR B;  1SE3 A;  2YEP B;  4HRO A;  1B1Z A;  4K81 A;  4M8N A;  2BB5 A;  4RF1 A;  2KAJ A;  3N30 A;  2BKF A;  1L0Y B;  4K3C A;  3A9K A;  3V3X A;  1GNU A;  5LXH A;  3QWZ B;  4ZHO A;  1WWT A;  4A20 A;  1FMA D;  3EEC A;  1I4X A;  3X23 A;  3L17 A;  4BKG A;  2IND C;  1ZE3 D;  1EO6 A;  2V9H A;  3AE6 B;  5I4D A;  1SIJ A;  3R2I A;  1Q5W B;  1C78 A;  3P4Q B;  2GI9 A;  2V4I B;  2DAJ A;  1OEY J;  1FFU A;  4YL8 A;  2C7M B;  3TMP B;  3PT2 B;  1T6B X;  3OJ4 B;  4FXC A;  4KGT A;  4BKT A;  1TZO A;  3CSF A;  1I4Q A;  2LZ6 A;  2PPH A;  4W9E A;  3SFE B;  1FO4 A;  2KT7 A;  4C00 A;  1SE4 A;  2INN E;  4ZHP A;  4RCO A;  5D3I B;  1EF5 A;  1PGA A;  4CYE A;  2FUH B;  2Z0E B;  1T5X D;  2AL3 A;  3N3K B;  3ZXV A;  3LXF A;  2JXT A;  2LGY A;  4ZRK A;  2BS3 B;  2HJ1 A;  1F77 A;  3AEB B;  1WXM A;  3M63 B;  4C7Z A;  2QIL A;  2LJ5 A;  1HEZ E;  2LD9 A;  3BK2 A;  4YSZ B;  2BYE A;  3TBL D;  1E7P B;  1JWU D;  2L3Z A;  3EFC A;  3NZU A;  3DHG C;  4O1N A;  2MJ3 A;  4CHK A;  2IYD B;  4ZOH C;  1RFA A;  4CO7 A;  2KVR A;  4HLE A;  1YQB A;  2E3T A;  2Z8L A;  3AE3 B;  4A3P A;  1N63 A;  1J7B A;  2IO3 B;  3I3T B;  4LCD E;  2KQ7 A;  2L0F A;  1VZ7 A;  1VZ8 A;  2AL6 A;  1HXY D;  3DWG C;  1GUA B;  3ENE A;  1WGR A;  3OAW A;  2BGF A;  3T8M A;  5CHW A;  5FKA C;  2XN9 C;  3Q8F A;  2K8B A;  4ZYS A;  1I4G A;  1C4A A;  1JQ4 A;  2WX0 A;  3GZN B;  1F2R C;  4HRS A;  1T0R C;  4IWP A;  2MQJ A;  1SE2 A;  3R66 C;  3RMK C;  2N1W A;  3RZF A;  2L83 A;  5IP4 D;  3TEY A;  1P0R A;  3NVZ A;  3P4P B;  1D5X C;  4X57 B;  3U4E G;  1WX8 A;  4HKZ E;  3W1S A;  4IG7 B;  3WCQ A;  2O6V B;  1E9M A;  3NVY A;  1WJ6 A;  4LNK A;  3PV1 A;  2WXN A;  2KYW A;  1ZXI A;  2ZPN A;  3ZRF A;  4M0W B;  3P4R B;  1VDV A;  2NVU I;  3R7R A;  1WX9 A;  1EWC A;  1DGJ A;  1WZ3 A;  4C4V A;  1V81 A;  3ECI A;  4XE0 A;  3FIL B;  3I9V 1;  3W2D A;  1UH6 A;  4N6E B;  3A4S C;  1WGY A;  4JE3 B;  5AEK B;  5FR6 A;  1VZ6 A;  1WXA A;  3DHI C;  2O2V A;  4GIV A;  3GZN I;  3AN1 A;  2EMS A;  2PVG C;  2QC8 A;  3UI3 A;  3UQB A;  5D7G A;  2LXC A;  5JHA A;  2KTR B;  4ITK A;  2IGG A;  3Q69 A;  1VR9 A;  1WZ0 A;  1WRI A;  4KGR A;  2QMT A;  4P7I A;  2FNJ B;  4GDK A;  2HTM E;  1RLF A;  5L95 C;  1GPX A;  1JWB D;  4LNN A;  1L4D B;  1FRD A;  1LFD A;  3B2G A;  4G11 A;  3SFD B;  4NY0 A;  4XWT A;  2K6Q A;  2FCM A;  3C19 A;  1ROE A;  3MJ5 A;  2FBW B;  3ZKJ C;  1L5P A;  1GB4 A;  4NAW B;  3S2A A;  4CQN A;  1CJE A;  4PYZ A;  4RF0 A;  4B6W A;  1KH0 A;  4KV2 A;  3AH7 A;  2CKH B;  3TSS A;  3AEE B;  2J53 A;  2I2Y A;  3AEG B;  4PS3 A;  1HE8 A;  2K0P A;  2FCQ A;  2AQ2 B;  2CHZ A;  1XF5 L;  3KUZ A;  1ZDV A;  1E5W A;  1MHH E;  2C60 A;  4AP4 C;  4ICV A;  4AUQ C;  3X0W A;  1AWD A;  2R61 A;  1CK1 A;  2KXJ A;  4TUU A;  1DOY A;  1C76 A;  1ET6 A;  4E74 A;  1AAR A;  3WAL A;  1D3Z A;  4F7Z A;  2X38 A;  3Q3M C;  2ZVO A;  2LGI A;  3ZNZ B;  2M0A A;  1WYW B;  2NBW B;  2KDM A;  1L6V A;  3AE1 B;  5AUI A;  1K53 A;  3UIP B;  2Y3A A;  3NY5 A;  2WXQ A;  5EE9 A;  3UIN B;  4FHK A;  1FXA A;  3ZDT A;  1V97 A;  2RDG A;  1FNW A;  3MC0 B;  3NS1 A;  2WXF A;  2MHJ A;  5LXI B;  2VH1 A;  1TGZ B;  1FEH A;  2XK5 A;  3VHT C;  4ZRI A;  1WIA A;  1I4R A;  1WMH B;  3SU8 X;  4MGY E;  3OG5 A;  1PDX A;  4C7Y A;  1TS3 A;  1T0Q C;  3L0W B;  4BBN F;  3ZYY X;  3AE8 B;  3RFZ B;  3TJP A;  2LHE A;  5L83 A;  1WFY A;  3J9C A;  1GC6 A;  2J0J A;  4IM0 A;  1OQR A;  3VR9 B;  4WJN A;  2BWF A;  4NPN A;  3WAP A;  2BW2 A;  3P1M A;  4H2A A;  2QJL A;  4HPM B;  2WWZ A;  2OOB B;  4N9F 4;  3ZJV A;  1N5W A;  3LDZ E;  3V61 A;  3Q6B A;  4IKG A;  4BAX A;  4TSS A;  1RAX A;  4W9C A;  3BVZ A;  1Q0W B;  3EHV A;  2M19 A;  2WGS A;  1KLG D;  2MBE A;  4YTP B;  3IVF A;  3UGB B;  2XBB C;  3KWL A;  2KQS A;  2G3Q B;  1I7H A;  2E6X A;  2KWV B;  5IO9 A;  4MSM B;  4I6P A;  2K9X A;  2GB1 A;  4LJP B;  2N1V A;  2KJ6 A;  5JH5 C;  3AM9 A;  3NHE B;  2IBI B;  2LI5 A;  4FJZ A;  1TIF A;  3RNB C;  2W3R A;  1KTK A;  4BOZ B;  2Z0D B;  5BO4 B;  1V2Y A;  1UGJ A;  4RNA A;  4K7W A;  3Q8A A;  1KJT A;  3A33 B;  3TIX A;  1KFY B;  3Q14 C;  4RFB A;  5DPT A;  5BYS A;  4OVU A;  2G9H D;  3VR8 B;  1JWM D;  3R8B A;  2BQQ A;  4JQW C;  4F1S A;  3NS8 A;  2OED A;  3VH4 B;  2LWP A;  2M8S A;  2PJH A;  2MP2 B;  4MGI E;  2DWQ A;  1SB3 C;  4DHJ D;  1K52 A;  2D3C A;  1L0V B;  4MGK E;  1P98 A;  3MHS D;  4FUL A;  2LXA A;  3TEW A;  3WIM A;  4US8 A;  2LEK A;  1ZUD 2;  2WXK A;  2RDH A;  1TT5 B;  1V1O A;  3H8H A; 
#chains in the Genus database with same CATH homology
 2JRI B;  1ZW7 A;  2G45 B;  2IO0 B;  3L17 A;  3X23 A;  4BKG A;  4G50 A;  3H7S A;  2NPT A;  2JF5 A;  1EO6 A;  4W9L A;  3HM3 A;  1Q5W B;  4MJS B;  3P2B A;  3CF6 E;  1NBF C;  1YD8 U;  2D10 A;  2MX2 A;  1WX7 A;  2DAJ A;  3W1Y A;  1V49 A;  5JHB A;  1OEY J;  4YL8 A;  2C7M B;  1V5T A;  3VUW A;  4URK A;  3TMP B;  3PT2 B;  1QZE A;  2MRP A;  2MBH A;  2ZCC A;  3OJ4 B;  3UQA A;  4ASW C;  5CTR C;  4BKT A;  4AWJ A;  2KN5 A;  2N7D A;  3CSF A;  3U30 A;  2NBV B;  4IM2 A;  4ANW A;  3SD5 A;  3Q3F A;  4ANU A;  2LZ6 A;  2PPH A;  2ZVN A;  4W9E A;  3QC8 B;  3DVN V;  1WM2 A;  2MP2 A;  2A5U A;  4KDI C;  2FCN A;  3ZVV A;  1YJ1 A;  4FBJ B;  4WJP A;  2HE7 A;  1WXV A;  1TTN A;  4MDK E;  1P9D U;  2BKR B;  2CHX A;  2KDE B;  1EF5 A;  2KWU B;  5CHF A;  2L00 B;  3KYD D;  2L7R A;  2FUH B;  2Z0E B;  4GDL B;  4PS8 A;  3PSE B;  4CYE A;  2AL3 A;  3H7P B;  3L16 A;  3N3K B;  1S1Q B;  1WE7 A;  2DZK A;  2REX A;  1PQS A;  2LGY A;  4ZRK A;  2JPH A;  2M0X A;  3DVG X;  2DEN B;  2RSU A;  1M94 A;  1WXM A;  3M63 B;  4WWP A;  5JZE B;  4FAD A;  3DBS A;  2LJ5 A;  2IZV B;  4MJS A;  2JWZ A;  5E6N A;  3APC A;  4IUM B;  3KUC B;  3ALB A;  2LD9 A;  3HK0 A;  4FN2 A;  3MJW A;  1G6J A;  2ZEQ A;  4K7U A;  3OLM D;  3DVN U;  2BYE A;  2CR5 A;  2C7H A;  2PEA A;  3B08 A;  3TBL D;  5E6O A;  2L8J A;  2KX3 A;  4WJQ A;  4XZ4 A;  1ISN A;  2L3Z A;  2DAF A;  4ZRJ A;  5G2N A;  3PLV A;  2KNB A;  2PE9 A;  3NZU A;  3PLU A;  5D2M B;  3KYC D;  4II3 B;  1OTR B;  3VDZ A;  5AZH A;  1WXS A;  4CHK A;  2HTH A;  2IYD B;  2KOX A;  3AXC A;  4K1R B;  2QHO A;  1RFA A;  2L76 A;  4CO7 A;  2KJR A;  2KVR A;  3IBE A;  4FLH A;  1YQB A;  3APF A;  3CMM B;  3PS6 A;  2CS4 A;  2WDT B;  3A1Q B;  3DQV A;  4KVG B;  4EOY A;  4EUT A;  1IP9 A;  3RD2 A;  4A3P A;  1S3S G;  3DCG A;  2KO3 A;  1LQB A;  3SDL C;  1XQQ A;  2IO3 B;  3I3T B;  3DBH I;  4LCD E;  1LM8 B;  2KQ7 A;  2L0F A;  2I1J A;  4GDL A;  3KUD B;  3H7P A;  2FAZ A;  2ZCB A;  2ZJD A;  2J0M A;  4OVV A;  3U7D A;  3VTU A;  4BOS C;  5C1Z A;  2AL6 A;  2R2O A;  4BVU C;  2FIF A;  4HDO A;  1I35 A;  1GUA B;  3ENE A;  1WGR A;  2D2Q A;  3OAW A;  4FJY A;  2KWC A;  2BGF A;  3T8M A;  4LJO B;  5CHW A;  2K8B A;  2RGF A;  3ZNI D;  2IY0 B;  3EFU A;  1V9J A;  3H6N A;  4JLC A;  5KHO A;  3ZNG C;  1WY8 A;  2O2V B;  2WX0 A;  4IWP A;  3NOB A;  4W9I A;  2CU1 A;  2FCS A;  4HPL B;  2MQJ A;  3T9L A;  3UF8 A;  3R66 C;  4MGZ E;  4B9K A;  2N1W A;  2PE6 B;  3RZF A;  5DPW A;  1P0R A;  1X1M A;  4DWF A;  4EEW A;  1YX5 B;  2MWS B;  3R3M A;  1WX8 A;  4IC7 B;  1FXT B;  4X57 B;  3VVW B;  3W1S A;  4XX5 A;  3PVL A;  3RUL A;  2KDB A;  3QJZ A;  2M4N A;  2O6V B;  4IG7 B;  4NQL B;  2KKC A;  4FHJ A;  3A1Q A;  4MH0 E;  1WJ6 A;  3MTN B;  3ZRC A;  4F8C B;  3A9J B;  3VAW A;  4GDK B;  4KSL C;  2K25 A;  4AJY B;  2R2Q A;  3D32 A;  3PV1 A;  1WJU A;  4E71 A;  5E6P A;  2KLG A;  2ZPN A;  1KLV A;  2EKE C;  2Z59 B;  2C5L C;  3HM6 X;  3AI5 A;  4EZL A;  5TR5 A;  2WX1 A;  3ZRF A;  2KJH B;  4M0W B;  4NQK E;  2NVU I;  2K8C A;  3R7R A;  1WX9 A;  3KW5 B;  1K8R B;  2ASQ A;  1WZ3 A;  1V81 A;  2K8H A;  3H1U A;  3KVF B;  4I6N B;  5C23 A;  2IO1 B;  3ECI A;  3ZO5 B;  3O65 B;  1P3Q U;  4M8M A;  1SIF A;  1UH6 A;  2KHW B;  3DBL I;  4MEL A;  4BKS D;  1C1Y B;  1WJ4 A;  3A4S C;  4DXA B;  1C3T A;  1WGY A;  1WGD A;  5AEK B;  5FR6 A;  1L2N A;  1WGH A;  2ZNV C;  5J18 A;  4DHJ B;  2LUE A;  1WXA A;  1UGM A;  1SE9 A;  1Y8R C;  2NCN A;  3QX1 A;  4RM9 A;  3V6C B;  2O2V A;  5KHQ A;  4MEM A;  1TZ1 A;  1ZKH A;  4GIV A;  4ZYN A;  3GZN I;  5G55 A;  1U4A A;  2EMS A;  2KC2 A;  2OJR A;  2MBQ A;  2LRU A;  3VUX A;  3UQB A;  1UBI A;  5D7G A;  5D6J B;  3RUI B;  2LXC A;  1VD2 A;  3SHQ A;  3L08 A;  5JHA A;  4EFO A;  2KTF A;  2BF8 B;  2KTR B;  2N7E A;  2LVO A;  3PTF C;  5DPS A;  3ZIM A;  2O6V A;  1H4R A;  3A4R A;  4HCN B;  4B95 A;  2D07 B;  1WZ0 A;  2J7Q B;  1I42 A;  2N4F A;  4JGH B;  3PHX B;  2KMA A;  3A9J A;  4P7I A;  2IO2 B;  1NDD A;  2FNJ B;  4GDK A;  3L13 A;  2JVC A;  4KIK B;  2KFJ A;  1RLF A;  2DX5 B;  2XEW A;  4HLE A;  1GG3 A;  1E8Z A;  5L95 C;  1ZGU B;  3B0A A;  3EC8 A;  2KZR A;  4ZDV A;  2B3A A;  4LDT D;  4XC2 A;  1LFD A;  4WWO A;  2KLC A;  4G11 A;  4IW0 A;  4PYU A;  2LVQ A;  4NY0 A;  3BIN A;  3PRE A;  2K6Q A;  1UBQ A;  1GC7 A;  3WAO A;  1V5O A;  2FCM A;  3IHP C;  2LGD A;  4GGQ A;  3ML9 A;  1OEY A;  3ZKJ C;  1LXD A;  4NAW B;  2G4S A;  4NNJ B;  4KZC A;  4ICU A;  3S2A A;  4EZJ A;  3M3J A;  1IPG A;  2V4L A;  3L54 A;  4GN1 A;  3ZTD A;  2BYV E;  2KX0 A;  3HHM A;  3VUY A;  4PYZ A;  1WR6 E;  4B6W A;  3ZTC A;  2JZ3 B;  3DVG Y;  1E8W A;  4W9F A;  2ZPY A;  4FJV B;  2K1F A;  2DYM A;  4KV2 A;  2MCN B;  2CKH B;  4IWQ A;  3V60 A;  2D3G A;  4JL9 A;  4J6I A;  4W9H A;  2MBO A;  1CMX B;  2MLB A;  4IM3 A;  3ZUN A;  3QCA A;  2KTR A;  2AYO B;  3B1L X;  5AZF A;  3AUL A;  4GSW A;  4GXB A;  3VTW A;  5IAA C;  3PRZ A;  1F9J A;  4PS3 A;  1E8X A;  4W9D A;  1HE8 A;  1E7V A;  1EF1 A;  4G3X B;  4EKU A;  5EDS A;  2K6D B;  1R4M I;  2FCQ A;  4GB9 A;  2KAN A;  4KIK A;  3APD A;  2CHZ A;  3KUZ A;  1Z2M A;  2UYZ B;  4JIO U;  1E5W A;  2KD0 A;  2HD5 B;  2C60 A;  4AP4 C;  4ICV A;  4AUQ C;  1P1A A;  1WR1 A;  3X0W A;  1H8C A;  3GOE A;  2KXJ A;  2XK5 B;  4TUU A;  4WWN A;  3RCZ A;  1IYF A;  3PZD A;  1WGG A;  3H9D A;  2GOW A;  1V80 A;  3PRP B;  3QHT A;  4WAA A;  2NR2 A;  1AAR A;  3DOW A;  3WAL A;  4DHZ E;  4E74 A;  4F7Z A;  1D3Z A;  4NAW A;  2AEH A;  2YLM A;  4BBN C;  3JYU A;  3K9O B;  2C7N B;  4DHZ B;  3M95 A;  2KDI A;  3RT3 B;  4NJ7 A;  3WA0 A;  1E7U A;  2A4Z A;  4HXD A;  2ZVO A;  3ZNZ B;  1WYW B;  1YX6 B;  4EZK A;  2NBW B;  1RRB A;  1J19 A;  3RYT A;  4G0N B;  3JW0 X;  3QIJ A;  3V6E B;  2W9N A;  2LRW A;  3UIP B;  2KFK B;  1MG8 A;  1OGW A;  2CHW A;  2V3S A;  3NY5 A;  3UIO B;  1GJZ A;  3UIN B;  3ML8 A;  1Z5S B;  4FHK A;  5D94 A;  2JY6 A;  2K39 A;  3ZDT A;  4DBG A;  3ZNH B;  4GU2 A;  3QAQ A;  4MSQ B;  3PHW B;  1NI2 A;  2JUO A;  3TCA A;  1WE6 A;  3TL5 A;  2KC1 A;  2UWQ A;  3ZLZ A;  2ZZP B;  5LXI B;  4W9J A;  1WI0 A;  2GBJ A;  5DCN A;  1TGZ B;  2DYB A;  4W9G A;  1BT0 A;  3DBR I;  2XK5 A;  5J2R A;  2JRH A;  3VHT C;  4ZRI A;  2L0T A;  1A5R A;  1WIA A;  2FID A;  2GBK A;  1WMH B;  2LVP A;  3DDC B;  2RD0 A;  3HIZ A;  3W1S C;  4FA6 A;  4I6L B;  3SU8 X;  4MGY E;  4TV3 A;  2D11 A;  1TBE A;  1WM3 A;  3Q3J A;  3L0W B;  3K9P B;  3PPA A;  4BBN F;  4HVB A;  1V6E A;  2MW5 A;  3JSV B;  4HWI B;  2BWE S;  5IA7 A;  4DK5 A;  3TJP A;  3IFW B;  5L83 A;  1WFY A;  2G4D B;  3VFK A;  1GC6 A;  2J0J A;  4IM0 A;  2J0K A;  3OJ3 A;  3VQI A;  1R4N I;  4WJN A;  2BWF A;  3BY4 B;  1J0G A;  4KSK C;  3CST A;  1L7Y A;  4NPN A;  4DDI D;  3WAP A;  2EMT A;  2I1K A;  4GMV A;  1OQY A;  2GBN A;  2C9W B;  3ONS A;  4DDG D;  4ANX A;  2KFK A;  4HPM B;  5HKH A;  4RM8 A;  4KDL B;  2WWZ A;  1E90 A;  2OOB B;  3C0R B;  4HJK A;  1V86 A;  4N9F 4;  2KDF B;  1J8C A;  1XD3 B;  3LDZ E;  3PGE A;  3V61 A;  4AOF A;  3QK0 A;  4AJW A;  4ANV A;  3KH0 A;  1RAX A;  4W9C A;  3R7Q A;  1YIW A;  1Q0W B;  2LGX A;  3EHV A;  2MA9 B;  1XT9 B;  2GBR A;  3VXW A;  5GMV A;  3M62 B;  2MBE A;  2L05 A;  1EUV B;  3IVF A;  1WJN A;  2AWT A;  4HK2 A;  3UGB B;  3VTV A;  5LLI A;  2NS5 A;  2XBB C;  3WAM A;  3QA8 A;  2KQS A;  2RPQ A;  1WMH A;  2G3Q B;  2KWV B;  3LJ3 A;  4WQO B;  5DPR A;  1UD7 A;  4MSM B;  3WAN A;  4A3O A;  2ZNV B;  4I6P A;  2BYF A;  3U8Z A;  5J17 A;  2M17 A;  2GBM A;  2RR9 A;  4NJ6 A;  2DYO A;  2VRR B;  3ZW3 A;  3A9K B;  3RZW C;  4LJP B;  1UEL A;  2KMC A;  3JSV A;  4KZ0 A;  2N1V A;  2HJ8 A;  2MSE D;  1WRD B;  4RMA A;  1UZX B;  1KOT A;  2KJ6 A;  2N9P C;  2NBU A;  2V1Y A;  5JH5 C;  3NHE B;  2IBI B;  2LI5 A;  2JT4 B;  3AU5 A;  4FJZ A;  4W9K A;  3QAR A;  4E3C A;  4II2 B;  3L10 B;  4LDT B;  5CX3 A;  2NPT B;  4HDQ A;  4TQ1 A;  2O6V D;  2DZM A;  2MBB B;  4BOZ B;  2Z0D B;  5BO4 B;  3ZDM C;  1V2Y A;  1E8Y A;  2DZJ A;  2M1M A;  4BKS A;  1Q1O A;  3VH3 B;  4TKN A;  2BPS A;  4K7W A;  2N9E B;  4MM3 A;  3NZS A;  3JVZ X;  2GMI C;  1KJT A;  3QQ8 B;  4PS7 A;  2WYQ A;  1SGH A;  1WF9 A;  3A33 B;  5DPT A;  2Y5B B;  3TIX A;  3DPD A;  4OVU A;  4K7S A;  4IWO A;  4JQW C;  4F1S A;  2LAS A;  4GOC A;  3NS8 A;  2DZI A;  2KK8 A;  3VH4 B;  2LWP A;  4WJO A;  2M8S A;  2PJH A;  5CHV C;  3V62 A;  3AU4 A;  2MP2 B;  4MGI E;  2JXX A;  2JZZ A;  4K81 A;  4DHJ D;  4M8N A;  4MGK E;  1P98 A;  3MHS D;  3N30 A;  2BKF A;  3PRM B;  5AZG A;  4TQ0 A;  4BFR A;  2YVC A;  1VCB A;  4FUL A;  2LXA A;  3A9K A;  2N9X A;  1GNU A;  1WH3 A;  4HCP B;  3QWZ B;  1JRU A;  3WIM A;  2DHZ A;  5LXH A;  1T0Y A;  3IG3 A;  4A20 A;  3N32 A;  2IY1 B;  1KM7 A;  3EEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...