2KNGA

Solution structure of c-domain of lsr2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
55
structure length
55
Chain Sequence
SGSGRGRGAIDREQSAAIREWARRNGHNVSTRGRIPADVIDAYHAATLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein lsr2
publication title Lsr2 is a nucleoid-associated protein that targets AT-rich sequences and virulence genes in Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 14
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2009-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.890.50 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 2kngA01
2KNGA
chains in the Genus database with same CATH superfamily
3RSYA 3ACSA 3QFZA 3S4DA 2CQTA 2CBGA 3IM4A 3UFEA 4RT4A 3S4AA 2OUTA 1L6EA 3QFYA 2CB9A 2H9RA 3G36A 3QDEA 2CQSA 2EZWA 2K9QA 3IM3A 2I15A 4ZP3A 3S4BA 2IZYA 2RQYA 3PMIA 3QG0A 4RTAA 3RRSA 2DRNA 4F9KA 1R2AA 3GWHA 3S4CA 2KYGA 5HVZA 3ACTA 2KNGA 3AFJA 4RIQA
chains in the Genus database with same CATH topology
3GWHA 2CB9A 2RQYA 2CBGA 3PMIA 2KNGA 3UFEA 2K9QA 2OUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNG A; 
#chains in the Genus database with same CATH topology
 3RSY A;  3ACS A;  3QFZ A;  3S4D A;  2CQT A;  2CBG A;  3IM4 A;  3UFE A;  4RT4 A;  3S4A A;  2OUT A;  1L6E A;  3QFY A;  2CB9 A;  2H9R A;  3G36 A;  3QDE A;  2CQS A;  2EZW A;  2K9Q A;  3IM3 A;  2I15 A;  4ZP3 A;  3S4B A;  2IZY A;  2RQY A;  3PMI A;  3QG0 A;  4RTA A;  3RRS A;  2DRN A;  4F9K A;  1R2A A;  3GWH A;  3S4C A;  2KYG A;  5HVZ A;  3ACT A;  2KNG A;  3AFJ A;  4RIQ A; 
#chains in the Genus database with same CATH homology
 3GWH A;  2CB9 A;  2RQY A;  2CBG A;  3PMI A;  2KNG A;  3UFE A;  2K9Q A;  2OUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...