2KNXA

Solution structure of complement repeat cr17 from lrp-1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
50
structure length
50
Chain Sequence
GSEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the minimal interface between ApoE and LRP.
pubmed doi rcsb
molecule keywords Prolow-density lipoprotein receptor-related protein 1
molecule tags Protein binding
source organism Homo sapiens
total genus 4
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 2knxA00
1N7DA 1J8EA 1LDLA 1F5YA 2LGPA 2FYJA 2M96A 1XFEA 2I1PA 1CR8A 1D2LA 2M0PA 1K7BA 1JRFA 2FCWB 2KNYA 2JM4A 2KNXA 1D2JA 2M7PA 1LDRA 2FYLB
chains in the Genus database with same CATH superfamily
1N7DA 1J8EA 1LDLA 1F5YA 2LGPA 2FYJA 2M96A 1XFEA 2I1PA 1CR8A 1D2LA 2M0PA 1K7BA 1JRFA 2FCWB 2KNYA 2JM4A 2KNXA 1D2JA 2M7PA 1LDRA 2FYLB
chains in the Genus database with same CATH topology
1N7DA 1J8EA 1LDLA 1F5YA 2LGPA 2FYJA 2M96A 1XFEA 2I1PA 1CR8A 1D2LA 2M0PA 1K7BA 1JRFA 2FCWB 2KNYA 2JM4A 2KNXA 1D2JA 2M7PA 1LDRA 2FYLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7D A;  1J8E A;  1LDL A;  1F5Y A;  2LGP A;  2FYJ A;  2M96 A;  1XFE A;  2I1P A;  1CR8 A;  1D2L A;  2M0P A;  1K7B A;  1JRF A;  2FCW B;  2KNY A;  2JM4 A;  2KNX A;  1D2J A;  2M7P A;  1LDR A;  2FYL B; 
#chains in the Genus database with same CATH topology
 1N7D A;  1J8E A;  1LDL A;  1F5Y A;  2LGP A;  2FYJ A;  2M96 A;  1XFE A;  2I1P A;  1CR8 A;  1D2L A;  2M0P A;  1K7B A;  1JRF A;  2FCW B;  2KNY A;  2JM4 A;  2KNX A;  1D2J A;  2M7P A;  1LDR A;  2FYL B; 
#chains in the Genus database with same CATH homology
 1N7D A;  1J8E A;  1LDL A;  1F5Y A;  2LGP A;  2FYJ A;  2M96 A;  1XFE A;  2I1P A;  1CR8 A;  1D2L A;  2M0P A;  1K7B A;  1JRF A;  2FCW B;  2KNY A;  2JM4 A;  2KNX A;  1D2J A;  2M7P A;  1LDR A;  2FYL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...