The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
89
|
structure length |
89
|
Chain Sequence |
MKCKRLNEVIELLQPAWQKEPDFNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSAKDAVIPGLQKDYEEDFKTALLRARGVIKE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
Uncharacterized protein yihD
|
publication title |
Solution Structure of protein sf3929 from Shigella flexneri 2a. Northeast Structural Genomics Consortium target SfR81/Ontario Center for Structural Proteomics Target sf3929
rcsb |
source organism |
Shigella flexneri
|
total genus |
19
|
structure length |
89
|
sequence length |
89
|
ec nomenclature | |
pdb deposition date | 2009-09-10 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Conserved Hypothetical Protein Ylqf; Chain: A; domain 2 | Conserved Hypothetical Protein Ylqf; Chain: A; domain 2 |
#chains in the Genus database with same CATH superfamily 2KO6 A; #chains in the Genus database with same CATH topology 3CNN A; 2KO6 A; 1PUJ A; 3CNL A; 3CNO A; #chains in the Genus database with same CATH homology 3CNN A; 2KO6 A; 1PUJ A; 3CNL A; 3CNO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...