2KO7A

Solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with cycloheximide-n-ethylethanoate
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
117
structure length
117
Chain Sequence
b'GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title The structure of a Burkholderia pseudomallei immunophilin-inhibitor complex reveals new approaches to antimicrobial development.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
total genus 15
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ko7A00
2FKEA 1J4IA 3MDYB 4QIBA 4IQCA 2RUQA 2XP9A 4QT3A 2DG9A 2KR7A 2MPHA 2UZ5A 3CGNA 3JYMA 5HUAA 3I6CA 4ODNA 2XP5A 1BKFA 5HT1A 4U84A 3O5OA 4JYSA 2ZQSA 4JFJA 5HW7A 4R0XA 3KABA 1B6CA 2F21A 3O5DA 2KGJA 1C9HA 1Q6HA 2L2SA 4JFLA 1EYMA 4QT2A 5HW6A 2KFWA 2LGOA 4J4OA 3GPKA 1D6OA 3EY6A 1M5YA 1JVWA 4C02B 4DRPA 3ODKA 2VCDA 5HW8A 1JNSA 2XPBA 2RQSA 4ODLA 3IHZA 2LPVA 4DRHA 4BF8A 1NMWA 5HTGA 1FKRA 3PRBA 4JFIA 1P5QA 2PPPA 2XP8A 5GPGA 2D9FA 2KI3A 2KE0A 2MLXA 2K8IA 3NTPA 3O5IA 1FKBA 1FKHA 4DRJA 2MLZA 1D7IA 2RSEA 2AWGA 4W9OA 2MLYA 2M08A 1JNTA 2ZR6A 4DRIA 5B8IC 3TC5A 1PINA 2PV1A 1NSGA 2FAPA 1U79A 2Q5AA 3OOBA 2JZVA 3KAIA 1FAPA 5DIVA 5I98A 1FKFA 3KADA 2PPOA 1EQ3A 3KAFA 3NI6A 1FKTA 3O5RA 1Q1CA 3PRDA 3WH0A 2PPNA 4DRNA 4G2PA 3O5KA 2PV3A 4ITZA 1FKDA 4TX0A 3IKDA 2XP6A 4J4NA 2DG4A 3CGMA 1J4HA 2RUDA 1KT0A 4LAVA 1A7XA 1Q6IA 1D7JA 2PV2A 1FKLA 3O5QA 4TW8A 4TW6A 4W9PA 3JXVA 4MSPA 2ITKA 4DRMA 1T11A 2XP4A 3PA7A 4DT4A 1F8AB 4FAPA 2XP3A 4DROA 4DZ2A 1FKGA 3UQBA 2M2AA 2ZQUA 3O5GA 1L1PA 3VAWA 1QZ2A 1HXVA 1FKKA 2RUCA 4DRKA 1ROTA 3RFWA 3UI4A 4DH0A 3NRKA 4MGVA 4ODQA 1PBKA 2ZR4A 3IKGA 3O5LA 3UI5A 4DIPA 3UF8A 5HWCA 2RURA 1ROUA 2IF4A 4ODRA 4DZ3A 1QPLA 1YW5A 4GGQA 4TNSA 5HKGA 2XPAA 4LAXA 3O5MA 1KT1A 2OFNA 2Y78A 1R9HA 4GIVA 4U86A 5J6EA 4N19A 1YATA 4ODPA 1FKIA 3KZ7A 4IQ2A 1Y0OA 3KCEA 3KAHA 4ODOA 2VN1A 3B7XA 3KACA 4TW7A 5D75A 3TCZA 3TDBA 1ZK6A 2PBCA 2MF9A 2M1IA 4LAYA 1D7HA 2DG3A 2ZQVA 3O5JA 1FD9A 1NMVA 4TYOA 1F40A 3UQAA 1QPFA 3IK8A 4ODKA 1FJDA 3O5FA 2F2DA 1FKSA 4O2TA 4W9QA 2XP7A 3O5EA 4FN2A 4ODMA 2N87A 3KAGA 1W26A 4JFMA 4JFKA 3UI6A 2KO7A 5BXJA 4G50A 2ZQTA 1FKJA 2LJ4A 1ZCNA 2MNTA 3H9RB 3LUOA 3O5PA 5DITA 4DRQA 2F4EA 4NNRA 1Q6UA 3JYJA 1J4RA 1BL4A 1J6YA 5HWBA 1TCOC 3RGCA 4U85A 2ZR5A 4IPXA 4LAWA 5DIUA 3UQIA 1N1AA 3FAPA 2LKNA
chains in the Genus database with same CATH superfamily
2FKEA 3BMBA 2KR7A 5HUAA 3CGNA 4ZS6A 3WD3A 1BKFA 4U84A 4JYSA 1W1YA 3KABA 4JFLA 1C9HA 2L2SA 2KFWA 1LL6A 3GPKA 4C02B 3ODKA 4ODLA 3WIJA 4DRHA 2A3AA 3PRBA 1X6LA 2KI3A 2MLXA 2KE0A 3ARYA 4UDMA 3ARUA 4DRJA 1XRVA 1GUVA 2AWGA 4W9OA 2PV1A 1U79A 2Q5AA 1ZBCA 3KADA 3O5RA 1EIBA 1Q1CA 3PRDA 2PPNA 3O5KA 1EDQA 4Z2HA 1FKDA 4J4NA 1ZBKA 2DG4A 4Z2KA 2RUDA 5I98A 1Q6IA 4W9PA 3O5QA 2ITKA 2XP3A 3B9AA 4ZPVR 1QZ2A 2YBUA 2RUCA 1ZB5A 4DH0A 4NSBA 4S3KA 4MNJA 5HWCA 4WIWA 4R5EA 3RM9A 4P8UA 4GGQA 4IT4A 1KFWA 4U86A 1W9VA 4IQ2A 4ODOA 1Y0OA 4PTMA 3TDBA 1ZK6A 4WKFA 2MF9A 4LAYA 1HKMA 1EHNA 1D7HA 3CHCA 1JNDA 4HBEA 4TYOA 3WQVA 4L72B 3O5FA 1FKSA 1WNOA 3WD2A 4MNLA 4ODMA 3KAGA 5DEZA 2ZQTA 2ETNA 4WJXA 3AS0A 3JYJA 2O92A 1NWSA 1TCOC 3RGCA 2WLZA 2AOSA 3UQIA 1NWRA 4QT3A 4IQCA 2XP9A 1HKKA 3JYMA 3I6CA 3WKZA 3AQUA 3FXYA 4NZCA 3O5OA 4MNKA 3B8SA 3O5DA 2KGJA 1Q6HA 3AS1A 3G6MA 2LGOA 1D6OA 1JNSA 2VCDA 1IX5A 1LG1A 4AY1A 3ARWA 4BF8A 2B31A 1FKRA 4Q22A 1OGBA 2XP8A 1RD6A 4P8VA 3NTPA 3O5IA 4KQZA 2MLZA 2RSEA 2ZR6A 4IT6A 3TC5A 3BXWA 3OOBA 3ALFA 1GOIA 2DSVA 2PPOA 1EQ3A 1E6RA 1HJXA 1FKTA 1E6NA 3WH0A 3ARPA 4DRNA 4G2PA 1E44A 2PV3A 4ITZA 2XP6A 1JCHB 1KT0A 4TW6A 1D7JA 4TW8A 1FKLA 1XHGA 2IUZA 3JXVA 4MSPA 4FAPA 1T11A 1LG2A 1ZL1A 4DROA 1GPFA 3O5LA 4Z2LA 3WD1A 2EULA 4HARA 4ML4A 4LAXA 5J6EA 1FFRA 3RMEA 1FKIA 3KZ7A 2VN1A 3CHFA 5D75A 3TCZA 2PBCA 1H0IA 3WD4A 1SYTA 2DG3A 2ZQVA 3O5JA 1FD9A 1F40A 1QPFA 2WK2A 3IK8A 4URIA 1NWTA 4O2TA 4W9QA 4FN2A 3ARQA 5BXJA 4G50A 3H9RB 1E15A 3ARZA 3O5PA 4DRQA 4KR0B 2F4EA 4NNRA 1J4RA 1BL4A 1ZU8A 2DPEA 5HWBA 2ZR5A 4IPXA 2G8ZA 3AS3A 4S3JA 3FAPA 4QIBA 4MPKA 3WD0A 2UZ5A 5JH8A 5HT1A 1LL4A 2DT1A 4Q7NA 2ZQSA 4JFJA 4DWSD 1H0GA 5HW7A 1B6CA 5HBFA 4QT2A 1HJWA 3EY6A 1M5YA 4DRPA 1W1VA 5HW8A 1X6NA 2RQSA 3IHZA 2A3BA 1P5QA 2PPPA 3RM4A 1GRJA 2K8IA 1E6ZA 1D7IA 2MLYA 2M08A 1JNTA 3CZ8A 1PINA 2FAPA 4MTVA 5GPRA 2JZVA 1FAPA 5DIVA 1FKFA 3B9EA 3ARRA 4P8WA 2DSWA 4TX0A 4DWSA 3CGMA 1J4HA 1A7XA 4DT4A 3PA7A 4L3NA 1F8AB 1W9PA 3UQBA 4DZ2A 1ZBWA 2M2AA 3O5GA 4HBOA 3AS2A 3VAWA 1HXVA 3ARSA 1D2KA 1FKKA 4DRKA 1ROTA 3UI4A 2DT2A 3NRKA 4MGVA 2ZR4A 4DIPA 3IKGA 3UF8A 3OA5A 1E6PA 1ROUA 2IF4A 4ODRA 1QPLA 1YW5A 2OLHA 3QOKA 4TNSA 5HKGA 3EIPA 3FY1A 3ALGA 2OFNA 3O5MA 1OGGA 4N19A 1YATA 1ZBVA 4TW7A 2PI6A 2B5UB 1TFVA 2WM0A 4LGXA 4WKHA 4ODKA 2A3EA 2F23A 2F2DA 1K9TA 1LJYA 2XP7A 3O5EA 1W26A 4JFKA 2KO7A 1FKJA 3PR9A 2MNTA 1ZCNA 1O6IA 4ZPTR 4ZPWR 2YBTA 1J6YA 4U85A 5DIUA 1N1AA 1W9UA 1J4IA 3MDYB 2RUQA 2DG9A 2DSUA 2MPHA 3WL1A 3CHDA 2XP5A 4DWSC 1JNEA 4R0XA 2F21A 5HW6A 1EYMA 1W1TA 3WL0A 1NH6A 1E9LA 1UR8A 4J4OA 1JVWA 2XPBA 2WLYA 2LPVA 1NMWA 5HTGA 2PN0A 4JFIA 4MAVA 2D9FA 3AROA 1FKBA 1FKHA 1WAWA 3ARVA 1VF8A 4DRIA 1LQ0A 5B8IC 1OWQA 1NSGA 4MNMA 1CTNA 3KAIA 4Z2GA 3CH9A 3KAFA 3NI6A 3PRAA 2ESCA 3B9DA 4DWSB 4W5UA 5GQBA 3IKDA 4ODNA 4LAVA 5GPGA 2PV2A 4DRMA 1UR9A 2XP4A 4Z2JA 3ARXA 2QF8A 1LL7A 3GU0A 1FKGA 2ZQUA 1L1PA 3RFWA 4ODQA 1PBKA 2G41A 3UI5A 2A3CA 2RURA 4DZ3A 3W4RA 2XPAA 1FFQA 1KT1A 2Y78A 1R9HA 3GTYX 4GIVA 5DO2A 3G6LA 3ARTA 2FDMA 4ODPA 3KCEA 3KAHA 3B7XA 3KACA 1HKIA 4WK9A 2O9OA 1HJVA 2DSZA 2M1IA 1HKJA 1NMVA 2P4VA 3UQAA 4QZVB 4P8XA 1FJDA 3WQWA 2N87A 2DT0A 4JFMA 3UI6A 1W1PA 4XAKA 2DT3A 2LJ4A 3LUOA 5DITA 1NWUA 5DF0A 1Q6UA 4WKAA 3RM8A 1SR0A 1WB0A 3CHEA 4LAWA 1ITXA 4Z2IA 2LKNA
chains in the Genus database with same CATH topology
2FKEA 2KR7A 5HUAA 3CGNA 4ZS6A 3WD3A 1BKFA 4U84A 4JYSA 1W1YA 3KABA 4JFLA 1C9HA 2L2SA 2KFWA 1LL6A 3GPKA 4C02B 3ODKA 4ODLA 3WIJA 4DRHA 2A3AA 3PRBA 1X6LA 2KI3A 2MLXA 2KE0A 3ARYA 3ARUA 4DRJA 1XRVA 1GUVA 2AWGA 4W9OA 2PV1A 1U79A 2Q5AA 1ZBCA 3KADA 3O5RA 1EIBA 1Q1CA 3PRDA 2PPNA 3O5KA 1EDQA 4Z2HA 1FKDA 4J4NA 1ZBKA 2DG4A 4Z2KA 2RUDA 5I98A 1Q6IA 4W9PA 3O5QA 2ITKA 2XP3A 3B9AA 4ZPVR 1QZ2A 2YBUA 2RUCA 1ZB5A 4DH0A 4NSBA 4S3KA 4MNJA 5HWCA 4WIWA 4R5EA 3RM9A 4P8UA 4GGQA 4IT4A 1KFWA 4U86A 1W9VA 4IQ2A 4ODOA 1Y0OA 4PTMA 3TDBA 1ZK6A 4WKFA 2MF9A 4LAYA 1HKMA 1EHNA 1D7HA 3CHCA 1JNDA 4HBEA 4TYOA 3WQVA 4L72B 3O5FA 1FKSA 1WNOA 3WD2A 4MNLA 4ODMA 3KAGA 5DEZA 2ZQTA 4WJXA 3AS0A 3JYJA 2O92A 1NWSA 1TCOC 3RGCA 2WLZA 2AOSA 3UQIA 1NWRA 4QT3A 4IQCA 2XP9A 1HKKA 3JYMA 3I6CA 3WKZA 3AQUA 3FXYA 4NZCA 3O5OA 4MNKA 3B8SA 3O5DA 2KGJA 1Q6HA 3AS1A 3G6MA 2LGOA 1D6OA 1JNSA 2VCDA 1IX5A 1LG1A 4AY1A 3ARWA 4BF8A 2B31A 1FKRA 4Q22A 1OGBA 2XP8A 1RD6A 4P8VA 3NTPA 3O5IA 4KQZA 2MLZA 2RSEA 2ZR6A 4IT6A 3TC5A 3BXWA 3OOBA 3ALFA 1GOIA 2DSVA 2PPOA 1EQ3A 1E6RA 1HJXA 1FKTA 1E6NA 3WH0A 3ARPA 4DRNA 4G2PA 2PV3A 4ITZA 2XP6A 1KT0A 4TW6A 1D7JA 4TW8A 1FKLA 1XHGA 2IUZA 3JXVA 4MSPA 4FAPA 1T11A 1LG2A 1ZL1A 4DROA 1GPFA 3O5LA 4Z2LA 3WD1A 4HARA 4ML4A 4LAXA 5J6EA 1FFRA 3RMEA 1FKIA 3KZ7A 2VN1A 3CHFA 5D75A 3TCZA 2PBCA 1H0IA 3WD4A 1SYTA 2DG3A 2ZQVA 3O5JA 1FD9A 1F40A 1QPFA 2WK2A 3IK8A 4URIA 1NWTA 4O2TA 4W9QA 4FN2A 3ARQA 5BXJA 4G50A 3H9RB 1E15A 3ARZA 3O5PA 4DRQA 4KR0B 2F4EA 4NNRA 1J4RA 1BL4A 1ZU8A 2DPEA 5HWBA 2ZR5A 4IPXA 2G8ZA 3AS3A 4S3JA 3FAPA 4QIBA 4MPKA 3WD0A 2UZ5A 5JH8A 5HT1A 1LL4A 2DT1A 4Q7NA 2ZQSA 4JFJA 4DWSD 1H0GA 5HW7A 1B6CA 5HBFA 4QT2A 1HJWA 3EY6A 1M5YA 4DRPA 1W1VA 5HW8A 1X6NA 2RQSA 3IHZA 2A3BA 1P5QA 2PPPA 3RM4A 2K8IA 1E6ZA 1D7IA 2MLYA 2M08A 1JNTA 3CZ8A 1PINA 2FAPA 4MTVA 5GPRA 2JZVA 1FAPA 5DIVA 1FKFA 3B9EA 3ARRA 4P8WA 2DSWA 4TX0A 4DWSA 3CGMA 1J4HA 1A7XA 4DT4A 3PA7A 4L3NA 1F8AB 1W9PA 3UQBA 4DZ2A 1ZBWA 2M2AA 3O5GA 4HBOA 3AS2A 3VAWA 1HXVA 3ARSA 1D2KA 1FKKA 4DRKA 1ROTA 3UI4A 2DT2A 3NRKA 4MGVA 2ZR4A 4DIPA 3IKGA 3UF8A 3OA5A 1E6PA 1ROUA 2IF4A 4ODRA 1QPLA 1YW5A 2OLHA 3QOKA 4TNSA 5HKGA 3FY1A 3ALGA 2OFNA 3O5MA 1OGGA 4N19A 1YATA 1ZBVA 4TW7A 2PI6A 1TFVA 2WM0A 4LGXA 4WKHA 4ODKA 2A3EA 2F2DA 1K9TA 1LJYA 2XP7A 3O5EA 1W26A 4JFKA 2KO7A 1FKJA 3PR9A 2MNTA 1ZCNA 1O6IA 4ZPTR 4ZPWR 2YBTA 1J6YA 4U85A 5DIUA 1N1AA 1W9UA 1J4IA 3MDYB 2RUQA 2DG9A 2DSUA 2MPHA 3WL1A 3CHDA 2XP5A 4DWSC 1JNEA 4R0XA 2F21A 5HW6A 1EYMA 1W1TA 3WL0A 1NH6A 1E9LA 1UR8A 4J4OA 1JVWA 2XPBA 2WLYA 2LPVA 1NMWA 5HTGA 4JFIA 4MAVA 2D9FA 3AROA 1FKBA 1FKHA 1WAWA 3ARVA 1VF8A 4DRIA 1LQ0A 5B8IC 1OWQA 1NSGA 4MNMA 1CTNA 3KAIA 4Z2GA 3CH9A 3KAFA 3NI6A 3PRAA 2ESCA 3B9DA 4DWSB 4W5UA 5GQBA 3IKDA 4ODNA 4LAVA 5GPGA 2PV2A 4DRMA 1UR9A 2XP4A 4Z2JA 3ARXA 2QF8A 1LL7A 1FKGA 2ZQUA 1L1PA 3RFWA 4ODQA 1PBKA 2G41A 3UI5A 2A3CA 2RURA 4DZ3A 3W4RA 2XPAA 1FFQA 1KT1A 2Y78A 1R9HA 4GIVA 5DO2A 3G6LA 3ARTA 2FDMA 4ODPA 3KCEA 3KAHA 3B7XA 3KACA 1HKIA 4WK9A 2O9OA 1HJVA 2DSZA 2M1IA 1HKJA 1NMVA 3UQAA 4QZVB 4P8XA 1FJDA 3WQWA 2N87A 2DT0A 4JFMA 3UI6A 1W1PA 4XAKA 2DT3A 2LJ4A 3LUOA 5DITA 1NWUA 5DF0A 1Q6UA 4WKAA 3RM8A 1SR0A 1WB0A 3CHEA 4LAWA 1ITXA 4Z2IA 2LKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKE A;  1J4I A;  3MDY B;  4QIB A;  4IQC A;  2RUQ A;  2XP9 A;  4QT3 A;  2DG9 A;  2KR7 A;  2MPH A;  2UZ5 A;  3CGN A;  3JYM A;  5HUA A;  3I6C A;  4ODN A;  2XP5 A;  1BKF A;  5HT1 A;  4U84 A;  3O5O A;  4JYS A;  2ZQS A;  4JFJ A;  5HW7 A;  4R0X A;  3KAB A;  1B6C A;  2F21 A;  3O5D A;  2KGJ A;  1C9H A;  1Q6H A;  2L2S A;  4JFL A;  1EYM A;  4QT2 A;  5HW6 A;  2KFW A;  2LGO A;  4J4O A;  3GPK A;  1D6O A;  3EY6 A;  1M5Y A;  1JVW A;  4C02 B;  4DRP A;  3ODK A;  2VCD A;  5HW8 A;  1JNS A;  2XPB A;  2RQS A;  4ODL A;  3IHZ A;  2LPV A;  4DRH A;  4BF8 A;  1NMW A;  5HTG A;  1FKR A;  3PRB A;  4JFI A;  1P5Q A;  2PPP A;  2XP8 A;  5GPG A;  2D9F A;  2KI3 A;  2KE0 A;  2MLX A;  2K8I A;  3NTP A;  3O5I A;  1FKB A;  1FKH A;  4DRJ A;  2MLZ A;  1D7I A;  2RSE A;  2AWG A;  4W9O A;  2MLY A;  2M08 A;  1JNT A;  2ZR6 A;  4DRI A;  5B8I C;  3TC5 A;  1PIN A;  2PV1 A;  1NSG A;  2FAP A;  1U79 A;  2Q5A A;  3OOB A;  2JZV A;  3KAI A;  1FAP A;  5DIV A;  5I98 A;  1FKF A;  3KAD A;  2PPO A;  1EQ3 A;  3KAF A;  3NI6 A;  1FKT A;  3O5R A;  1Q1C A;  3PRD A;  3WH0 A;  2PPN A;  4DRN A;  4G2P A;  3O5K A;  2PV3 A;  4ITZ A;  1FKD A;  4TX0 A;  3IKD A;  2XP6 A;  4J4N A;  2DG4 A;  3CGM A;  1J4H A;  2RUD A;  1KT0 A;  4LAV A;  1A7X A;  1Q6I A;  1D7J A;  2PV2 A;  1FKL A;  3O5Q A;  4TW8 A;  4TW6 A;  4W9P A;  3JXV A;  4MSP A;  2ITK A;  4DRM A;  1T11 A;  2XP4 A;  3PA7 A;  4DT4 A;  1F8A B;  4FAP A;  2XP3 A;  4DRO A;  4DZ2 A;  1FKG A;  3UQB A;  2M2A A;  2ZQU A;  3O5G A;  1L1P A;  3VAW A;  1QZ2 A;  1HXV A;  1FKK A;  2RUC A;  4DRK A;  1ROT A;  3RFW A;  3UI4 A;  4DH0 A;  3NRK A;  4MGV A;  4ODQ A;  1PBK A;  2ZR4 A;  3IKG A;  3O5L A;  3UI5 A;  4DIP A;  3UF8 A;  5HWC A;  2RUR A;  1ROU A;  2IF4 A;  4ODR A;  4DZ3 A;  1QPL A;  1YW5 A;  4GGQ A;  4TNS A;  5HKG A;  2XPA A;  4LAX A;  3O5M A;  1KT1 A;  2OFN A;  2Y78 A;  1R9H A;  4GIV A;  4U86 A;  5J6E A;  4N19 A;  1YAT A;  4ODP A;  1FKI A;  3KZ7 A;  4IQ2 A;  1Y0O A;  3KCE A;  3KAH A;  4ODO A;  2VN1 A;  3B7X A;  3KAC A;  4TW7 A;  5D75 A;  3TCZ A;  3TDB A;  1ZK6 A;  2PBC A;  2MF9 A;  2M1I A;  4LAY A;  1D7H A;  2DG3 A;  2ZQV A;  3O5J A;  1FD9 A;  1NMV A;  4TYO A;  1F40 A;  3UQA A;  1QPF A;  3IK8 A;  4ODK A;  1FJD A;  3O5F A;  2F2D A;  1FKS A;  4O2T A;  4W9Q A;  2XP7 A;  3O5E A;  4FN2 A;  4ODM A;  2N87 A;  3KAG A;  1W26 A;  4JFM A;  4JFK A;  3UI6 A;  2KO7 A;  5BXJ A;  4G50 A;  2ZQT A;  1FKJ A;  2LJ4 A;  1ZCN A;  2MNT A;  3H9R B;  3LUO A;  3O5P A;  5DIT A;  4DRQ A;  2F4E A;  4NNR A;  1Q6U A;  3JYJ A;  1J4R A;  1BL4 A;  1J6Y A;  5HWB A;  1TCO C;  3RGC A;  4U85 A;  2ZR5 A;  4IPX A;  4LAW A;  5DIU A;  3UQI A;  1N1A A;  3FAP A;  2LKN A; 
#chains in the Genus database with same CATH topology
 2FKE A;  3BMB A;  2KR7 A;  5HUA A;  3CGN A;  4ZS6 A;  3WD3 A;  1BKF A;  4U84 A;  4JYS A;  1W1Y A;  3KAB A;  4JFL A;  1C9H A;  2L2S A;  2KFW A;  1LL6 A;  3GPK A;  4C02 B;  3ODK A;  4ODL A;  3WIJ A;  4DRH A;  2A3A A;  3PRB A;  1X6L A;  2KI3 A;  2MLX A;  2KE0 A;  3ARY A;  4UDM A;  3ARU A;  4DRJ A;  1XRV A;  1GUV A;  2AWG A;  4W9O A;  2PV1 A;  1U79 A;  2Q5A A;  1ZBC A;  3KAD A;  3O5R A;  1EIB A;  1Q1C A;  3PRD A;  2PPN A;  3O5K A;  1EDQ A;  4Z2H A;  1FKD A;  4J4N A;  1ZBK A;  2DG4 A;  4Z2K A;  2RUD A;  5I98 A;  1Q6I A;  4W9P A;  3O5Q A;  2ITK A;  2XP3 A;  3B9A A;  4ZPV R;  1QZ2 A;  2YBU A;  2RUC A;  1ZB5 A;  4DH0 A;  4NSB A;  4S3K A;  4MNJ A;  5HWC A;  4WIW A;  4R5E A;  3RM9 A;  4P8U A;  4GGQ A;  4IT4 A;  1KFW A;  4U86 A;  1W9V A;  4IQ2 A;  4ODO A;  1Y0O A;  4PTM A;  3TDB A;  1ZK6 A;  4WKF A;  2MF9 A;  4LAY A;  1HKM A;  1EHN A;  1D7H A;  3CHC A;  1JND A;  4HBE A;  4TYO A;  3WQV A;  4L72 B;  3O5F A;  1FKS A;  1WNO A;  3WD2 A;  4MNL A;  4ODM A;  3KAG A;  5DEZ A;  2ZQT A;  2ETN A;  4WJX A;  3AS0 A;  3JYJ A;  2O92 A;  1NWS A;  1TCO C;  3RGC A;  2WLZ A;  2AOS A;  3UQI A;  1NWR A;  4QT3 A;  4IQC A;  2XP9 A;  1HKK A;  3JYM A;  3I6C A;  3WKZ A;  3AQU A;  3FXY A;  4NZC A;  3O5O A;  4MNK A;  3B8S A;  3O5D A;  2KGJ A;  1Q6H A;  3AS1 A;  3G6M A;  2LGO A;  1D6O A;  1JNS A;  2VCD A;  1IX5 A;  1LG1 A;  4AY1 A;  3ARW A;  4BF8 A;  2B31 A;  1FKR A;  4Q22 A;  1OGB A;  2XP8 A;  1RD6 A;  4P8V A;  3NTP A;  3O5I A;  4KQZ A;  2MLZ A;  2RSE A;  2ZR6 A;  4IT6 A;  3TC5 A;  3BXW A;  3OOB A;  3ALF A;  1GOI A;  2DSV A;  2PPO A;  1EQ3 A;  1E6R A;  1HJX A;  1FKT A;  1E6N A;  3WH0 A;  3ARP A;  4DRN A;  4G2P A;  1E44 A;  2PV3 A;  4ITZ A;  2XP6 A;  1JCH B;  1KT0 A;  4TW6 A;  1D7J A;  4TW8 A;  1FKL A;  1XHG A;  2IUZ A;  3JXV A;  4MSP A;  4FAP A;  1T11 A;  1LG2 A;  1ZL1 A;  4DRO A;  1GPF A;  3O5L A;  4Z2L A;  3WD1 A;  2EUL A;  4HAR A;  4ML4 A;  4LAX A;  5J6E A;  1FFR A;  3RME A;  1FKI A;  3KZ7 A;  2VN1 A;  3CHF A;  5D75 A;  3TCZ A;  2PBC A;  1H0I A;  3WD4 A;  1SYT A;  2DG3 A;  2ZQV A;  3O5J A;  1FD9 A;  1F40 A;  1QPF A;  2WK2 A;  3IK8 A;  4URI A;  1NWT A;  4O2T A;  4W9Q A;  4FN2 A;  3ARQ A;  5BXJ A;  4G50 A;  3H9R B;  1E15 A;  3ARZ A;  3O5P A;  4DRQ A;  4KR0 B;  2F4E A;  4NNR A;  1J4R A;  1BL4 A;  1ZU8 A;  2DPE A;  5HWB A;  2ZR5 A;  4IPX A;  2G8Z A;  3AS3 A;  4S3J A;  3FAP A;  4QIB A;  4MPK A;  3WD0 A;  2UZ5 A;  5JH8 A;  5HT1 A;  1LL4 A;  2DT1 A;  4Q7N A;  2ZQS A;  4JFJ A;  4DWS D;  1H0G A;  5HW7 A;  1B6C A;  5HBF A;  4QT2 A;  1HJW A;  3EY6 A;  1M5Y A;  4DRP A;  1W1V A;  5HW8 A;  1X6N A;  2RQS A;  3IHZ A;  2A3B A;  1P5Q A;  2PPP A;  3RM4 A;  1GRJ A;  2K8I A;  1E6Z A;  1D7I A;  2MLY A;  2M08 A;  1JNT A;  3CZ8 A;  1PIN A;  2FAP A;  4MTV A;  5GPR A;  2JZV A;  1FAP A;  5DIV A;  1FKF A;  3B9E A;  3ARR A;  4P8W A;  2DSW A;  4TX0 A;  4DWS A;  3CGM A;  1J4H A;  1A7X A;  4DT4 A;  3PA7 A;  4L3N A;  1F8A B;  1W9P A;  3UQB A;  4DZ2 A;  1ZBW A;  2M2A A;  3O5G A;  4HBO A;  3AS2 A;  3VAW A;  1HXV A;  3ARS A;  1D2K A;  1FKK A;  4DRK A;  1ROT A;  3UI4 A;  2DT2 A;  3NRK A;  4MGV A;  2ZR4 A;  4DIP A;  3IKG A;  3UF8 A;  3OA5 A;  1E6P A;  1ROU A;  2IF4 A;  4ODR A;  1QPL A;  1YW5 A;  2OLH A;  3QOK A;  4TNS A;  5HKG A;  3EIP A;  3FY1 A;  3ALG A;  2OFN A;  3O5M A;  1OGG A;  4N19 A;  1YAT A;  1ZBV A;  4TW7 A;  2PI6 A;  2B5U B;  1TFV A;  2WM0 A;  4LGX A;  4WKH A;  4ODK A;  2A3E A;  2F23 A;  2F2D A;  1K9T A;  1LJY A;  2XP7 A;  3O5E A;  1W26 A;  4JFK A;  2KO7 A;  1FKJ A;  3PR9 A;  2MNT A;  1ZCN A;  1O6I A;  4ZPT R;  4ZPW R;  2YBT A;  1J6Y A;  4U85 A;  5DIU A;  1N1A A;  1W9U A;  1J4I A;  3MDY B;  2RUQ A;  2DG9 A;  2DSU A;  2MPH A;  3WL1 A;  3CHD A;  2XP5 A;  4DWS C;  1JNE A;  4R0X A;  2F21 A;  5HW6 A;  1EYM A;  1W1T A;  3WL0 A;  1NH6 A;  1E9L A;  1UR8 A;  4J4O A;  1JVW A;  2XPB A;  2WLY A;  2LPV A;  1NMW A;  5HTG A;  2PN0 A;  4JFI A;  4MAV A;  2D9F A;  3ARO A;  1FKB A;  1FKH A;  1WAW A;  3ARV A;  1VF8 A;  4DRI A;  1LQ0 A;  5B8I C;  1OWQ A;  1NSG A;  4MNM A;  1CTN A;  3KAI A;  4Z2G A;  3CH9 A;  3KAF A;  3NI6 A;  3PRA A;  2ESC A;  3B9D A;  4DWS B;  4W5U A;  5GQB A;  3IKD A;  4ODN A;  4LAV A;  5GPG A;  2PV2 A;  4DRM A;  1UR9 A;  2XP4 A;  4Z2J A;  3ARX A;  2QF8 A;  1LL7 A;  3GU0 A;  1FKG A;  2ZQU A;  1L1P A;  3RFW A;  4ODQ A;  1PBK A;  2G41 A;  3UI5 A;  2A3C A;  2RUR A;  4DZ3 A;  3W4R A;  2XPA A;  1FFQ A;  1KT1 A;  2Y78 A;  1R9H A;  3GTY X;  4GIV A;  5DO2 A;  3G6L A;  3ART A;  2FDM A;  4ODP A;  3KCE A;  3KAH A;  3B7X A;  3KAC A;  1HKI A;  4WK9 A;  2O9O A;  1HJV A;  2DSZ A;  2M1I A;  1HKJ A;  1NMV A;  2P4V A;  3UQA A;  4QZV B;  4P8X A;  1FJD A;  3WQW A;  2N87 A;  2DT0 A;  4JFM A;  3UI6 A;  1W1P A;  4XAK A;  2DT3 A;  2LJ4 A;  3LUO A;  5DIT A;  1NWU A;  5DF0 A;  1Q6U A;  4WKA A;  3RM8 A;  1SR0 A;  1WB0 A;  3CHE A;  4LAW A;  1ITX A;  4Z2I A;  2LKN A; 
#chains in the Genus database with same CATH homology
 2FKE A;  2KR7 A;  5HUA A;  3CGN A;  4ZS6 A;  3WD3 A;  1BKF A;  4U84 A;  4JYS A;  1W1Y A;  3KAB A;  4JFL A;  1C9H A;  2L2S A;  2KFW A;  1LL6 A;  3GPK A;  4C02 B;  3ODK A;  4ODL A;  3WIJ A;  4DRH A;  2A3A A;  3PRB A;  1X6L A;  2KI3 A;  2MLX A;  2KE0 A;  3ARY A;  3ARU A;  4DRJ A;  1XRV A;  1GUV A;  2AWG A;  4W9O A;  2PV1 A;  1U79 A;  2Q5A A;  1ZBC A;  3KAD A;  3O5R A;  1EIB A;  1Q1C A;  3PRD A;  2PPN A;  3O5K A;  1EDQ A;  4Z2H A;  1FKD A;  4J4N A;  1ZBK A;  2DG4 A;  4Z2K A;  2RUD A;  5I98 A;  1Q6I A;  4W9P A;  3O5Q A;  2ITK A;  2XP3 A;  3B9A A;  4ZPV R;  1QZ2 A;  2YBU A;  2RUC A;  1ZB5 A;  4DH0 A;  4NSB A;  4S3K A;  4MNJ A;  5HWC A;  4WIW A;  4R5E A;  3RM9 A;  4P8U A;  4GGQ A;  4IT4 A;  1KFW A;  4U86 A;  1W9V A;  4IQ2 A;  4ODO A;  1Y0O A;  4PTM A;  3TDB A;  1ZK6 A;  4WKF A;  2MF9 A;  4LAY A;  1HKM A;  1EHN A;  1D7H A;  3CHC A;  1JND A;  4HBE A;  4TYO A;  3WQV A;  4L72 B;  3O5F A;  1FKS A;  1WNO A;  3WD2 A;  4MNL A;  4ODM A;  3KAG A;  5DEZ A;  2ZQT A;  4WJX A;  3AS0 A;  3JYJ A;  2O92 A;  1NWS A;  1TCO C;  3RGC A;  2WLZ A;  2AOS A;  3UQI A;  1NWR A;  4QT3 A;  4IQC A;  2XP9 A;  1HKK A;  3JYM A;  3I6C A;  3WKZ A;  3AQU A;  3FXY A;  4NZC A;  3O5O A;  4MNK A;  3B8S A;  3O5D A;  2KGJ A;  1Q6H A;  3AS1 A;  3G6M A;  2LGO A;  1D6O A;  1JNS A;  2VCD A;  1IX5 A;  1LG1 A;  4AY1 A;  3ARW A;  4BF8 A;  2B31 A;  1FKR A;  4Q22 A;  1OGB A;  2XP8 A;  1RD6 A;  4P8V A;  3NTP A;  3O5I A;  4KQZ A;  2MLZ A;  2RSE A;  2ZR6 A;  4IT6 A;  3TC5 A;  3BXW A;  3OOB A;  3ALF A;  1GOI A;  2DSV A;  2PPO A;  1EQ3 A;  1E6R A;  1HJX A;  1FKT A;  1E6N A;  3WH0 A;  3ARP A;  4DRN A;  4G2P A;  2PV3 A;  4ITZ A;  2XP6 A;  1KT0 A;  4TW6 A;  1D7J A;  4TW8 A;  1FKL A;  1XHG A;  2IUZ A;  3JXV A;  4MSP A;  4FAP A;  1T11 A;  1LG2 A;  1ZL1 A;  4DRO A;  1GPF A;  3O5L A;  4Z2L A;  3WD1 A;  4HAR A;  4ML4 A;  4LAX A;  5J6E A;  1FFR A;  3RME A;  1FKI A;  3KZ7 A;  2VN1 A;  3CHF A;  5D75 A;  3TCZ A;  2PBC A;  1H0I A;  3WD4 A;  1SYT A;  2DG3 A;  2ZQV A;  3O5J A;  1FD9 A;  1F40 A;  1QPF A;  2WK2 A;  3IK8 A;  4URI A;  1NWT A;  4O2T A;  4W9Q A;  4FN2 A;  3ARQ A;  5BXJ A;  4G50 A;  3H9R B;  1E15 A;  3ARZ A;  3O5P A;  4DRQ A;  4KR0 B;  2F4E A;  4NNR A;  1J4R A;  1BL4 A;  1ZU8 A;  2DPE A;  5HWB A;  2ZR5 A;  4IPX A;  2G8Z A;  3AS3 A;  4S3J A;  3FAP A;  4QIB A;  4MPK A;  3WD0 A;  2UZ5 A;  5JH8 A;  5HT1 A;  1LL4 A;  2DT1 A;  4Q7N A;  2ZQS A;  4JFJ A;  4DWS D;  1H0G A;  5HW7 A;  1B6C A;  5HBF A;  4QT2 A;  1HJW A;  3EY6 A;  1M5Y A;  4DRP A;  1W1V A;  5HW8 A;  1X6N A;  2RQS A;  3IHZ A;  2A3B A;  1P5Q A;  2PPP A;  3RM4 A;  2K8I A;  1E6Z A;  1D7I A;  2MLY A;  2M08 A;  1JNT A;  3CZ8 A;  1PIN A;  2FAP A;  4MTV A;  5GPR A;  2JZV A;  1FAP A;  5DIV A;  1FKF A;  3B9E A;  3ARR A;  4P8W A;  2DSW A;  4TX0 A;  4DWS A;  3CGM A;  1J4H A;  1A7X A;  4DT4 A;  3PA7 A;  4L3N A;  1F8A B;  1W9P A;  3UQB A;  4DZ2 A;  1ZBW A;  2M2A A;  3O5G A;  4HBO A;  3AS2 A;  3VAW A;  1HXV A;  3ARS A;  1D2K A;  1FKK A;  4DRK A;  1ROT A;  3UI4 A;  2DT2 A;  3NRK A;  4MGV A;  2ZR4 A;  4DIP A;  3IKG A;  3UF8 A;  3OA5 A;  1E6P A;  1ROU A;  2IF4 A;  4ODR A;  1QPL A;  1YW5 A;  2OLH A;  3QOK A;  4TNS A;  5HKG A;  3FY1 A;  3ALG A;  2OFN A;  3O5M A;  1OGG A;  4N19 A;  1YAT A;  1ZBV A;  4TW7 A;  2PI6 A;  1TFV A;  2WM0 A;  4LGX A;  4WKH A;  4ODK A;  2A3E A;  2F2D A;  1K9T A;  1LJY A;  2XP7 A;  3O5E A;  1W26 A;  4JFK A;  2KO7 A;  1FKJ A;  3PR9 A;  2MNT A;  1ZCN A;  1O6I A;  4ZPT R;  4ZPW R;  2YBT A;  1J6Y A;  4U85 A;  5DIU A;  1N1A A;  1W9U A;  1J4I A;  3MDY B;  2RUQ A;  2DG9 A;  2DSU A;  2MPH A;  3WL1 A;  3CHD A;  2XP5 A;  4DWS C;  1JNE A;  4R0X A;  2F21 A;  5HW6 A;  1EYM A;  1W1T A;  3WL0 A;  1NH6 A;  1E9L A;  1UR8 A;  4J4O A;  1JVW A;  2XPB A;  2WLY A;  2LPV A;  1NMW A;  5HTG A;  4JFI A;  4MAV A;  2D9F A;  3ARO A;  1FKB A;  1FKH A;  1WAW A;  3ARV A;  1VF8 A;  4DRI A;  1LQ0 A;  5B8I C;  1OWQ A;  1NSG A;  4MNM A;  1CTN A;  3KAI A;  4Z2G A;  3CH9 A;  3KAF A;  3NI6 A;  3PRA A;  2ESC A;  3B9D A;  4DWS B;  4W5U A;  5GQB A;  3IKD A;  4ODN A;  4LAV A;  5GPG A;  2PV2 A;  4DRM A;  1UR9 A;  2XP4 A;  4Z2J A;  3ARX A;  2QF8 A;  1LL7 A;  1FKG A;  2ZQU A;  1L1P A;  3RFW A;  4ODQ A;  1PBK A;  2G41 A;  3UI5 A;  2A3C A;  2RUR A;  4DZ3 A;  3W4R A;  2XPA A;  1FFQ A;  1KT1 A;  2Y78 A;  1R9H A;  4GIV A;  5DO2 A;  3G6L A;  3ART A;  2FDM A;  4ODP A;  3KCE A;  3KAH A;  3B7X A;  3KAC A;  1HKI A;  4WK9 A;  2O9O A;  1HJV A;  2DSZ A;  2M1I A;  1HKJ A;  1NMV A;  3UQA A;  4QZV B;  4P8X A;  1FJD A;  3WQW A;  2N87 A;  2DT0 A;  4JFM A;  3UI6 A;  1W1P A;  4XAK A;  2DT3 A;  2LJ4 A;  3LUO A;  5DIT A;  1NWU A;  5DF0 A;  1Q6U A;  4WKA A;  3RM8 A;  1SR0 A;  1WB0 A;  3CHE A;  4LAW A;  1ITX A;  4Z2I A;  2LKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...