2KO7A

Solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with cycloheximide-n-ethylethanoate
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
117
structure length
117
Chain Sequence
GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title The structure of a Burkholderia pseudomallei immunophilin-inhibitor complex reveals new approaches to antimicrobial development.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
total genus 15
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ko7A00
1FKBA 2ZR4A 3PA7A 5HW7A 3O5FA 3KABA 1D6OA 5HWBA 1YATA 2Y78A 5GPGA 1W26A 2MNTA 4U86A 3KCEA 2N87A 3RGCA 4ODRA 2PPOA 3O5GA 2XP4A 1NSGA 2FKEA 2PV3A 4DRKA 3EY6A 1FKFA 1KT1A 4J4NA 2XPBA 5DITA 3O5KA 2KI3A 1HXVA 3H9RB 4DT4A 2D9FA 2PV2A 1QPLA 2L2SA 1J4IA 4TW7A 1FD9A 2XP9A 2RURA 1FKGA 4ODQA 1TCOC 2XP5A 5HW6A 1J6YA 3KZ7A 4FAPA 2KGJA 1EYMA 2RSEA 2LKNA 1PBKA 4JYSA 3PRDA 1D7HA 4ODPA 4U84A 3OOBA 1FKKA 1J4RA 2ITKA 1FAPA 3NTPA 4U85A 4W9OA 2AWGA 2F21A 2RUDA 4R0XA 4JFKA 1KT0A 5HUAA 5J6EA 2XP7A 4JFLA 1JVWA 4JFIA 1C9HA 3UQIA 2ZQSA 3TC5A 2XP8A 3UQAA 3UI4A 2K8IA 2RQSA 2RUQA 4DRJA 1JNTA 4ODOA 2KR7A 3O5IA 1L1PA 3O5OA 1ROUA 1BKFA 1NMVA 2F2DA 2XP6A 2M08A 4GIVA 4MGVA 4NNRA 4LAVA 4ODLA 2KFWA 4DIPA 1FKRA 1D7IA 1PINA 2VN1A 4TW6A 1FKTA 2MF9A 3KACA 2ZR5A 3CGNA 3IKDA 1Q6HA 1Y0OA 3WH0A 2LGOA 4IQCA 1Q6IA 4N19A 2F4EA 2PBCA 4G50A 4ODNA 4MSPA 4C02B 2OFNA 3JYMA 4J4OA 2RUCA 4QT2A 1N1AA 1Q6UA 4QIBA 3UI5A 2M1IA 2MLZA 2DG3A 3LUOA 3UF8A 5I98A 1D7JA 2PPNA 5D75A 4ODKA 4DRMA 4DZ3A 2Q5AA 3O5PA 4W9PA 3TCZA 2ZQTA 2MLYA 3UQBA 1P5QA 4DH0A 4TX0A 1F8AB 3O5QA 1ZK6A 4DRPA 3ODKA 4QT3A 1A7XA 2KO7A 3KADA 5HKGA 3GPKA 4JFMA 4LAYA 3O5JA 1FKJA 2MLXA 2M2AA 5DIUA 4W9QA 1F40A 1ROTA 2MPHA 2XPAA 3I6CA 4IPXA 2JZVA 3RFWA 3B7XA 4ITZA 5BXJA 3O5MA 3IHZA 2IF4A 3O5EA 4ODMA 3PRBA 4FN2A 4IQ2A 1B6CA 3CGMA 4DRNA 2LPVA 4DRQA 1EQ3A 4LAXA 4G2PA 1ZCNA 3O5DA 4JFJA 4DZ2A 5HW8A 1FKLA 3O5LA 3UI6A 1JNSA 1M5YA 4TNSA 3FAPA 3JYJA 1FKDA 5HWCA 1Q1CA 1FKIA 3IKGA 4DROA 2PV1A 3VAWA 4O2TA 3NI6A 4GGQA 2ZQVA 2FAPA 3KAFA 1NMWA 3TDBA 4BF8A 4DRIA 2VCDA 1FKSA 5HTGA 2UZ5A 3KAGA 5B8IC 1QZ2A 2KE0A 2LJ4A 4TW8A 1T11A 4DRHA 1FJDA 3KAIA 1YW5A 5DIVA 1J4HA 2ZQUA 4LAWA 5HT1A 4TYOA 1FKHA 3KAHA 2XP3A 1U79A 3MDYB 3JXVA 3IK8A 1BL4A 2DG4A 2PPPA 1R9HA 3NRKA 2ZR6A 3O5RA 2DG9A 1QPFA
chains in the Genus database with same CATH superfamily
1FKBA 4MAVA 1D6OA 1W9PA 5HWBA 1YATA 1E6RA 4ODRA 1NSGA 4DWSC 4MNJA 3H9RB 4WK9A 3OA5A 1J4IA 4XAKA 5HW6A 2XP5A 2PN0A 4Q22A 1D7HA 4ODPA 3B9DA 2ITKA 3RMEA 4W9OA 4HBEA 2RUDA 4JFKA 1KT0A 2ETNA 4DWSD 1HJWA 4JFIA 1C9HA 3FY1A 4S3KA 1EDQA 3UI4A 2RQSA 2KR7A 1L1PA 2A3EA 1W1TA 3O5OA 1IX5A 2M08A 4ODLA 2IUZA 2DT2A 2KFWA 4LAVA 4HARA 3ARPA 1FKTA 2AOSA 4IT6A 4N19A 4G50A 4MSPA 3AS3A 3WD1A 1OWQA 3AROA 4P8VA 2A3AA 2Q5AA 4URIA 1F8AB 1ZK6A 3KADA 3WD4A 3GPKA 4MNLA 2M2AA 4L72B 3WKZA 2JZVA 3RFWA 4ITZA 1SYTA 1FFRA 4IQ2A 4Z2KA 4DRNA 3CHCA 4LAXA 2A3BA 4JFJA 1NWSA 4DZ2A 3B9EA 1JNSA 1M5YA 1VF8A 3WD2A 3BMBA 1X6LA 2PV1A 4GGQA 1HJVA 3ALGA 4W5UA 3TDBA 4BF8A 1HKMA 2VCDA 3KAGA 4MNMA 3ARZA 4TW8A 4DRHA 1FJDA 3KAIA 5DIVA 1WB0A 4TYOA 1E6NA 1XRVA 5HW7A 3O5RA 2DG4A 2DG9A 4ML4A 4NNRA 3EIPA 3PA7A 2EULA 1GUVA 3O5GA 2XP4A 2FKEA 1FKFA 2XPBA 5DITA 2WK2A 1LJYA 3O5KA 1GOIA 1WNOA 4DT4A 1E15A 1LG2A 2PV2A 1QPLA 4TW7A 4HBOA 1NWRA 4ODQA 3ARWA 1EYMA 4MNKA 2RSEA 2LKNA 1PBKA 1FFQA 4Z2HA 4WJXA 1FKKA 4U85A 1GRJA 3WD0A 3AQUA 3UQIA 1UR8A 4DRJA 2K8IA 4ODOA 3O5IA 2XP6A 1NWTA 4GIVA 2OLHA 1D7IA 1ZU8A 2MF9A 3CGNA 3IKDA 2ESCA 3QOKA 1W1VA 1LL4A 4J4OA 2RUCA 1E6ZA 1W9VA 1N1AA 1OGBA 3UF8A 1D7JA 1ZBVA 4DRMA 3O5PA 3TCZA 1JCHB 2MLYA 3UQBA 1P5QA 4DH0A 1A7XA 4LAYA 3RM8A 3WL0A 5DIUA 4ZPWR 2MPHA 3I6CA 4IPXA 1D2KA 1ZBKA 1W1YA 5BXJA 2F23A 2IF4A 4P8UA 4FN2A 3CGMA 4WKAA 4UDMA 2DT0A 2DSVA 1ZCNA 4G2PA 1FKLA 5DF0A 3WQVA 1UR9A 3ARYA 4ZPVR 4DWSA 5GQBA 2ZQVA 2FAPA 2UZ5A 3ARUA 4ZS6A 1QZ2A 4QZVB 1YW5A 3CHEA 5HT1A 4NZCA 3KAHA 3IK8A 1BL4A 3NRKA 4MGVA 2ZR6A 1FKGA 3BXWA 2ZR4A 3O5FA 2Y78A 2MNTA 4U86A 2DSWA 4Q7NA 3RGCA 2PPOA 1LL7A 2PV3A 3EY6A 2KI3A 1HXVA 2D9FA 1TCOC 4FAPA 1E6PA 5JH8A 1E44A 2P4VA 2B5UB 4U84A 4KR0B 1J4RA 3NTPA 3GTYX 2AWGA 2F21A 2XP7A 4JFLA 1JVWA 5DEZA 2ZQSA 3TC5A 2XP8A 3UQAA 4S3JA 2RUQA 1ZL1A 4NSBA 1ITXA 3WIJA 1ROUA 2F2DA 1NMVA 3ARRA 1FKRA 2VN1A 1O6IA 3KACA 1NH6A 2ZR5A 3WH0A 1Q6HA 3G6MA 1JNEA 1NWUA 1Q6IA 3CH9A 2PBCA 4ODNA 3AS1A 4C02B 2OFNA 1Q6UA 2A3CA 2MLZA 1ZBCA 2PPNA 4R5EA 1OGGA 4W9PA 2ZQTA 4IT4A 1EHNA 3RM4A 4DRPA 3ARQA 5HKGA 4JFMA 3O5JA 1FKJA 2YBUA 4W9QA 1ROTA 1F40A 1K9TA 3B7XA 2QF8A 3FXYA 3O5MA 2DT3A 3IHZA 1HKKA 3CZ8A 4ODMA 3PRBA 4MTVA 1SR0A 2PI6A 4DRQA 5GPRA 3ARXA 3AS0A 4L3NA 1HKJA 3WQWA 3UI6A 3PR9A 4KQZA 4TNSA 2WLZA 1FKDA 2DT1A 5HWCA 2DSZA 3WD3A 1FKIA 4DROA 3VAWA 4O2TA 3NI6A 1ZB5A 2WLYA 4WIWA 4PTMA 5DO2A 5HTGA 4AY1A 2YBTA 1EIBA 3CHFA 3ARTA 4LAWA 1LG1A 2G41A 1FKHA 4ZPTR 2XP3A 4TX0A 4P8WA 4QT3A 4WKFA 2DSUA 3KABA 3ALFA 5GPGA 1W26A 3KCEA 2N87A 3ARVA 4DRKA 3AS2A 4J4NA 1W9UA 1KT1A 5HBFA 1XHGA 4P8XA 2L2SA 1FD9A 2XP9A 2RURA 1J6YA 3KZ7A 1KFWA 2KGJA 4JYSA 3G6LA 3OOBA 1FAPA 4R0XA 5J6EA 5HUAA 3RM9A 3B9AA 4WKHA 4MPKA 1JNDA 1JNTA 2G8ZA 1LQ0A 1BKFA 4DIPA 1PINA 4TW6A 4LGXA 3GU0A 4DWSB 1E9LA 1Y0OA 2LGOA 4IQCA 2B31A 2F4EA 1WAWA 1LL6A 3JYMA 4QT2A 1ZBWA 4QIBA 3UI5A 2M1IA 3PRAA 2DG3A 3LUOA 5I98A 2O9OA 1HKIA 5D75A 4ODKA 4DZ3A 1H0GA 2FDMA 3CHDA 4Z2GA 3O5QA 2O92A 3ODKA 2KO7A 4Z2LA 2MLXA 2XPAA 1W1PA 1H0IA 1X6NA 2WM0A 3O5EA 4Z2IA 1CTNA 1B6CA 2LPVA 1EQ3A 2DPEA 3O5DA 4Z2JA 5HW8A 3O5LA 1RD6A 3FAPA 1HJXA 3JYJA 3B8SA 1Q1CA 3ARSA 1TFVA 3IKGA 3W4RA 3KAFA 3WL1A 1NMWA 4DRIA 1FKSA 5B8IC 2KE0A 2LJ4A 1T11A 1J4HA 2ZQUA 1GPFA 3PRDA 1U79A 3MDYB 3JXVA 2PPPA 1R9HA 1QPFA
chains in the Genus database with same CATH topology
1FKBA 4MAVA 1D6OA 1W9PA 5HWBA 1YATA 1E6RA 4ODRA 1NSGA 4DWSC 4MNJA 3H9RB 4WK9A 3OA5A 1J4IA 4XAKA 5HW6A 2XP5A 4Q22A 1D7HA 4ODPA 3B9DA 2ITKA 3RMEA 4W9OA 4HBEA 2RUDA 4JFKA 1KT0A 4DWSD 1HJWA 4JFIA 1C9HA 3FY1A 4S3KA 1EDQA 3UI4A 2RQSA 2KR7A 1L1PA 2A3EA 1W1TA 3O5OA 1IX5A 2M08A 4ODLA 2IUZA 2DT2A 2KFWA 4LAVA 4HARA 3ARPA 1FKTA 2AOSA 4IT6A 4N19A 4G50A 4MSPA 3AS3A 3WD1A 1OWQA 3AROA 4P8VA 2A3AA 2Q5AA 4URIA 1F8AB 1ZK6A 3KADA 3WD4A 3GPKA 4MNLA 2M2AA 4L72B 3WKZA 2JZVA 3RFWA 4ITZA 1SYTA 1FFRA 4IQ2A 4Z2KA 4DRNA 3CHCA 4LAXA 2A3BA 4JFJA 1NWSA 4DZ2A 3B9EA 1JNSA 1M5YA 1VF8A 3WD2A 1X6LA 2PV1A 4GGQA 1HJVA 3ALGA 4W5UA 3TDBA 4BF8A 1HKMA 2VCDA 3KAGA 4MNMA 3ARZA 4TW8A 4DRHA 1FJDA 3KAIA 5DIVA 1WB0A 4TYOA 1E6NA 1XRVA 5HW7A 2DG4A 2DG9A 4ML4A 4NNRA 3PA7A 1GUVA 3O5GA 2XP4A 2FKEA 1FKFA 2XPBA 5DITA 2WK2A 1LJYA 3O5KA 1GOIA 1WNOA 4DT4A 1E15A 1LG2A 2PV2A 1QPLA 4TW7A 4HBOA 1NWRA 4ODQA 3ARWA 1EYMA 4MNKA 2RSEA 2LKNA 1PBKA 1FFQA 4Z2HA 4WJXA 1FKKA 4U85A 3WD0A 3AQUA 3UQIA 1UR8A 4DRJA 2K8IA 4ODOA 3O5IA 2XP6A 1NWTA 4GIVA 2OLHA 1D7IA 1ZU8A 2MF9A 3CGNA 3IKDA 2ESCA 3QOKA 1W1VA 1LL4A 4J4OA 2RUCA 1E6ZA 1W9VA 1N1AA 1OGBA 3UF8A 1D7JA 1ZBVA 4DRMA 3O5PA 3TCZA 2MLYA 3UQBA 1P5QA 4DH0A 1A7XA 4LAYA 3RM8A 3WL0A 5DIUA 4ZPWR 2MPHA 3I6CA 4IPXA 1D2KA 1ZBKA 1W1YA 5BXJA 2IF4A 4P8UA 4FN2A 3CGMA 4WKAA 2DT0A 2DSVA 1ZCNA 4G2PA 1FKLA 5DF0A 3WQVA 1UR9A 3ARYA 4ZPVR 4DWSA 5GQBA 2ZQVA 2FAPA 2UZ5A 3ARUA 4ZS6A 1QZ2A 4QZVB 1YW5A 3CHEA 5HT1A 4NZCA 3KAHA 3IK8A 1BL4A 3NRKA 4MGVA 2ZR6A 1FKGA 3BXWA 2ZR4A 3O5FA 2Y78A 2MNTA 4U86A 2DSWA 4Q7NA 3RGCA 2PPOA 1LL7A 2PV3A 3EY6A 2KI3A 1HXVA 2D9FA 1TCOC 4FAPA 1E6PA 5JH8A 4U84A 4KR0B 1J4RA 3NTPA 2AWGA 2F21A 2XP7A 4JFLA 1JVWA 5DEZA 2ZQSA 3TC5A 2XP8A 3UQAA 4S3JA 2RUQA 1ZL1A 4NSBA 1ITXA 3WIJA 1ROUA 2F2DA 1NMVA 3ARRA 1FKRA 2VN1A 1O6IA 3KACA 1NH6A 2ZR5A 3WH0A 1Q6HA 3G6MA 1JNEA 1NWUA 1Q6IA 3CH9A 2PBCA 4ODNA 3AS1A 4C02B 2OFNA 1Q6UA 2A3CA 2MLZA 1ZBCA 2PPNA 4R5EA 1OGGA 4W9PA 2ZQTA 4IT4A 1EHNA 3RM4A 4DRPA 3ARQA 5HKGA 4JFMA 3O5JA 1FKJA 2YBUA 4W9QA 1ROTA 1F40A 1K9TA 3B7XA 2QF8A 3FXYA 3O5MA 2DT3A 3IHZA 1HKKA 3CZ8A 4ODMA 3PRBA 4MTVA 1SR0A 2PI6A 4DRQA 5GPRA 3ARXA 3AS0A 4L3NA 1HKJA 3WQWA 3UI6A 3PR9A 4KQZA 4TNSA 2WLZA 1FKDA 2DT1A 5HWCA 2DSZA 3WD3A 1FKIA 4DROA 3VAWA 4O2TA 3NI6A 1ZB5A 2WLYA 4WIWA 4PTMA 5DO2A 5HTGA 4AY1A 2YBTA 1EIBA 3CHFA 3ARTA 4LAWA 1LG1A 2G41A 1FKHA 4ZPTR 2XP3A 4TX0A 4P8WA 4QT3A 4WKFA 2DSUA 3KABA 3ALFA 5GPGA 1W26A 3KCEA 2N87A 3ARVA 4DRKA 3AS2A 4J4NA 1W9UA 1KT1A 5HBFA 1XHGA 1QPFA 4P8XA 2L2SA 1FD9A 2XP9A 2RURA 1J6YA 3KZ7A 1KFWA 2KGJA 4JYSA 3G6LA 3OOBA 1FAPA 4R0XA 5J6EA 5HUAA 3RM9A 3B9AA 4WKHA 4MPKA 1JNDA 1JNTA 2G8ZA 1LQ0A 1BKFA 4DIPA 1PINA 4TW6A 4LGXA 4DWSB 1E9LA 1Y0OA 2LGOA 4IQCA 2B31A 2F4EA 1WAWA 1LL6A 3JYMA 4QT2A 1ZBWA 4QIBA 3UI5A 2M1IA 3PRAA 2DG3A 3LUOA 5I98A 2O9OA 1HKIA 5D75A 4ODKA 4DZ3A 1H0GA 2FDMA 3CHDA 4Z2GA 3O5QA 2O92A 3ODKA 2KO7A 4Z2LA 2MLXA 2XPAA 1W1PA 1H0IA 1X6NA 2WM0A 3O5EA 4Z2IA 1CTNA 1B6CA 2LPVA 1EQ3A 2DPEA 3O5DA 4Z2JA 5HW8A 3O5LA 1RD6A 3FAPA 1HJXA 3JYJA 3B8SA 1Q1CA 3ARSA 1TFVA 3IKGA 3W4RA 3KAFA 3WL1A 1NMWA 4DRIA 1FKSA 5B8IC 2KE0A 2LJ4A 1T11A 1J4HA 2ZQUA 1GPFA 3PRDA 1U79A 3MDYB 3JXVA 2PPPA 1R9HA 3O5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKB A;  2ZR4 A;  3PA7 A;  5HW7 A;  3O5F A;  3KAB A;  1D6O A;  5HWB A;  1YAT A;  2Y78 A;  5GPG A;  1W26 A;  2MNT A;  4U86 A;  3KCE A;  2N87 A;  3RGC A;  4ODR A;  2PPO A;  3O5G A;  2XP4 A;  1NSG A;  2FKE A;  2PV3 A;  4DRK A;  3EY6 A;  1FKF A;  1KT1 A;  4J4N A;  2XPB A;  5DIT A;  3O5K A;  2KI3 A;  1HXV A;  3H9R B;  4DT4 A;  2D9F A;  2PV2 A;  1QPL A;  2L2S A;  1J4I A;  4TW7 A;  1FD9 A;  2XP9 A;  2RUR A;  1FKG A;  4ODQ A;  1TCO C;  2XP5 A;  5HW6 A;  1J6Y A;  3KZ7 A;  4FAP A;  2KGJ A;  1EYM A;  2RSE A;  2LKN A;  1PBK A;  4JYS A;  3PRD A;  1D7H A;  4ODP A;  4U84 A;  3OOB A;  1FKK A;  1J4R A;  2ITK A;  1FAP A;  3NTP A;  4U85 A;  4W9O A;  2AWG A;  2F21 A;  2RUD A;  4R0X A;  4JFK A;  1KT0 A;  5HUA A;  5J6E A;  2XP7 A;  4JFL A;  1JVW A;  4JFI A;  1C9H A;  3UQI A;  2ZQS A;  3TC5 A;  2XP8 A;  3UQA A;  3UI4 A;  2K8I A;  2RQS A;  2RUQ A;  4DRJ A;  1JNT A;  4ODO A;  2KR7 A;  3O5I A;  1L1P A;  3O5O A;  1ROU A;  1BKF A;  1NMV A;  2F2D A;  2XP6 A;  2M08 A;  4GIV A;  4MGV A;  4NNR A;  4LAV A;  4ODL A;  2KFW A;  4DIP A;  1FKR A;  1D7I A;  1PIN A;  2VN1 A;  4TW6 A;  1FKT A;  2MF9 A;  3KAC A;  2ZR5 A;  3CGN A;  3IKD A;  1Q6H A;  1Y0O A;  3WH0 A;  2LGO A;  4IQC A;  1Q6I A;  4N19 A;  2F4E A;  2PBC A;  4G50 A;  4ODN A;  4MSP A;  4C02 B;  2OFN A;  3JYM A;  4J4O A;  2RUC A;  4QT2 A;  1N1A A;  1Q6U A;  4QIB A;  3UI5 A;  2M1I A;  2MLZ A;  2DG3 A;  3LUO A;  3UF8 A;  5I98 A;  1D7J A;  2PPN A;  5D75 A;  4ODK A;  4DRM A;  4DZ3 A;  2Q5A A;  3O5P A;  4W9P A;  3TCZ A;  2ZQT A;  2MLY A;  3UQB A;  1P5Q A;  4DH0 A;  4TX0 A;  1F8A B;  3O5Q A;  1ZK6 A;  4DRP A;  3ODK A;  4QT3 A;  1A7X A;  2KO7 A;  3KAD A;  5HKG A;  3GPK A;  4JFM A;  4LAY A;  3O5J A;  1FKJ A;  2MLX A;  2M2A A;  5DIU A;  4W9Q A;  1F40 A;  1ROT A;  2MPH A;  2XPA A;  3I6C A;  4IPX A;  2JZV A;  3RFW A;  3B7X A;  4ITZ A;  5BXJ A;  3O5M A;  3IHZ A;  2IF4 A;  3O5E A;  4ODM A;  3PRB A;  4FN2 A;  4IQ2 A;  1B6C A;  3CGM A;  4DRN A;  2LPV A;  4DRQ A;  1EQ3 A;  4LAX A;  4G2P A;  1ZCN A;  3O5D A;  4JFJ A;  4DZ2 A;  5HW8 A;  1FKL A;  3O5L A;  3UI6 A;  1JNS A;  1M5Y A;  4TNS A;  3FAP A;  3JYJ A;  1FKD A;  5HWC A;  1Q1C A;  1FKI A;  3IKG A;  4DRO A;  2PV1 A;  3VAW A;  4O2T A;  3NI6 A;  4GGQ A;  2ZQV A;  2FAP A;  3KAF A;  1NMW A;  3TDB A;  4BF8 A;  4DRI A;  2VCD A;  1FKS A;  5HTG A;  2UZ5 A;  3KAG A;  5B8I C;  1QZ2 A;  2KE0 A;  2LJ4 A;  4TW8 A;  1T11 A;  4DRH A;  1FJD A;  3KAI A;  1YW5 A;  5DIV A;  1J4H A;  2ZQU A;  4LAW A;  5HT1 A;  4TYO A;  1FKH A;  3KAH A;  2XP3 A;  1U79 A;  3MDY B;  3JXV A;  3IK8 A;  1BL4 A;  2DG4 A;  2PPP A;  1R9H A;  3NRK A;  2ZR6 A;  3O5R A;  2DG9 A;  1QPF A; 
#chains in the Genus database with same CATH topology
 1FKB A;  4MAV A;  1D6O A;  1W9P A;  5HWB A;  1YAT A;  1E6R A;  4ODR A;  1NSG A;  4DWS C;  4MNJ A;  3H9R B;  4WK9 A;  3OA5 A;  1J4I A;  4XAK A;  5HW6 A;  2XP5 A;  2PN0 A;  4Q22 A;  1D7H A;  4ODP A;  3B9D A;  2ITK A;  3RME A;  4W9O A;  4HBE A;  2RUD A;  4JFK A;  1KT0 A;  2ETN A;  4DWS D;  1HJW A;  4JFI A;  1C9H A;  3FY1 A;  4S3K A;  1EDQ A;  3UI4 A;  2RQS A;  2KR7 A;  1L1P A;  2A3E A;  1W1T A;  3O5O A;  1IX5 A;  2M08 A;  4ODL A;  2IUZ A;  2DT2 A;  2KFW A;  4LAV A;  4HAR A;  3ARP A;  1FKT A;  2AOS A;  4IT6 A;  4N19 A;  4G50 A;  4MSP A;  3AS3 A;  3WD1 A;  1OWQ A;  3ARO A;  4P8V A;  2A3A A;  2Q5A A;  4URI A;  1F8A B;  1ZK6 A;  3KAD A;  3WD4 A;  3GPK A;  4MNL A;  2M2A A;  4L72 B;  3WKZ A;  2JZV A;  3RFW A;  4ITZ A;  1SYT A;  1FFR A;  4IQ2 A;  4Z2K A;  4DRN A;  3CHC A;  4LAX A;  2A3B A;  4JFJ A;  1NWS A;  4DZ2 A;  3B9E A;  1JNS A;  1M5Y A;  1VF8 A;  3WD2 A;  3BMB A;  1X6L A;  2PV1 A;  4GGQ A;  1HJV A;  3ALG A;  4W5U A;  3TDB A;  4BF8 A;  1HKM A;  2VCD A;  3KAG A;  4MNM A;  3ARZ A;  4TW8 A;  4DRH A;  1FJD A;  3KAI A;  5DIV A;  1WB0 A;  4TYO A;  1E6N A;  1XRV A;  5HW7 A;  3O5R A;  2DG4 A;  2DG9 A;  4ML4 A;  4NNR A;  3EIP A;  3PA7 A;  2EUL A;  1GUV A;  3O5G A;  2XP4 A;  2FKE A;  1FKF A;  2XPB A;  5DIT A;  2WK2 A;  1LJY A;  3O5K A;  1GOI A;  1WNO A;  4DT4 A;  1E15 A;  1LG2 A;  2PV2 A;  1QPL A;  4TW7 A;  4HBO A;  1NWR A;  4ODQ A;  3ARW A;  1EYM A;  4MNK A;  2RSE A;  2LKN A;  1PBK A;  1FFQ A;  4Z2H A;  4WJX A;  1FKK A;  4U85 A;  1GRJ A;  3WD0 A;  3AQU A;  3UQI A;  1UR8 A;  4DRJ A;  2K8I A;  4ODO A;  3O5I A;  2XP6 A;  1NWT A;  4GIV A;  2OLH A;  1D7I A;  1ZU8 A;  2MF9 A;  3CGN A;  3IKD A;  2ESC A;  3QOK A;  1W1V A;  1LL4 A;  4J4O A;  2RUC A;  1E6Z A;  1W9V A;  1N1A A;  1OGB A;  3UF8 A;  1D7J A;  1ZBV A;  4DRM A;  3O5P A;  3TCZ A;  1JCH B;  2MLY A;  3UQB A;  1P5Q A;  4DH0 A;  1A7X A;  4LAY A;  3RM8 A;  3WL0 A;  5DIU A;  4ZPW R;  2MPH A;  3I6C A;  4IPX A;  1D2K A;  1ZBK A;  1W1Y A;  5BXJ A;  2F23 A;  2IF4 A;  4P8U A;  4FN2 A;  3CGM A;  4WKA A;  4UDM A;  2DT0 A;  2DSV A;  1ZCN A;  4G2P A;  1FKL A;  5DF0 A;  3WQV A;  1UR9 A;  3ARY A;  4ZPV R;  4DWS A;  5GQB A;  2ZQV A;  2FAP A;  2UZ5 A;  3ARU A;  4ZS6 A;  1QZ2 A;  4QZV B;  1YW5 A;  3CHE A;  5HT1 A;  4NZC A;  3KAH A;  3IK8 A;  1BL4 A;  3NRK A;  4MGV A;  2ZR6 A;  1FKG A;  3BXW A;  2ZR4 A;  3O5F A;  2Y78 A;  2MNT A;  4U86 A;  2DSW A;  4Q7N A;  3RGC A;  2PPO A;  1LL7 A;  2PV3 A;  3EY6 A;  2KI3 A;  1HXV A;  2D9F A;  1TCO C;  4FAP A;  1E6P A;  5JH8 A;  1E44 A;  2P4V A;  2B5U B;  4U84 A;  4KR0 B;  1J4R A;  3NTP A;  3GTY X;  2AWG A;  2F21 A;  2XP7 A;  4JFL A;  1JVW A;  5DEZ A;  2ZQS A;  3TC5 A;  2XP8 A;  3UQA A;  4S3J A;  2RUQ A;  1ZL1 A;  4NSB A;  1ITX A;  3WIJ A;  1ROU A;  2F2D A;  1NMV A;  3ARR A;  1FKR A;  2VN1 A;  1O6I A;  3KAC A;  1NH6 A;  2ZR5 A;  3WH0 A;  1Q6H A;  3G6M A;  1JNE A;  1NWU A;  1Q6I A;  3CH9 A;  2PBC A;  4ODN A;  3AS1 A;  4C02 B;  2OFN A;  1Q6U A;  2A3C A;  2MLZ A;  1ZBC A;  2PPN A;  4R5E A;  1OGG A;  4W9P A;  2ZQT A;  4IT4 A;  1EHN A;  3RM4 A;  4DRP A;  3ARQ A;  5HKG A;  4JFM A;  3O5J A;  1FKJ A;  2YBU A;  4W9Q A;  1ROT A;  1F40 A;  1K9T A;  3B7X A;  2QF8 A;  3FXY A;  3O5M A;  2DT3 A;  3IHZ A;  1HKK A;  3CZ8 A;  4ODM A;  3PRB A;  4MTV A;  1SR0 A;  2PI6 A;  4DRQ A;  5GPR A;  3ARX A;  3AS0 A;  4L3N A;  1HKJ A;  3WQW A;  3UI6 A;  3PR9 A;  4KQZ A;  4TNS A;  2WLZ A;  1FKD A;  2DT1 A;  5HWC A;  2DSZ A;  3WD3 A;  1FKI A;  4DRO A;  3VAW A;  4O2T A;  3NI6 A;  1ZB5 A;  2WLY A;  4WIW A;  4PTM A;  5DO2 A;  5HTG A;  4AY1 A;  2YBT A;  1EIB A;  3CHF A;  3ART A;  4LAW A;  1LG1 A;  2G41 A;  1FKH A;  4ZPT R;  2XP3 A;  4TX0 A;  4P8W A;  4QT3 A;  4WKF A;  2DSU A;  3KAB A;  3ALF A;  5GPG A;  1W26 A;  3KCE A;  2N87 A;  3ARV A;  4DRK A;  3AS2 A;  4J4N A;  1W9U A;  1KT1 A;  5HBF A;  1XHG A;  4P8X A;  2L2S A;  1FD9 A;  2XP9 A;  2RUR A;  1J6Y A;  3KZ7 A;  1KFW A;  2KGJ A;  4JYS A;  3G6L A;  3OOB A;  1FAP A;  4R0X A;  5J6E A;  5HUA A;  3RM9 A;  3B9A A;  4WKH A;  4MPK A;  1JND A;  1JNT A;  2G8Z A;  1LQ0 A;  1BKF A;  4DIP A;  1PIN A;  4TW6 A;  4LGX A;  3GU0 A;  4DWS B;  1E9L A;  1Y0O A;  2LGO A;  4IQC A;  2B31 A;  2F4E A;  1WAW A;  1LL6 A;  3JYM A;  4QT2 A;  1ZBW A;  4QIB A;  3UI5 A;  2M1I A;  3PRA A;  2DG3 A;  3LUO A;  5I98 A;  2O9O A;  1HKI A;  5D75 A;  4ODK A;  4DZ3 A;  1H0G A;  2FDM A;  3CHD A;  4Z2G A;  3O5Q A;  2O92 A;  3ODK A;  2KO7 A;  4Z2L A;  2MLX A;  2XPA A;  1W1P A;  1H0I A;  1X6N A;  2WM0 A;  3O5E A;  4Z2I A;  1CTN A;  1B6C A;  2LPV A;  1EQ3 A;  2DPE A;  3O5D A;  4Z2J A;  5HW8 A;  3O5L A;  1RD6 A;  3FAP A;  1HJX A;  3JYJ A;  3B8S A;  1Q1C A;  3ARS A;  1TFV A;  3IKG A;  3W4R A;  3KAF A;  3WL1 A;  1NMW A;  4DRI A;  1FKS A;  5B8I C;  2KE0 A;  2LJ4 A;  1T11 A;  1J4H A;  2ZQU A;  1GPF A;  3PRD A;  1U79 A;  3MDY B;  3JXV A;  2PPP A;  1R9H A;  1QPF A; 
#chains in the Genus database with same CATH homology
 1FKB A;  4MAV A;  1D6O A;  1W9P A;  5HWB A;  1YAT A;  1E6R A;  4ODR A;  1NSG A;  4DWS C;  4MNJ A;  3H9R B;  4WK9 A;  3OA5 A;  1J4I A;  4XAK A;  5HW6 A;  2XP5 A;  4Q22 A;  1D7H A;  4ODP A;  3B9D A;  2ITK A;  3RME A;  4W9O A;  4HBE A;  2RUD A;  4JFK A;  1KT0 A;  4DWS D;  1HJW A;  4JFI A;  1C9H A;  3FY1 A;  4S3K A;  1EDQ A;  3UI4 A;  2RQS A;  2KR7 A;  1L1P A;  2A3E A;  1W1T A;  3O5O A;  1IX5 A;  2M08 A;  4ODL A;  2IUZ A;  2DT2 A;  2KFW A;  4LAV A;  4HAR A;  3ARP A;  1FKT A;  2AOS A;  4IT6 A;  4N19 A;  4G50 A;  4MSP A;  3AS3 A;  3WD1 A;  1OWQ A;  3ARO A;  4P8V A;  2A3A A;  2Q5A A;  4URI A;  1F8A B;  1ZK6 A;  3KAD A;  3WD4 A;  3GPK A;  4MNL A;  2M2A A;  4L72 B;  3WKZ A;  2JZV A;  3RFW A;  4ITZ A;  1SYT A;  1FFR A;  4IQ2 A;  4Z2K A;  4DRN A;  3CHC A;  4LAX A;  2A3B A;  4JFJ A;  1NWS A;  4DZ2 A;  3B9E A;  1JNS A;  1M5Y A;  1VF8 A;  3WD2 A;  1X6L A;  2PV1 A;  4GGQ A;  1HJV A;  3ALG A;  4W5U A;  3TDB A;  4BF8 A;  1HKM A;  2VCD A;  3KAG A;  4MNM A;  3ARZ A;  4TW8 A;  4DRH A;  1FJD A;  3KAI A;  5DIV A;  1WB0 A;  4TYO A;  1E6N A;  1XRV A;  5HW7 A;  2DG4 A;  2DG9 A;  4ML4 A;  4NNR A;  3PA7 A;  1GUV A;  3O5G A;  2XP4 A;  2FKE A;  1FKF A;  2XPB A;  5DIT A;  2WK2 A;  1LJY A;  3O5K A;  1GOI A;  1WNO A;  4DT4 A;  1E15 A;  1LG2 A;  2PV2 A;  1QPL A;  4TW7 A;  4HBO A;  1NWR A;  4ODQ A;  3ARW A;  1EYM A;  4MNK A;  2RSE A;  2LKN A;  1PBK A;  1FFQ A;  4Z2H A;  4WJX A;  1FKK A;  4U85 A;  3WD0 A;  3AQU A;  3UQI A;  1UR8 A;  4DRJ A;  2K8I A;  4ODO A;  3O5I A;  2XP6 A;  1NWT A;  4GIV A;  2OLH A;  1D7I A;  1ZU8 A;  2MF9 A;  3CGN A;  3IKD A;  2ESC A;  3QOK A;  1W1V A;  1LL4 A;  4J4O A;  2RUC A;  1E6Z A;  1W9V A;  1N1A A;  1OGB A;  3UF8 A;  1D7J A;  1ZBV A;  4DRM A;  3O5P A;  3TCZ A;  2MLY A;  3UQB A;  1P5Q A;  4DH0 A;  1A7X A;  4LAY A;  3RM8 A;  3WL0 A;  5DIU A;  4ZPW R;  2MPH A;  3I6C A;  4IPX A;  1D2K A;  1ZBK A;  1W1Y A;  5BXJ A;  2IF4 A;  4P8U A;  4FN2 A;  3CGM A;  4WKA A;  2DT0 A;  2DSV A;  1ZCN A;  4G2P A;  1FKL A;  5DF0 A;  3WQV A;  1UR9 A;  3ARY A;  4ZPV R;  4DWS A;  5GQB A;  2ZQV A;  2FAP A;  2UZ5 A;  3ARU A;  4ZS6 A;  1QZ2 A;  4QZV B;  1YW5 A;  3CHE A;  5HT1 A;  4NZC A;  3KAH A;  3IK8 A;  1BL4 A;  3NRK A;  4MGV A;  2ZR6 A;  1FKG A;  3BXW A;  2ZR4 A;  3O5F A;  2Y78 A;  2MNT A;  4U86 A;  2DSW A;  4Q7N A;  3RGC A;  2PPO A;  1LL7 A;  2PV3 A;  3EY6 A;  2KI3 A;  1HXV A;  2D9F A;  1TCO C;  4FAP A;  1E6P A;  5JH8 A;  4U84 A;  4KR0 B;  1J4R A;  3NTP A;  2AWG A;  2F21 A;  2XP7 A;  4JFL A;  1JVW A;  5DEZ A;  2ZQS A;  3TC5 A;  2XP8 A;  3UQA A;  4S3J A;  2RUQ A;  1ZL1 A;  4NSB A;  1ITX A;  3WIJ A;  1ROU A;  2F2D A;  1NMV A;  3ARR A;  1FKR A;  2VN1 A;  1O6I A;  3KAC A;  1NH6 A;  2ZR5 A;  3WH0 A;  1Q6H A;  3G6M A;  1JNE A;  1NWU A;  1Q6I A;  3CH9 A;  2PBC A;  4ODN A;  3AS1 A;  4C02 B;  2OFN A;  1Q6U A;  2A3C A;  2MLZ A;  1ZBC A;  2PPN A;  4R5E A;  1OGG A;  4W9P A;  2ZQT A;  4IT4 A;  1EHN A;  3RM4 A;  4DRP A;  3ARQ A;  5HKG A;  4JFM A;  3O5J A;  1FKJ A;  2YBU A;  4W9Q A;  1ROT A;  1F40 A;  1K9T A;  3B7X A;  2QF8 A;  3FXY A;  3O5M A;  2DT3 A;  3IHZ A;  1HKK A;  3CZ8 A;  4ODM A;  3PRB A;  4MTV A;  1SR0 A;  2PI6 A;  4DRQ A;  5GPR A;  3ARX A;  3AS0 A;  4L3N A;  1HKJ A;  3WQW A;  3UI6 A;  3PR9 A;  4KQZ A;  4TNS A;  2WLZ A;  1FKD A;  2DT1 A;  5HWC A;  2DSZ A;  3WD3 A;  1FKI A;  4DRO A;  3VAW A;  4O2T A;  3NI6 A;  1ZB5 A;  2WLY A;  4WIW A;  4PTM A;  5DO2 A;  5HTG A;  4AY1 A;  2YBT A;  1EIB A;  3CHF A;  3ART A;  4LAW A;  1LG1 A;  2G41 A;  1FKH A;  4ZPT R;  2XP3 A;  4TX0 A;  4P8W A;  4QT3 A;  4WKF A;  2DSU A;  3KAB A;  3ALF A;  5GPG A;  1W26 A;  3KCE A;  2N87 A;  3ARV A;  4DRK A;  3AS2 A;  4J4N A;  1W9U A;  1KT1 A;  5HBF A;  1XHG A;  1QPF A;  4P8X A;  2L2S A;  1FD9 A;  2XP9 A;  2RUR A;  1J6Y A;  3KZ7 A;  1KFW A;  2KGJ A;  4JYS A;  3G6L A;  3OOB A;  1FAP A;  4R0X A;  5J6E A;  5HUA A;  3RM9 A;  3B9A A;  4WKH A;  4MPK A;  1JND A;  1JNT A;  2G8Z A;  1LQ0 A;  1BKF A;  4DIP A;  1PIN A;  4TW6 A;  4LGX A;  4DWS B;  1E9L A;  1Y0O A;  2LGO A;  4IQC A;  2B31 A;  2F4E A;  1WAW A;  1LL6 A;  3JYM A;  4QT2 A;  1ZBW A;  4QIB A;  3UI5 A;  2M1I A;  3PRA A;  2DG3 A;  3LUO A;  5I98 A;  2O9O A;  1HKI A;  5D75 A;  4ODK A;  4DZ3 A;  1H0G A;  2FDM A;  3CHD A;  4Z2G A;  3O5Q A;  2O92 A;  3ODK A;  2KO7 A;  4Z2L A;  2MLX A;  2XPA A;  1W1P A;  1H0I A;  1X6N A;  2WM0 A;  3O5E A;  4Z2I A;  1CTN A;  1B6C A;  2LPV A;  1EQ3 A;  2DPE A;  3O5D A;  4Z2J A;  5HW8 A;  3O5L A;  1RD6 A;  3FAP A;  1HJX A;  3JYJ A;  3B8S A;  1Q1C A;  3ARS A;  1TFV A;  3IKG A;  3W4R A;  3KAF A;  3WL1 A;  1NMW A;  4DRI A;  1FKS A;  5B8I C;  2KE0 A;  2LJ4 A;  1T11 A;  1J4H A;  2ZQU A;  1GPF A;  3PRD A;  1U79 A;  3MDY B;  3JXV A;  2PPP A;  1R9H A;  3O5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...