2KO7A

Solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with cycloheximide-n-ethylethanoate
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
117
structure length
117
Chain Sequence
GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a Burkholderia pseudomallei immunophilin-inhibitor complex reveals new approaches to antimicrobial development.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 15
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ko7A00
2KI3A 2L2SA 3O5GA 1U79A 2XPBA 1KT0A 4IQ2A 4LAVA 4DT4A 1F40A 1J4IA 2MLYA 3TC5A 3TCZA 5HTGA 1W26A 2RSEA 3IHZA 4JFIA 2FAPA 4ODOA 2MLXA 2VCDA 1ZCNA 1Y0OA 1JVWA 1QPFA 1R9HA 3JXVA 1NSGA 2RUCA 3KACA 1J4HA 3WH0A 1L1PA 3O5DA 5I98A 1YATA 2OFNA 1FKTA 4JFKA 5HW8A 2PV2A 2XP9A 4QT3A 5HUAA 3IKDA 1ZK6A 2ZR4A 2KR7A 1FKFA 1FKSA 1M5YA 4J4OA 1T11A 1ROUA 2D9FA 1QPLA 3UF8A 3FAPA 2LGOA 2M2AA 2PPPA 2MPHA 2XP8A 3KZ7A 3NRKA 3O5OA 5J6EA 4FAPA 1QZ2A 5GPGA 4G50A 2RUDA 2XP6A 3OOBA 1J6YA 1EQ3A 1Q1CA 3KAFA 5BXJA 4W9OA 1JNSA 2F2DA 3O5EA 3TDBA 5HWBA 3IKGA 3MDYB 4ODKA 1Q6IA 3PRDA 4QT2A 5HW6A 1D7IA 4MGVA 2XP7A 1Q6UA 2ZQUA 4NNRA 5DITA 2AWGA 4TW8A 2FKEA 3NI6A 3UI4A 1FKHA 2LPVA 2XP3A 4DRHA 1NMVA 1FKIA 4MSPA 2ZR5A 1FKGA 3O5PA 4GGQA 4JFMA 2ZQVA 4TW6A 3UQAA 3UQBA 5DIUA 3I6CA 2RUQA 3LUOA 1C9HA 3O5QA 1PBKA 3JYJA 4TW7A 1A7XA 1B6CA 1FKBA 2IF4A 1EYMA 3KAIA 2ZR6A 2KE0A 2PPOA 3JYMA 1JNTA 2UZ5A 4IQCA 3RFWA 3O5JA 4ITZA 4U85A 3B7XA 3H9RB 1BL4A 2F4EA 2DG9A 1F8AB 2RQSA 1KT1A 3KABA 2XP4A 1PINA 3PRBA 2ZQTA 3EY6A 2KFWA 1J4RA 4LAXA 2PPNA 3KAHA 4ODQA 4R0XA 4DRPA 4LAWA 1D7HA 1FAPA 2VN1A 3O5IA 3PA7A 4ODMA 4BF8A 4DRQA 4GIVA 4DRKA 2F21A 3O5RA 1BKFA 3KCEA 3KADA 2MNTA 2RURA 1YW5A 3GPKA 4FN2A 4J4NA 4U86A 2M1IA 4W9PA 5HT1A 2KGJA 4LAYA 1ROTA 4TYOA 5HW7A 2N87A 1P5QA 3CGMA 2XP5A 3NTPA 2ITKA 4IPXA 4DIPA 4JFJA 2PBCA 4TNSA 4W9QA 5DIVA 1FKJA 1Q6HA 4DH0A 1NMWA 3UQIA 2MF9A 3VAWA 1TCOC 2JZVA 2DG4A 2M08A 3O5LA 2PV3A 2MLZA 4DRMA 4DZ3A 2Y78A 5HWCA 4JFLA 4ODLA 4ODRA 3O5FA 5D75A 3ODKA 1FKRA 4DRNA 4N19A 4U84A 2PV1A 1FD9A 5B8IC 1FKLA 2KO7A 4JYSA 1D6OA 4O2TA 4ODPA 2DG3A 2Q5AA 4G2PA 4QIBA 3O5KA 1FKKA 2K8IA 3IK8A 3KAGA 2XPAA 4C02B 4DZ2A 1HXVA 5HKGA 3O5MA 4DRIA 3CGNA 1D7JA 2ZQSA 4TX0A 1FJDA 2LKNA 3RGCA 1N1AA 3UI5A 3UI6A 4DRJA 4ODNA 4DROA 2LJ4A 1FKDA
chains in the Genus database with same CATH superfamily
2KI3A 4LAVA 1KT0A 1J4IA 3IHZA 4Q7NA 2FAPA 4ODOA 2MLXA 3WD4A 2DT1A 1UR9A 1LL4A 1QPFA 1J4HA 3FXYA 4P8UA 2ZR4A 2KR7A 4Z2JA 4J4OA 1FKSA 1T11A 3ARPA 1WNOA 3WL0A 2DSWA 4ML4A 4ZPVR 3KAFA 4W9OA 1JNSA 3MDYB 3PRDA 4QT2A 2DSUA 2ZQUA 5DITA 1ZBCA 3ARWA 4DRHA 1FKIA 3BXWA 1E6PA 1FKGA 2ZR5A 4W5UA 2ZQVA 5DIUA 4WKHA 2RUQA 3LUOA 3JYJA 1TFVA 1A7XA 1ZBKA 1EYMA 3RFWA 3O5JA 3WD1A 3CHCA 2RQSA 3KABA 1KT1A 2WLZA 5GPRA 3EY6A 1D2KA 4LAXA 4PTMA 4ODQA 4R0XA 1E6ZA 1D7HA 2VN1A 1E9LA 4DRQA 4GIVA 2O9OA 4XAKA 1NWUA 2B31A 3AS1A 2KGJA 2WK2A 4TYOA 3CHFA 3NTPA 3WKZA 2ITKA 2PBCA 1KFWA 4W9QA 1FKJA 1CTNA 2A3BA 1NMWA 2MF9A 1HJXA 2M08A 2DG4A 4L72B 3ARYA 2MLZA 1ZB5A 2Y78A 4NSBA 2AOSA 5D75A 3B9AA 1HKKA 5B8IC 2KO7A 4JYSA 1D6OA 4O2TA 4ODPA 2Q5AA 3ARRA 4Z2LA 1FKKA 3KAGA 1HXVA 2XPAA 4DRIA 3CGNA 1D7JA 2ZQSA 1NH6A 4Q22A 1LJYA 3G6LA 3B8SA 2L2SA 1U79A 1F40A 4MAVA 2MLYA 3TC5A 3TCZA 2RSEA 3WL1A 1Y0OA 1NSGA 2RUCA 3KACA 3WH0A 3AROA 2B5UB 3O5DA 4WK9A 5HBFA 2PV2A 1ZU8A 4HARA 1FKFA 2DSZA 1W9UA 1EHNA 1EIBA 3NRKA 2MPHA 3CH9A 3WD0A 4FAPA 2YBUA 4MNKA 3PRAA 1GOIA 2RUDA 2XP6A 3OOBA 1EQ3A 4DWSC 1VF8A 2EULA 5BXJA 1E6NA 1EDQA 2WLYA 2F2DA 4ZS6A 4ODKA 1Q6IA 1W1YA 1D7IA 1E44A 2DT2A 2XP7A 4HBEA 5DEZA 2AWGA 2FKEA 3NI6A 1FKHA 2XP3A 1NMVA 4MSPA 3BMBA 3QOKA 1LL6A 3ARZA 3UQBA 3UQAA 2QF8A 3O5QA 4WKAA 1GPFA 3KAIA 2ZR6A 2KE0A 2PPOA 3JYMA 1JNTA 3ARTA 4ITZA 3B7XA 1BL4A 2F4EA 4Z2KA 5DF0A 1F8AB 3PRBA 4WKFA 2DT0A 4LAWA 3O5RA 1BKFA 3WD2A 4MTVA 2MNTA 3AS0A 1YW5A 2G41A 4FN2A 4U86A 1LQ0A 1ROTA 2DSVA 1W1TA 2N87A 1P5QA 2XP5A 4IPXA 4JFJA 2F23A 4TNSA 4URIA 4QZVB 4DH0A 3CHDA 2JZVA 2A3CA 4JFLA 3RM9A 4ODRA 3O5FA 1E6RA 4U84A 1W1PA 1FD9A 1FKLA 1GUVA 1XHGA 1W9VA 4C02B 4QIBA 3O5KA 1UR8A 4DZ2A 3IK8A 5HKGA 1RD6A 5DO2A 1FJDA 2LKNA 3UI5A 4DRJA 2FDMA 2XPBA 4IQ2A 4MNLA 2IUZA 1R9HA 3JXVA 2PI6A 2ESCA 5I98A 2OFNA 1FKTA 4JFKA 2XP9A 3ARQA 3IKDA 2A3AA 2D9FA 4L3NA 1FFRA 3UF8A 3FAPA 1GRJA 2M2AA 2YBTA 3O5OA 4WIWA 1SYTA 4MNMA 3CHEA 1IX5A 3WQVA 4UDMA 1Q6UA 3ALGA 3WIJA 1H0GA 4TW8A 3PR9A 3GTYX 4GGQA 1C9HA 1FKBA 1JNEA 2UZ5A 3WD3A 4U85A 3GU0A 2DG9A 4ZPTR 1PINA 2ZQTA 2KFWA 4DRPA 4DRKA 1SR0A 3PA7A 4ODMA 2F21A 3RMEA 4IT6A 5GQBA 1W1VA 3KADA 3AS2A 4MPKA 1K9TA 4J4NA 3RM4A 2M1IA 4W9PA 5HW7A 1JNDA 3CGMA 4DIPA 3CZ8A 3ARXA 1JCHB 1HJVA 1NWSA 5DIVA 1Q6HA 1O6IA 3VAWA 2WM0A 2ETNA 1TCOC 3O5LA 4DZ3A 3EIPA 4N19A 2A3EA 2DG3A 2K8IA 1E15A 3W4RA 4IT4A 4WJXA 4DWSD 3RGCA 1N1AA 4AY1A 4ODNA 4DROA 4Z2HA 3H9RB 1FKDA 3FY1A 1FFQA 3O5GA 4DT4A 4P8VA 5HTGA 1W9PA 1W26A 4JFIA 4NZCA 2VCDA 1ZCNA 1JVWA 1ZBWA 1L1PA 1LG2A 1YATA 5HW8A 4QT3A 5HUAA 1OWQA 4P8WA 1ZK6A 1NWRA 1HJWA 1M5YA 2O92A 1ROUA 1HKIA 1QPLA 2LGOA 2PPPA 2XP8A 3KZ7A 5J6EA 2G8ZA 1QZ2A 5GPGA 4KR0B 4G50A 1J6YA 1Q1CA 4KQZA 3OA5A 3O5EA 3TDBA 3RM8A 5HWBA 1X6LA 3IKGA 1HKMA 5HW6A 4MGVA 4ZPWR 4Z2GA 4NNRA 1H0IA 3UI4A 3ALFA 2LPVA 3AQUA 1ZBVA 1X6NA 3ARVA 1WB0A 3O5PA 4JFMA 4S3KA 4TW6A 1NWTA 2DT3A 3I6CA 1PBKA 4TW7A 1B6CA 2IF4A 4S3JA 1OGBA 4IQCA 3B9DA 1WAWA 5JH8A 2XP4A 3AS3A 4HBOA 3ARUA 1J4RA 2PPNA 3KAHA 1ZL1A 4DWSB 1FAPA 3O5IA 4BF8A 3ARSA 3KCEA 1LL7A 2RURA 3GPKA 4MNJA 5HT1A 4LAYA 3B9EA 4P8XA 4DWSA 3WQWA 3UQIA 4DRMA 1HKJA 2PV3A 4R5EA 5HWCA 2DPEA 4ODLA 1LG1A 3ODKA 1FKRA 4DRNA 2PV1A 1OGGA 3G6MA 4Z2IA 1XRVA 4G2PA 2PN0A 2P4VA 3O5MA 1ITXA 2OLHA 4TX0A 3UI6A 2LJ4A 4LGXA
chains in the Genus database with same CATH topology
2KI3A 4LAVA 1KT0A 1J4IA 3IHZA 4Q7NA 2FAPA 4ODOA 2MLXA 3WD4A 2DT1A 1UR9A 1LL4A 1QPFA 1J4HA 3FXYA 4P8UA 2ZR4A 2KR7A 4Z2JA 4J4OA 1FKSA 1T11A 3ARPA 1WNOA 3WL0A 2DSWA 4ML4A 4ZPVR 3KAFA 4W9OA 1JNSA 3MDYB 3PRDA 4QT2A 2DSUA 2ZQUA 5DITA 1ZBCA 3ARWA 4DRHA 1FKIA 3BXWA 1E6PA 1FKGA 2ZR5A 4W5UA 2ZQVA 5DIUA 4WKHA 2RUQA 3LUOA 3JYJA 1TFVA 1A7XA 1ZBKA 1EYMA 3RFWA 3O5JA 3WD1A 3CHCA 2RQSA 3KABA 1KT1A 2WLZA 5GPRA 3EY6A 1D2KA 4LAXA 4PTMA 4ODQA 4R0XA 1E6ZA 1D7HA 2VN1A 1E9LA 4DRQA 4GIVA 2O9OA 4XAKA 1NWUA 2B31A 3AS1A 2KGJA 2WK2A 4TYOA 3CHFA 3NTPA 3WKZA 2ITKA 2PBCA 1KFWA 4W9QA 1FKJA 1CTNA 2A3BA 1NMWA 2MF9A 1HJXA 2M08A 2DG4A 4L72B 3ARYA 2MLZA 1ZB5A 2Y78A 4NSBA 2AOSA 5D75A 3B9AA 1HKKA 5B8IC 2KO7A 4JYSA 1D6OA 4O2TA 4ODPA 2Q5AA 3ARRA 4Z2LA 1FKKA 3KAGA 1HXVA 2XPAA 4DRIA 3CGNA 1D7JA 2ZQSA 1NH6A 4Q22A 1LJYA 3G6LA 3B8SA 2L2SA 1U79A 1F40A 4MAVA 2MLYA 3TC5A 3TCZA 2RSEA 3WL1A 1Y0OA 1NSGA 2RUCA 3KACA 3WH0A 3AROA 3O5DA 4WK9A 5HBFA 2PV2A 1ZU8A 4HARA 1FKFA 2DSZA 1W9UA 1EHNA 1EIBA 3NRKA 2MPHA 3CH9A 3WD0A 4FAPA 2YBUA 4MNKA 3PRAA 1GOIA 2RUDA 2XP6A 3OOBA 1EQ3A 4DWSC 1VF8A 5BXJA 1E6NA 1EDQA 2WLYA 2F2DA 4ZS6A 4ODKA 1Q6IA 1W1YA 1D7IA 2DT2A 2XP7A 4HBEA 5DEZA 2AWGA 2FKEA 3NI6A 1FKHA 2XP3A 1NMVA 4MSPA 3QOKA 1LL6A 3ARZA 3UQBA 3UQAA 2QF8A 3O5QA 4WKAA 1GPFA 3KAIA 2ZR6A 2KE0A 2PPOA 3JYMA 1JNTA 3ARTA 4ITZA 3B7XA 1BL4A 2F4EA 4Z2KA 5DF0A 1F8AB 3PRBA 4WKFA 2DT0A 4LAWA 3O5RA 1BKFA 3WD2A 4MTVA 2MNTA 3AS0A 1YW5A 2G41A 4FN2A 4U86A 1LQ0A 1ROTA 2DSVA 1W1TA 2N87A 1P5QA 2XP5A 4IPXA 4JFJA 4TNSA 4URIA 4QZVB 4DH0A 3CHDA 2JZVA 2A3CA 4JFLA 3RM9A 4ODRA 3O5FA 1E6RA 4U84A 1W1PA 1FD9A 1FKLA 1GUVA 1XHGA 1W9VA 4C02B 4QIBA 3O5KA 1UR8A 4DZ2A 3IK8A 5HKGA 1RD6A 5DO2A 1FJDA 2LKNA 3UI5A 4DRJA 2FDMA 2XPBA 4IQ2A 4MNLA 2IUZA 1R9HA 3JXVA 2PI6A 2ESCA 5I98A 2OFNA 1FKTA 4JFKA 2XP9A 3ARQA 3IKDA 2A3AA 2D9FA 4L3NA 1FFRA 3UF8A 3FAPA 2M2AA 2YBTA 3O5OA 4WIWA 1SYTA 4MNMA 3CHEA 1IX5A 3WQVA 1Q6UA 3ALGA 3WIJA 1H0GA 4TW8A 3PR9A 4GGQA 1C9HA 1FKBA 1JNEA 2UZ5A 3WD3A 4U85A 2DG9A 4ZPTR 1PINA 2ZQTA 2KFWA 4DRPA 4DRKA 1SR0A 3PA7A 4ODMA 2F21A 3RMEA 4IT6A 5GQBA 1W1VA 3KADA 3AS2A 4MPKA 1K9TA 4J4NA 3RM4A 2M1IA 4W9PA 5HW7A 1JNDA 3CGMA 4DIPA 3CZ8A 3ARXA 1HJVA 1NWSA 5DIVA 1Q6HA 1O6IA 3VAWA 2WM0A 1TCOC 3O5LA 4DZ3A 4N19A 2A3EA 2DG3A 2K8IA 1E15A 3W4RA 4IT4A 4WJXA 4DWSD 3RGCA 1N1AA 4AY1A 4ODNA 4DROA 4Z2HA 3H9RB 1FKDA 3FY1A 1FFQA 3O5GA 4DT4A 4P8VA 5HTGA 1W9PA 1W26A 4JFIA 4NZCA 2VCDA 1ZCNA 1JVWA 1ZBWA 1L1PA 1LG2A 1YATA 5HW8A 4QT3A 5HUAA 1OWQA 4P8WA 1ZK6A 1NWRA 1HJWA 1M5YA 2O92A 1ROUA 1HKIA 1QPLA 2LGOA 2PPPA 2XP8A 3KZ7A 5J6EA 2G8ZA 1QZ2A 5GPGA 4KR0B 4G50A 1J6YA 1Q1CA 4KQZA 3OA5A 3O5EA 3TDBA 3RM8A 5HWBA 1X6LA 3IKGA 1HKMA 5HW6A 4MGVA 4ZPWR 4Z2GA 4NNRA 1H0IA 3UI4A 3ALFA 2LPVA 3AQUA 1ZBVA 1X6NA 3ARVA 1WB0A 3O5PA 4JFMA 4S3KA 4TW6A 1NWTA 2DT3A 3I6CA 1PBKA 4TW7A 1B6CA 2IF4A 4S3JA 1OGBA 4IQCA 3B9DA 1WAWA 5JH8A 2XP4A 3AS3A 4HBOA 3ARUA 1J4RA 2PPNA 3KAHA 1ZL1A 4DWSB 1FAPA 3O5IA 4BF8A 3ARSA 3KCEA 1LL7A 2RURA 3GPKA 4MNJA 5HT1A 4LAYA 3B9EA 4P8XA 4DWSA 3WQWA 3UQIA 4DRMA 1HKJA 2PV3A 4R5EA 5HWCA 2DPEA 4ODLA 1LG1A 3ODKA 1FKRA 4DRNA 2PV1A 1OGGA 3G6MA 4Z2IA 1XRVA 4G2PA 3O5MA 1ITXA 2OLHA 4TX0A 3UI6A 2LJ4A 4LGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI3 A;  2L2S A;  3O5G A;  1U79 A;  2XPB A;  1KT0 A;  4IQ2 A;  4LAV A;  4DT4 A;  1F40 A;  1J4I A;  2MLY A;  3TC5 A;  3TCZ A;  5HTG A;  1W26 A;  2RSE A;  3IHZ A;  4JFI A;  2FAP A;  4ODO A;  2MLX A;  2VCD A;  1ZCN A;  1Y0O A;  1JVW A;  1QPF A;  1R9H A;  3JXV A;  1NSG A;  2RUC A;  3KAC A;  1J4H A;  3WH0 A;  1L1P A;  3O5D A;  5I98 A;  1YAT A;  2OFN A;  1FKT A;  4JFK A;  5HW8 A;  2PV2 A;  2XP9 A;  4QT3 A;  5HUA A;  3IKD A;  1ZK6 A;  2ZR4 A;  2KR7 A;  1FKF A;  1FKS A;  1M5Y A;  4J4O A;  1T11 A;  1ROU A;  2D9F A;  1QPL A;  3UF8 A;  3FAP A;  2LGO A;  2M2A A;  2PPP A;  2MPH A;  2XP8 A;  3KZ7 A;  3NRK A;  3O5O A;  5J6E A;  4FAP A;  1QZ2 A;  5GPG A;  4G50 A;  2RUD A;  2XP6 A;  3OOB A;  1J6Y A;  1EQ3 A;  1Q1C A;  3KAF A;  5BXJ A;  4W9O A;  1JNS A;  2F2D A;  3O5E A;  3TDB A;  5HWB A;  3IKG A;  3MDY B;  4ODK A;  1Q6I A;  3PRD A;  4QT2 A;  5HW6 A;  1D7I A;  4MGV A;  2XP7 A;  1Q6U A;  2ZQU A;  4NNR A;  5DIT A;  2AWG A;  4TW8 A;  2FKE A;  3NI6 A;  3UI4 A;  1FKH A;  2LPV A;  2XP3 A;  4DRH A;  1NMV A;  1FKI A;  4MSP A;  2ZR5 A;  1FKG A;  3O5P A;  4GGQ A;  4JFM A;  2ZQV A;  4TW6 A;  3UQA A;  3UQB A;  5DIU A;  3I6C A;  2RUQ A;  3LUO A;  1C9H A;  3O5Q A;  1PBK A;  3JYJ A;  4TW7 A;  1A7X A;  1B6C A;  1FKB A;  2IF4 A;  1EYM A;  3KAI A;  2ZR6 A;  2KE0 A;  2PPO A;  3JYM A;  1JNT A;  2UZ5 A;  4IQC A;  3RFW A;  3O5J A;  4ITZ A;  4U85 A;  3B7X A;  3H9R B;  1BL4 A;  2F4E A;  2DG9 A;  1F8A B;  2RQS A;  1KT1 A;  3KAB A;  2XP4 A;  1PIN A;  3PRB A;  2ZQT A;  3EY6 A;  2KFW A;  1J4R A;  4LAX A;  2PPN A;  3KAH A;  4ODQ A;  4R0X A;  4DRP A;  4LAW A;  1D7H A;  1FAP A;  2VN1 A;  3O5I A;  3PA7 A;  4ODM A;  4BF8 A;  4DRQ A;  4GIV A;  4DRK A;  2F21 A;  3O5R A;  1BKF A;  3KCE A;  3KAD A;  2MNT A;  2RUR A;  1YW5 A;  3GPK A;  4FN2 A;  4J4N A;  4U86 A;  2M1I A;  4W9P A;  5HT1 A;  2KGJ A;  4LAY A;  1ROT A;  4TYO A;  5HW7 A;  2N87 A;  1P5Q A;  3CGM A;  2XP5 A;  3NTP A;  2ITK A;  4IPX A;  4DIP A;  4JFJ A;  2PBC A;  4TNS A;  4W9Q A;  5DIV A;  1FKJ A;  1Q6H A;  4DH0 A;  1NMW A;  3UQI A;  2MF9 A;  3VAW A;  1TCO C;  2JZV A;  2DG4 A;  2M08 A;  3O5L A;  2PV3 A;  2MLZ A;  4DRM A;  4DZ3 A;  2Y78 A;  5HWC A;  4JFL A;  4ODL A;  4ODR A;  3O5F A;  5D75 A;  3ODK A;  1FKR A;  4DRN A;  4N19 A;  4U84 A;  2PV1 A;  1FD9 A;  5B8I C;  1FKL A;  2KO7 A;  4JYS A;  1D6O A;  4O2T A;  4ODP A;  2DG3 A;  2Q5A A;  4G2P A;  4QIB A;  3O5K A;  1FKK A;  2K8I A;  3IK8 A;  3KAG A;  2XPA A;  4C02 B;  4DZ2 A;  1HXV A;  5HKG A;  3O5M A;  4DRI A;  3CGN A;  1D7J A;  2ZQS A;  4TX0 A;  1FJD A;  2LKN A;  3RGC A;  1N1A A;  3UI5 A;  3UI6 A;  4DRJ A;  4ODN A;  4DRO A;  2LJ4 A;  1FKD A; 
#chains in the Genus database with same CATH topology
 2KI3 A;  4LAV A;  1KT0 A;  1J4I A;  3IHZ A;  4Q7N A;  2FAP A;  4ODO A;  2MLX A;  3WD4 A;  2DT1 A;  1UR9 A;  1LL4 A;  1QPF A;  1J4H A;  3FXY A;  4P8U A;  2ZR4 A;  2KR7 A;  4Z2J A;  4J4O A;  1FKS A;  1T11 A;  3ARP A;  1WNO A;  3WL0 A;  2DSW A;  4ML4 A;  4ZPV R;  3KAF A;  4W9O A;  1JNS A;  3MDY B;  3PRD A;  4QT2 A;  2DSU A;  2ZQU A;  5DIT A;  1ZBC A;  3ARW A;  4DRH A;  1FKI A;  3BXW A;  1E6P A;  1FKG A;  2ZR5 A;  4W5U A;  2ZQV A;  5DIU A;  4WKH A;  2RUQ A;  3LUO A;  3JYJ A;  1TFV A;  1A7X A;  1ZBK A;  1EYM A;  3RFW A;  3O5J A;  3WD1 A;  3CHC A;  2RQS A;  3KAB A;  1KT1 A;  2WLZ A;  5GPR A;  3EY6 A;  1D2K A;  4LAX A;  4PTM A;  4ODQ A;  4R0X A;  1E6Z A;  1D7H A;  2VN1 A;  1E9L A;  4DRQ A;  4GIV A;  2O9O A;  4XAK A;  1NWU A;  2B31 A;  3AS1 A;  2KGJ A;  2WK2 A;  4TYO A;  3CHF A;  3NTP A;  3WKZ A;  2ITK A;  2PBC A;  1KFW A;  4W9Q A;  1FKJ A;  1CTN A;  2A3B A;  1NMW A;  2MF9 A;  1HJX A;  2M08 A;  2DG4 A;  4L72 B;  3ARY A;  2MLZ A;  1ZB5 A;  2Y78 A;  4NSB A;  2AOS A;  5D75 A;  3B9A A;  1HKK A;  5B8I C;  2KO7 A;  4JYS A;  1D6O A;  4O2T A;  4ODP A;  2Q5A A;  3ARR A;  4Z2L A;  1FKK A;  3KAG A;  1HXV A;  2XPA A;  4DRI A;  3CGN A;  1D7J A;  2ZQS A;  1NH6 A;  4Q22 A;  1LJY A;  3G6L A;  3B8S A;  2L2S A;  1U79 A;  1F40 A;  4MAV A;  2MLY A;  3TC5 A;  3TCZ A;  2RSE A;  3WL1 A;  1Y0O A;  1NSG A;  2RUC A;  3KAC A;  3WH0 A;  3ARO A;  2B5U B;  3O5D A;  4WK9 A;  5HBF A;  2PV2 A;  1ZU8 A;  4HAR A;  1FKF A;  2DSZ A;  1W9U A;  1EHN A;  1EIB A;  3NRK A;  2MPH A;  3CH9 A;  3WD0 A;  4FAP A;  2YBU A;  4MNK A;  3PRA A;  1GOI A;  2RUD A;  2XP6 A;  3OOB A;  1EQ3 A;  4DWS C;  1VF8 A;  2EUL A;  5BXJ A;  1E6N A;  1EDQ A;  2WLY A;  2F2D A;  4ZS6 A;  4ODK A;  1Q6I A;  1W1Y A;  1D7I A;  1E44 A;  2DT2 A;  2XP7 A;  4HBE A;  5DEZ A;  2AWG A;  2FKE A;  3NI6 A;  1FKH A;  2XP3 A;  1NMV A;  4MSP A;  3BMB A;  3QOK A;  1LL6 A;  3ARZ A;  3UQB A;  3UQA A;  2QF8 A;  3O5Q A;  4WKA A;  1GPF A;  3KAI A;  2ZR6 A;  2KE0 A;  2PPO A;  3JYM A;  1JNT A;  3ART A;  4ITZ A;  3B7X A;  1BL4 A;  2F4E A;  4Z2K A;  5DF0 A;  1F8A B;  3PRB A;  4WKF A;  2DT0 A;  4LAW A;  3O5R A;  1BKF A;  3WD2 A;  4MTV A;  2MNT A;  3AS0 A;  1YW5 A;  2G41 A;  4FN2 A;  4U86 A;  1LQ0 A;  1ROT A;  2DSV A;  1W1T A;  2N87 A;  1P5Q A;  2XP5 A;  4IPX A;  4JFJ A;  2F23 A;  4TNS A;  4URI A;  4QZV B;  4DH0 A;  3CHD A;  2JZV A;  2A3C A;  4JFL A;  3RM9 A;  4ODR A;  3O5F A;  1E6R A;  4U84 A;  1W1P A;  1FD9 A;  1FKL A;  1GUV A;  1XHG A;  1W9V A;  4C02 B;  4QIB A;  3O5K A;  1UR8 A;  4DZ2 A;  3IK8 A;  5HKG A;  1RD6 A;  5DO2 A;  1FJD A;  2LKN A;  3UI5 A;  4DRJ A;  2FDM A;  2XPB A;  4IQ2 A;  4MNL A;  2IUZ A;  1R9H A;  3JXV A;  2PI6 A;  2ESC A;  5I98 A;  2OFN A;  1FKT A;  4JFK A;  2XP9 A;  3ARQ A;  3IKD A;  2A3A A;  2D9F A;  4L3N A;  1FFR A;  3UF8 A;  3FAP A;  1GRJ A;  2M2A A;  2YBT A;  3O5O A;  4WIW A;  1SYT A;  4MNM A;  3CHE A;  1IX5 A;  3WQV A;  4UDM A;  1Q6U A;  3ALG A;  3WIJ A;  1H0G A;  4TW8 A;  3PR9 A;  3GTY X;  4GGQ A;  1C9H A;  1FKB A;  1JNE A;  2UZ5 A;  3WD3 A;  4U85 A;  3GU0 A;  2DG9 A;  4ZPT R;  1PIN A;  2ZQT A;  2KFW A;  4DRP A;  4DRK A;  1SR0 A;  3PA7 A;  4ODM A;  2F21 A;  3RME A;  4IT6 A;  5GQB A;  1W1V A;  3KAD A;  3AS2 A;  4MPK A;  1K9T A;  4J4N A;  3RM4 A;  2M1I A;  4W9P A;  5HW7 A;  1JND A;  3CGM A;  4DIP A;  3CZ8 A;  3ARX A;  1JCH B;  1HJV A;  1NWS A;  5DIV A;  1Q6H A;  1O6I A;  3VAW A;  2WM0 A;  2ETN A;  1TCO C;  3O5L A;  4DZ3 A;  3EIP A;  4N19 A;  2A3E A;  2DG3 A;  2K8I A;  1E15 A;  3W4R A;  4IT4 A;  4WJX A;  4DWS D;  3RGC A;  1N1A A;  4AY1 A;  4ODN A;  4DRO A;  4Z2H A;  3H9R B;  1FKD A;  3FY1 A;  1FFQ A;  3O5G A;  4DT4 A;  4P8V A;  5HTG A;  1W9P A;  1W26 A;  4JFI A;  4NZC A;  2VCD A;  1ZCN A;  1JVW A;  1ZBW A;  1L1P A;  1LG2 A;  1YAT A;  5HW8 A;  4QT3 A;  5HUA A;  1OWQ A;  4P8W A;  1ZK6 A;  1NWR A;  1HJW A;  1M5Y A;  2O92 A;  1ROU A;  1HKI A;  1QPL A;  2LGO A;  2PPP A;  2XP8 A;  3KZ7 A;  5J6E A;  2G8Z A;  1QZ2 A;  5GPG A;  4KR0 B;  4G50 A;  1J6Y A;  1Q1C A;  4KQZ A;  3OA5 A;  3O5E A;  3TDB A;  3RM8 A;  5HWB A;  1X6L A;  3IKG A;  1HKM A;  5HW6 A;  4MGV A;  4ZPW R;  4Z2G A;  4NNR A;  1H0I A;  3UI4 A;  3ALF A;  2LPV A;  3AQU A;  1ZBV A;  1X6N A;  3ARV A;  1WB0 A;  3O5P A;  4JFM A;  4S3K A;  4TW6 A;  1NWT A;  2DT3 A;  3I6C A;  1PBK A;  4TW7 A;  1B6C A;  2IF4 A;  4S3J A;  1OGB A;  4IQC A;  3B9D A;  1WAW A;  5JH8 A;  2XP4 A;  3AS3 A;  4HBO A;  3ARU A;  1J4R A;  2PPN A;  3KAH A;  1ZL1 A;  4DWS B;  1FAP A;  3O5I A;  4BF8 A;  3ARS A;  3KCE A;  1LL7 A;  2RUR A;  3GPK A;  4MNJ A;  5HT1 A;  4LAY A;  3B9E A;  4P8X A;  4DWS A;  3WQW A;  3UQI A;  4DRM A;  1HKJ A;  2PV3 A;  4R5E A;  5HWC A;  2DPE A;  4ODL A;  1LG1 A;  3ODK A;  1FKR A;  4DRN A;  2PV1 A;  1OGG A;  3G6M A;  4Z2I A;  1XRV A;  4G2P A;  2PN0 A;  2P4V A;  3O5M A;  1ITX A;  2OLH A;  4TX0 A;  3UI6 A;  2LJ4 A;  4LGX A; 
#chains in the Genus database with same CATH homology
 2KI3 A;  4LAV A;  1KT0 A;  1J4I A;  3IHZ A;  4Q7N A;  2FAP A;  4ODO A;  2MLX A;  3WD4 A;  2DT1 A;  1UR9 A;  1LL4 A;  1QPF A;  1J4H A;  3FXY A;  4P8U A;  2ZR4 A;  2KR7 A;  4Z2J A;  4J4O A;  1FKS A;  1T11 A;  3ARP A;  1WNO A;  3WL0 A;  2DSW A;  4ML4 A;  4ZPV R;  3KAF A;  4W9O A;  1JNS A;  3MDY B;  3PRD A;  4QT2 A;  2DSU A;  2ZQU A;  5DIT A;  1ZBC A;  3ARW A;  4DRH A;  1FKI A;  3BXW A;  1E6P A;  1FKG A;  2ZR5 A;  4W5U A;  2ZQV A;  5DIU A;  4WKH A;  2RUQ A;  3LUO A;  3JYJ A;  1TFV A;  1A7X A;  1ZBK A;  1EYM A;  3RFW A;  3O5J A;  3WD1 A;  3CHC A;  2RQS A;  3KAB A;  1KT1 A;  2WLZ A;  5GPR A;  3EY6 A;  1D2K A;  4LAX A;  4PTM A;  4ODQ A;  4R0X A;  1E6Z A;  1D7H A;  2VN1 A;  1E9L A;  4DRQ A;  4GIV A;  2O9O A;  4XAK A;  1NWU A;  2B31 A;  3AS1 A;  2KGJ A;  2WK2 A;  4TYO A;  3CHF A;  3NTP A;  3WKZ A;  2ITK A;  2PBC A;  1KFW A;  4W9Q A;  1FKJ A;  1CTN A;  2A3B A;  1NMW A;  2MF9 A;  1HJX A;  2M08 A;  2DG4 A;  4L72 B;  3ARY A;  2MLZ A;  1ZB5 A;  2Y78 A;  4NSB A;  2AOS A;  5D75 A;  3B9A A;  1HKK A;  5B8I C;  2KO7 A;  4JYS A;  1D6O A;  4O2T A;  4ODP A;  2Q5A A;  3ARR A;  4Z2L A;  1FKK A;  3KAG A;  1HXV A;  2XPA A;  4DRI A;  3CGN A;  1D7J A;  2ZQS A;  1NH6 A;  4Q22 A;  1LJY A;  3G6L A;  3B8S A;  2L2S A;  1U79 A;  1F40 A;  4MAV A;  2MLY A;  3TC5 A;  3TCZ A;  2RSE A;  3WL1 A;  1Y0O A;  1NSG A;  2RUC A;  3KAC A;  3WH0 A;  3ARO A;  3O5D A;  4WK9 A;  5HBF A;  2PV2 A;  1ZU8 A;  4HAR A;  1FKF A;  2DSZ A;  1W9U A;  1EHN A;  1EIB A;  3NRK A;  2MPH A;  3CH9 A;  3WD0 A;  4FAP A;  2YBU A;  4MNK A;  3PRA A;  1GOI A;  2RUD A;  2XP6 A;  3OOB A;  1EQ3 A;  4DWS C;  1VF8 A;  5BXJ A;  1E6N A;  1EDQ A;  2WLY A;  2F2D A;  4ZS6 A;  4ODK A;  1Q6I A;  1W1Y A;  1D7I A;  2DT2 A;  2XP7 A;  4HBE A;  5DEZ A;  2AWG A;  2FKE A;  3NI6 A;  1FKH A;  2XP3 A;  1NMV A;  4MSP A;  3QOK A;  1LL6 A;  3ARZ A;  3UQB A;  3UQA A;  2QF8 A;  3O5Q A;  4WKA A;  1GPF A;  3KAI A;  2ZR6 A;  2KE0 A;  2PPO A;  3JYM A;  1JNT A;  3ART A;  4ITZ A;  3B7X A;  1BL4 A;  2F4E A;  4Z2K A;  5DF0 A;  1F8A B;  3PRB A;  4WKF A;  2DT0 A;  4LAW A;  3O5R A;  1BKF A;  3WD2 A;  4MTV A;  2MNT A;  3AS0 A;  1YW5 A;  2G41 A;  4FN2 A;  4U86 A;  1LQ0 A;  1ROT A;  2DSV A;  1W1T A;  2N87 A;  1P5Q A;  2XP5 A;  4IPX A;  4JFJ A;  4TNS A;  4URI A;  4QZV B;  4DH0 A;  3CHD A;  2JZV A;  2A3C A;  4JFL A;  3RM9 A;  4ODR A;  3O5F A;  1E6R A;  4U84 A;  1W1P A;  1FD9 A;  1FKL A;  1GUV A;  1XHG A;  1W9V A;  4C02 B;  4QIB A;  3O5K A;  1UR8 A;  4DZ2 A;  3IK8 A;  5HKG A;  1RD6 A;  5DO2 A;  1FJD A;  2LKN A;  3UI5 A;  4DRJ A;  2FDM A;  2XPB A;  4IQ2 A;  4MNL A;  2IUZ A;  1R9H A;  3JXV A;  2PI6 A;  2ESC A;  5I98 A;  2OFN A;  1FKT A;  4JFK A;  2XP9 A;  3ARQ A;  3IKD A;  2A3A A;  2D9F A;  4L3N A;  1FFR A;  3UF8 A;  3FAP A;  2M2A A;  2YBT A;  3O5O A;  4WIW A;  1SYT A;  4MNM A;  3CHE A;  1IX5 A;  3WQV A;  1Q6U A;  3ALG A;  3WIJ A;  1H0G A;  4TW8 A;  3PR9 A;  4GGQ A;  1C9H A;  1FKB A;  1JNE A;  2UZ5 A;  3WD3 A;  4U85 A;  2DG9 A;  4ZPT R;  1PIN A;  2ZQT A;  2KFW A;  4DRP A;  4DRK A;  1SR0 A;  3PA7 A;  4ODM A;  2F21 A;  3RME A;  4IT6 A;  5GQB A;  1W1V A;  3KAD A;  3AS2 A;  4MPK A;  1K9T A;  4J4N A;  3RM4 A;  2M1I A;  4W9P A;  5HW7 A;  1JND A;  3CGM A;  4DIP A;  3CZ8 A;  3ARX A;  1HJV A;  1NWS A;  5DIV A;  1Q6H A;  1O6I A;  3VAW A;  2WM0 A;  1TCO C;  3O5L A;  4DZ3 A;  4N19 A;  2A3E A;  2DG3 A;  2K8I A;  1E15 A;  3W4R A;  4IT4 A;  4WJX A;  4DWS D;  3RGC A;  1N1A A;  4AY1 A;  4ODN A;  4DRO A;  4Z2H A;  3H9R B;  1FKD A;  3FY1 A;  1FFQ A;  3O5G A;  4DT4 A;  4P8V A;  5HTG A;  1W9P A;  1W26 A;  4JFI A;  4NZC A;  2VCD A;  1ZCN A;  1JVW A;  1ZBW A;  1L1P A;  1LG2 A;  1YAT A;  5HW8 A;  4QT3 A;  5HUA A;  1OWQ A;  4P8W A;  1ZK6 A;  1NWR A;  1HJW A;  1M5Y A;  2O92 A;  1ROU A;  1HKI A;  1QPL A;  2LGO A;  2PPP A;  2XP8 A;  3KZ7 A;  5J6E A;  2G8Z A;  1QZ2 A;  5GPG A;  4KR0 B;  4G50 A;  1J6Y A;  1Q1C A;  4KQZ A;  3OA5 A;  3O5E A;  3TDB A;  3RM8 A;  5HWB A;  1X6L A;  3IKG A;  1HKM A;  5HW6 A;  4MGV A;  4ZPW R;  4Z2G A;  4NNR A;  1H0I A;  3UI4 A;  3ALF A;  2LPV A;  3AQU A;  1ZBV A;  1X6N A;  3ARV A;  1WB0 A;  3O5P A;  4JFM A;  4S3K A;  4TW6 A;  1NWT A;  2DT3 A;  3I6C A;  1PBK A;  4TW7 A;  1B6C A;  2IF4 A;  4S3J A;  1OGB A;  4IQC A;  3B9D A;  1WAW A;  5JH8 A;  2XP4 A;  3AS3 A;  4HBO A;  3ARU A;  1J4R A;  2PPN A;  3KAH A;  1ZL1 A;  4DWS B;  1FAP A;  3O5I A;  4BF8 A;  3ARS A;  3KCE A;  1LL7 A;  2RUR A;  3GPK A;  4MNJ A;  5HT1 A;  4LAY A;  3B9E A;  4P8X A;  4DWS A;  3WQW A;  3UQI A;  4DRM A;  1HKJ A;  2PV3 A;  4R5E A;  5HWC A;  2DPE A;  4ODL A;  1LG1 A;  3ODK A;  1FKR A;  4DRN A;  2PV1 A;  1OGG A;  3G6M A;  4Z2I A;  1XRV A;  4G2P A;  3O5M A;  1ITX A;  2OLH A;  4TX0 A;  3UI6 A;  2LJ4 A;  4LGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...