2KO7A

Solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with cycloheximide-n-ethylethanoate
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
117
structure length
117
Chain Sequence
GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a Burkholderia pseudomallei immunophilin-inhibitor complex reveals new approaches to antimicrobial development.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 15
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ko7A00
4TYOA 1R9HA 4TW8A 4DROA 2UZ5A 2KGJA 5BXJA 3IK8A 3NRKA 2DG4A 3O5OA 3RGCA 1D7IA 4JFMA 2XPBA 1FAPA 4DRNA 3UF8A 1HXVA 1YW5A 1Q1CA 2LKNA 1NMWA 1YATA 4JFJA 1PINA 1D7HA 4MSPA 4TW6A 5DIVA 2M1IA 3KADA 4DZ3A 1JNSA 4JYSA 1FKFA 2Q5AA 3KAHA 1FKDA 5HT1A 4ODQA 4QT3A 1QPFA 2XP4A 2F2DA 2ZQSA 3IKDA 4JFKA 5HUAA 3OOBA 4FAPA 4NNRA 4JFIA 3O5JA 1U79A 3PRBA 4ODKA 1Q6UA 5HW7A 4ODNA 3B7XA 2AWGA 4QIBA 5HKGA 2LJ4A 3I6CA 2LPVA 2MNTA 1D6OA 1Y0OA 2XP6A 2K8IA 2PPOA 3UQAA 2ZR4A 1FKBA 3CGNA 2XP5A 3KAGA 1N1AA 1J4RA 2XP9A 3TC5A 2ZR5A 3GPKA 1FKJA 4U84A 3H9RB 5D75A 1F40A 3KCEA 4GIVA 3FAPA 1ROUA 2MLZA 1ZK6A 3IKGA 4ODOA 2VCDA 5HWCA 2D9FA 1BL4A 4FN2A 4BF8A 2RQSA 3JYJA 1FD9A 2MLYA 3UI6A 4IQCA 2OFNA 3TCZA 1L1PA 1BKFA 1FKTA 4DRIA 1F8AB 3JYMA 3KACA 2L2SA 3LUOA 3O5EA 4W9PA 1FKGA 3KABA 1Q6IA 4DRQA 4G2PA 3O5LA 3O5RA 5HWBA 2XP7A 4TW7A 4QT2A 1JNTA 2M08A 4ODRA 2ZR6A 2XP3A 2FAPA 1QPLA 4W9OA 3WH0A 2PPPA 2PPNA 2MF9A 2RUCA 1JVWA 1A7XA 1D7JA 1ROTA 3O5PA 3O5GA 4J4NA 4U85A 4DRJA 4DH0A 3CGMA 5J6EA 4DIPA 1FKRA 4R0XA 2RSEA 1FKIA 4TNSA 2VN1A 3JXVA 2ZQTA 4U86A 1T11A 2KR7A 3O5DA 4J4OA 2N87A 5GPGA 3PA7A 4ITZA 2KO7A 4DRHA 1FKLA 1KT1A 1W26A 4GGQA 5I98A 4DRKA 4DRMA 3KAIA 1ZCNA 2F4EA 4O2TA 4ODLA 4DZ2A 2KE0A 2ZQVA 3KZ7A 5DIUA 1KT0A 3O5KA 2FKEA 2KFWA 4DRPA 5HW8A 2RUDA 4LAXA 3UI5A 3TDBA 3UQIA 1EQ3A 1M5YA 2PV2A 4ODMA 1FKSA 2ZQUA 1FKHA 2KI3A 2RUQA 2IF4A 4ODPA 4DT4A 2XPAA 2DG3A 3UQBA 1EYMA 1TCOC 1NSGA 2XP8A 4IQ2A 3KAFA 5HTGA 5HW6A 3O5IA 4IPXA 1C9HA 4N19A 5DITA 3IHZA 3ODKA 4LAVA 4MGVA 3VAWA 4W9QA 2M2AA 2JZVA 1J4IA 2PV3A 3O5QA 3NTPA 4LAYA 5B8IC 2MPHA 2LGOA 1NMVA 2RURA 4LAWA 3NI6A 4JFLA 4C02B 1J6YA 2MLXA 3EY6A 1FJDA 2Y78A 1PBKA 3RFWA 1P5QA 2ITKA 3O5FA 1FKKA 1Q6HA 3O5MA 4G50A 3UI4A 4TX0A 1J4HA 2F21A 2PBCA 3MDYB 2DG9A 2PV1A 3PRDA 1B6CA 1QZ2A
chains in the Genus database with same CATH superfamily
4WJXA 2DG4A 3RGCA 1FAPA 4DRNA 1YW5A 2G8ZA 3KADA 4DZ3A 4DWSB 1FKFA 3KAHA 1QPFA 2XP4A 1OWQA 1RD6A 3IKDA 3PRBA 1KFWA 3W4RA 2AWGA 1D6OA 2PPOA 4Z2GA 4WKFA 1FKBA 3CHCA 1W1TA 1J4RA 3TC5A 2A3BA 1WB0A 5D75A 1F40A 3OA5A 1W9PA 4KR0B 1ROUA 4Z2IA 5DEZA 1BL4A 4FN2A 2OFNA 1L1PA 4DWSC 3LUOA 4W9PA 4MNKA 1FKGA 2O9OA 1NWSA 3FY1A 2B5UB 3PRAA 4DRQA 3O5RA 5HWBA 1W1VA 1W9UA 2M08A 2ZR6A 2XP3A 2FAPA 1UR9A 4LGXA 1LL4A 2MF9A 4QZVB 1WAWA 2DT2A 3O5GA 1JNEA 3B8SA 3CGMA 4DH0A 2RSEA 1E6NA 4TNSA 3JXVA 2DT1A 4J4OA 1FKLA 4GGQA 5I98A 3KAIA 2F4EA 3WD4A 5DIUA 1KT0A 3ARVA 4XAKA 3ARWA 1WNOA 3TDBA 2DPEA 2WM0A 4MNLA 1M5YA 2PV2A 4P8XA 4ODMA 1FKSA 1FKHA 2KI3A 2IF4A 4NSBA 3RM4A 1TCOC 4IQ2A 3KAFA 4IPXA 3IHZA 4DWSA 4W9QA 1J4IA 4IT4A 4WKAA 3B9DA 1LJYA 3G6LA 4LAWA 3NI6A 1GPFA 4JFLA 1ZB5A 2Y78A 1FJDA 4W5UA 1P5QA 2DSVA 2ITKA 1FKKA 2B31A 4Z2HA 4TX0A 2F21A 3BXWA 2DG9A 5HBFA 3UQBA 3ARYA 4TYOA 1R9HA 3QOKA 4TW8A 4DROA 1W1PA 3NRKA 1VF8A 1Q1CA 4Q22A 1NMWA 3RMEA 4HARA 1PINA 1D7HA 2M1IA 1W9VA 4JYSA 3WL0A 4IT6A 1FKDA 2ETNA 5HT1A 4QT3A 2ZQSA 5HUAA 1LG1A 4JFIA 1XRVA 4WK9A 4QIBA 1SYTA 2XP6A 2K8IA 3UQAA 4KQZA 4P8WA 3KCEA 3FAPA 2MLZA 1JCHB 1X6NA 4MNJA 1HKJA 3JYJA 4IQCA 1HJXA 2DSZA 1FKTA 3O5EA 3ARPA 1HJVA 4ZPVR 3KABA 1LL7A 2QF8A 3O5LA 4G2PA 1LQ0A 4W9OA 3WH0A 2PPPA 2RUCA 1A7XA 1E15A 1ZBVA 1H0IA 2A3AA 5JH8A 2ZQTA 3O5DA 1OGBA 5GPGA 1NH6A 2KO7A 1ZL1A 2F23A 2KE0A 2ZQVA 3O5KA 5HW8A 3WQVA 3UI5A 1LG2A 4MNMA 3CH9A 3AS1A 4ML4A 2XP8A 1NSGA 3GTYX 1OGGA 3CZ8A 3ODKA 3B9AA 1NWRA 2M2AA 3O5QA 3ARRA 4LAYA 2MPHA 2LGOA 1J6YA 1TFVA 2MLXA 3EY6A 1LL6A 3RFWA 3WD3A 4P8UA 3WL1A 1J4HA 1K9TA 2PBCA 3WIJA 4ODOA 3PRDA 1HKKA 1B6CA 3ARUA 1QZ2A 1E9LA 2OLHA 1FFRA 2KGJA 3IK8A 1ZBKA 4JFMA 1HXVA 1ZBWA 2LKNA 4TW6A 4JFJA 4MSPA 3AS2A 3ALFA 3CHEA 4L72B 1NWUA 3AROA 5GQBA 4JFKA 4NNRA 1U79A 1ZU8A 2DSUA 1Q6UA 3B7XA 1GOIA 5HKGA 3WD2A 2LPVA 2MNTA 1E6PA 2XP5A 2XP9A 3ARTA 1ZBCA 3GPKA 4UDMA 4U84A 3H9RB 4URIA 1ZK6A 3IKGA 1CTNA 5HWCA 2D9FA 2EULA 2A3EA 4BF8A 4AY1A 3UI6A 2G41A 3TCZA 1SR0A 1ITXA 1UR8A 3JYMA 3KACA 3ARSA 5GPRA 1Q6IA 5DO2A 4TW7A 1NWTA 4ODRA 2O92A 3AS0A 2DT0A 1O6IA 4DWSD 2PPNA 3AQUA 4DRJA 4U85A 5J6EA 4DIPA 1FKIA 4HBEA 2VN1A 3PR9A 2KR7A 4Z2KA 4ITZA 1HKMA 1KT1A 4DRKA 4DRMA 4O2TA 4MTVA 4DZ2A 4PTMA 1HJWA 2FKEA 4DRPA 4MPKA 2RUDA 1EQ3A 2YBTA 3B9EA 2RUQA 3AS3A 1EYMA 5HTGA 2P4VA 3WQWA 5HW6A 2A3CA 1C9HA 4N19A 4LAVA 4WIWA 4ZPTR 5B8IC 2WLYA 4C02B 1E44A 4HBOA 1IX5A 3O5FA 4Z2JA 3O5MA 4MAVA 4ZS6A 3ALGA 3G6MA 2PV1A 1E6ZA 2UZ5A 5BXJA 3BMBA 3O5OA 3ARQA 2DSWA 1D7IA 2XPBA 3UF8A 1YATA 1JNSA 5DIVA 3WD1A 4R5EA 2Q5AA 1EHNA 4ODQA 2FDMA 1HKIA 2F2DA 3OOBA 4FAPA 3O5JA 1W1YA 5HW7A 4ODKA 1X6LA 4ODNA 2LJ4A 2AOSA 3I6CA 1Y0OA 5DF0A 2PN0A 2ZR4A 3CGNA 3KAGA 1N1AA 2ESCA 2ZR5A 3CHDA 3ARXA 1FKJA 4GIVA 2IUZA 2PI6A 1GRJA 2VCDA 1EDQA 2RQSA 1FD9A 2MLYA 4S3KA 4Q7NA 1BKFA 4NZCA 1FFQA 4DRIA 1F8AB 4S3JA 2L2SA 1GUVA 2XP7A 4QT2A 1JNTA 2YBUA 1QPLA 3FXYA 1JVWA 3GU0A 4J4NA 1D7JA 1ROTA 3O5PA 4ZPWR 1FKRA 2DT3A 3RM9A 4R0XA 1JNDA 1D2KA 4U86A 1T11A 2WLZA 2N87A 3PA7A 4DRHA 1W26A 1ZCNA 4ODLA 3KZ7A 3WKZA 2KFWA 2WK2A 4LAXA 3UQIA 4L3NA 2ZQUA 4ODPA 3ARZA 4DT4A 1H0GA 2XPAA 2DG3A 4P8VA 3O5IA 5DITA 3CHFA 4MGVA 3VAWA 2JZVA 2PV3A 3EIPA 1EIBA 3NTPA 2RURA 1NMVA 1XHGA 4WKHA 4Z2LA 1E6RA 1PBKA 3RM8A 1Q6HA 4G50A 3UI4A 3MDYB 3WD0A
chains in the Genus database with same CATH topology
4WJXA 2DG4A 3RGCA 1FAPA 4DRNA 1YW5A 2G8ZA 3KADA 4DZ3A 4DWSB 1FKFA 3KAHA 1QPFA 2XP4A 1OWQA 1RD6A 3IKDA 3PRBA 1KFWA 3W4RA 2AWGA 1D6OA 2PPOA 4Z2GA 4WKFA 1FKBA 3CHCA 1W1TA 1J4RA 3TC5A 2A3BA 1WB0A 5D75A 1F40A 3OA5A 1W9PA 4KR0B 1ROUA 4Z2IA 5DEZA 1BL4A 4FN2A 2OFNA 1L1PA 4DWSC 3LUOA 4W9PA 4MNKA 1FKGA 2O9OA 1NWSA 3FY1A 3PRAA 4DRQA 3O5RA 5HWBA 1W1VA 1W9UA 2M08A 2ZR6A 2XP3A 2FAPA 1UR9A 4LGXA 1LL4A 2MF9A 4QZVB 1WAWA 2DT2A 3O5GA 1JNEA 3B8SA 3CGMA 4DH0A 2RSEA 1E6NA 4TNSA 3JXVA 2DT1A 4J4OA 1FKLA 4GGQA 5I98A 3KAIA 2F4EA 3WD4A 5DIUA 1KT0A 3ARVA 4XAKA 3ARWA 1WNOA 3TDBA 2DPEA 2WM0A 4MNLA 1M5YA 2PV2A 4P8XA 4ODMA 1FKSA 1FKHA 2KI3A 2IF4A 4NSBA 3RM4A 1TCOC 4IQ2A 3KAFA 4IPXA 3IHZA 4DWSA 4W9QA 1J4IA 4IT4A 4WKAA 3B9DA 1LJYA 3G6LA 4LAWA 3NI6A 1GPFA 4JFLA 1ZB5A 2Y78A 1FJDA 4W5UA 1P5QA 2DSVA 2ITKA 1FKKA 2B31A 4Z2HA 4TX0A 2F21A 3BXWA 2DG9A 5HBFA 3UQBA 3ARYA 4TYOA 1R9HA 3QOKA 4TW8A 4DROA 1W1PA 3NRKA 1VF8A 1Q1CA 4Q22A 1NMWA 3RMEA 4HARA 1PINA 1D7HA 2M1IA 1W9VA 4JYSA 3WL0A 4IT6A 1FKDA 5HT1A 4QT3A 2ZQSA 5HUAA 1LG1A 4JFIA 1XRVA 4WK9A 4QIBA 1SYTA 2XP6A 2K8IA 3UQAA 4KQZA 4P8WA 3KCEA 3FAPA 2MLZA 1X6NA 4MNJA 1HKJA 3JYJA 4IQCA 1HJXA 2DSZA 1FKTA 3O5EA 3ARPA 1HJVA 4ZPVR 3KABA 1LL7A 2QF8A 3O5LA 4G2PA 1LQ0A 4W9OA 3WH0A 2PPPA 2RUCA 1A7XA 1E15A 1ZBVA 1H0IA 2A3AA 5JH8A 2ZQTA 3O5DA 1OGBA 5GPGA 1NH6A 2KO7A 1ZL1A 2KE0A 2ZQVA 3O5KA 5HW8A 3WQVA 3UI5A 1LG2A 4MNMA 3CH9A 3AS1A 4ML4A 2XP8A 1NSGA 1OGGA 3CZ8A 3ODKA 3B9AA 1NWRA 2M2AA 3O5QA 3ARRA 4LAYA 2MPHA 2LGOA 1J6YA 1TFVA 2MLXA 3EY6A 1LL6A 3RFWA 3WD3A 4P8UA 3WL1A 1J4HA 1K9TA 2PBCA 3WIJA 4ODOA 3PRDA 1HKKA 1B6CA 3ARUA 1QZ2A 1E9LA 2OLHA 1FFRA 2KGJA 3IK8A 1ZBKA 4JFMA 1HXVA 1ZBWA 2LKNA 4TW6A 4JFJA 4MSPA 3AS2A 3ALFA 3CHEA 4L72B 1NWUA 3AROA 5GQBA 4JFKA 4NNRA 1U79A 1ZU8A 2DSUA 1Q6UA 3B7XA 1GOIA 5HKGA 3WD2A 2LPVA 2MNTA 1E6PA 2XP5A 2XP9A 3ARTA 1ZBCA 3GPKA 4U84A 3H9RB 4URIA 1ZK6A 3IKGA 1CTNA 5HWCA 2D9FA 2A3EA 4BF8A 4AY1A 3UI6A 2G41A 3TCZA 1SR0A 1ITXA 1UR8A 3JYMA 3KACA 3ARSA 5GPRA 1Q6IA 5DO2A 4TW7A 1NWTA 4ODRA 2O92A 3AS0A 2DT0A 1O6IA 4DWSD 2PPNA 3AQUA 4DRJA 4U85A 5J6EA 4DIPA 1FKIA 4HBEA 2VN1A 3PR9A 2KR7A 4Z2KA 4ITZA 1HKMA 1KT1A 4DRKA 4DRMA 4O2TA 4MTVA 4DZ2A 4PTMA 1HJWA 2FKEA 4DRPA 4MPKA 2RUDA 1EQ3A 2YBTA 3B9EA 2RUQA 3AS3A 1EYMA 5HTGA 3WQWA 5HW6A 2A3CA 1C9HA 4N19A 4LAVA 4WIWA 4ZPTR 5B8IC 2WLYA 4C02B 4HBOA 1IX5A 3O5FA 4Z2JA 3O5MA 4MAVA 4ZS6A 3ALGA 3G6MA 2PV1A 1E6ZA 2UZ5A 5BXJA 3O5OA 3ARQA 2DSWA 1D7IA 2XPBA 3UF8A 1YATA 1JNSA 5DIVA 3WD1A 4R5EA 2Q5AA 1EHNA 4ODQA 2FDMA 1HKIA 2F2DA 3OOBA 4FAPA 3O5JA 1W1YA 5HW7A 4ODKA 1X6LA 4ODNA 2LJ4A 2AOSA 3I6CA 1Y0OA 5DF0A 2ZR4A 3CGNA 3KAGA 1N1AA 2ESCA 2ZR5A 3CHDA 3ARXA 1FKJA 4GIVA 2IUZA 2PI6A 2VCDA 1EDQA 2RQSA 1FD9A 2MLYA 4S3KA 4Q7NA 1BKFA 4NZCA 1FFQA 4DRIA 1F8AB 4S3JA 2L2SA 1GUVA 2XP7A 4QT2A 1JNTA 2YBUA 1QPLA 3FXYA 1JVWA 4J4NA 1D7JA 1ROTA 3O5PA 4ZPWR 1FKRA 2DT3A 3RM9A 4R0XA 1JNDA 1D2KA 4U86A 1T11A 2WLZA 2N87A 3PA7A 4DRHA 1W26A 1ZCNA 4ODLA 3KZ7A 3WKZA 2KFWA 2WK2A 4LAXA 3UQIA 4L3NA 2ZQUA 4ODPA 3ARZA 4DT4A 1H0GA 2XPAA 2DG3A 4P8VA 3O5IA 5DITA 3CHFA 4MGVA 3VAWA 2JZVA 2PV3A 1EIBA 3NTPA 2RURA 1NMVA 1XHGA 4WKHA 4Z2LA 1E6RA 1PBKA 3RM8A 1Q6HA 4G50A 3UI4A 3MDYB 3WD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TYO A;  1R9H A;  4TW8 A;  4DRO A;  2UZ5 A;  2KGJ A;  5BXJ A;  3IK8 A;  3NRK A;  2DG4 A;  3O5O A;  3RGC A;  1D7I A;  4JFM A;  2XPB A;  1FAP A;  4DRN A;  3UF8 A;  1HXV A;  1YW5 A;  1Q1C A;  2LKN A;  1NMW A;  1YAT A;  4JFJ A;  1PIN A;  1D7H A;  4MSP A;  4TW6 A;  5DIV A;  2M1I A;  3KAD A;  4DZ3 A;  1JNS A;  4JYS A;  1FKF A;  2Q5A A;  3KAH A;  1FKD A;  5HT1 A;  4ODQ A;  4QT3 A;  1QPF A;  2XP4 A;  2F2D A;  2ZQS A;  3IKD A;  4JFK A;  5HUA A;  3OOB A;  4FAP A;  4NNR A;  4JFI A;  3O5J A;  1U79 A;  3PRB A;  4ODK A;  1Q6U A;  5HW7 A;  4ODN A;  3B7X A;  2AWG A;  4QIB A;  5HKG A;  2LJ4 A;  3I6C A;  2LPV A;  2MNT A;  1D6O A;  1Y0O A;  2XP6 A;  2K8I A;  2PPO A;  3UQA A;  2ZR4 A;  1FKB A;  3CGN A;  2XP5 A;  3KAG A;  1N1A A;  1J4R A;  2XP9 A;  3TC5 A;  2ZR5 A;  3GPK A;  1FKJ A;  4U84 A;  3H9R B;  5D75 A;  1F40 A;  3KCE A;  4GIV A;  3FAP A;  1ROU A;  2MLZ A;  1ZK6 A;  3IKG A;  4ODO A;  2VCD A;  5HWC A;  2D9F A;  1BL4 A;  4FN2 A;  4BF8 A;  2RQS A;  3JYJ A;  1FD9 A;  2MLY A;  3UI6 A;  4IQC A;  2OFN A;  3TCZ A;  1L1P A;  1BKF A;  1FKT A;  4DRI A;  1F8A B;  3JYM A;  3KAC A;  2L2S A;  3LUO A;  3O5E A;  4W9P A;  1FKG A;  3KAB A;  1Q6I A;  4DRQ A;  4G2P A;  3O5L A;  3O5R A;  5HWB A;  2XP7 A;  4TW7 A;  4QT2 A;  1JNT A;  2M08 A;  4ODR A;  2ZR6 A;  2XP3 A;  2FAP A;  1QPL A;  4W9O A;  3WH0 A;  2PPP A;  2PPN A;  2MF9 A;  2RUC A;  1JVW A;  1A7X A;  1D7J A;  1ROT A;  3O5P A;  3O5G A;  4J4N A;  4U85 A;  4DRJ A;  4DH0 A;  3CGM A;  5J6E A;  4DIP A;  1FKR A;  4R0X A;  2RSE A;  1FKI A;  4TNS A;  2VN1 A;  3JXV A;  2ZQT A;  4U86 A;  1T11 A;  2KR7 A;  3O5D A;  4J4O A;  2N87 A;  5GPG A;  3PA7 A;  4ITZ A;  2KO7 A;  4DRH A;  1FKL A;  1KT1 A;  1W26 A;  4GGQ A;  5I98 A;  4DRK A;  4DRM A;  3KAI A;  1ZCN A;  2F4E A;  4O2T A;  4ODL A;  4DZ2 A;  2KE0 A;  2ZQV A;  3KZ7 A;  5DIU A;  1KT0 A;  3O5K A;  2FKE A;  2KFW A;  4DRP A;  5HW8 A;  2RUD A;  4LAX A;  3UI5 A;  3TDB A;  3UQI A;  1EQ3 A;  1M5Y A;  2PV2 A;  4ODM A;  1FKS A;  2ZQU A;  1FKH A;  2KI3 A;  2RUQ A;  2IF4 A;  4ODP A;  4DT4 A;  2XPA A;  2DG3 A;  3UQB A;  1EYM A;  1TCO C;  1NSG A;  2XP8 A;  4IQ2 A;  3KAF A;  5HTG A;  5HW6 A;  3O5I A;  4IPX A;  1C9H A;  4N19 A;  5DIT A;  3IHZ A;  3ODK A;  4LAV A;  4MGV A;  3VAW A;  4W9Q A;  2M2A A;  2JZV A;  1J4I A;  2PV3 A;  3O5Q A;  3NTP A;  4LAY A;  5B8I C;  2MPH A;  2LGO A;  1NMV A;  2RUR A;  4LAW A;  3NI6 A;  4JFL A;  4C02 B;  1J6Y A;  2MLX A;  3EY6 A;  1FJD A;  2Y78 A;  1PBK A;  3RFW A;  1P5Q A;  2ITK A;  3O5F A;  1FKK A;  1Q6H A;  3O5M A;  4G50 A;  3UI4 A;  4TX0 A;  1J4H A;  2F21 A;  2PBC A;  3MDY B;  2DG9 A;  2PV1 A;  3PRD A;  1B6C A;  1QZ2 A; 
#chains in the Genus database with same CATH topology
 4WJX A;  2DG4 A;  3RGC A;  1FAP A;  4DRN A;  1YW5 A;  2G8Z A;  3KAD A;  4DZ3 A;  4DWS B;  1FKF A;  3KAH A;  1QPF A;  2XP4 A;  1OWQ A;  1RD6 A;  3IKD A;  3PRB A;  1KFW A;  3W4R A;  2AWG A;  1D6O A;  2PPO A;  4Z2G A;  4WKF A;  1FKB A;  3CHC A;  1W1T A;  1J4R A;  3TC5 A;  2A3B A;  1WB0 A;  5D75 A;  1F40 A;  3OA5 A;  1W9P A;  4KR0 B;  1ROU A;  4Z2I A;  5DEZ A;  1BL4 A;  4FN2 A;  2OFN A;  1L1P A;  4DWS C;  3LUO A;  4W9P A;  4MNK A;  1FKG A;  2O9O A;  1NWS A;  3FY1 A;  2B5U B;  3PRA A;  4DRQ A;  3O5R A;  5HWB A;  1W1V A;  1W9U A;  2M08 A;  2ZR6 A;  2XP3 A;  2FAP A;  1UR9 A;  4LGX A;  1LL4 A;  2MF9 A;  4QZV B;  1WAW A;  2DT2 A;  3O5G A;  1JNE A;  3B8S A;  3CGM A;  4DH0 A;  2RSE A;  1E6N A;  4TNS A;  3JXV A;  2DT1 A;  4J4O A;  1FKL A;  4GGQ A;  5I98 A;  3KAI A;  2F4E A;  3WD4 A;  5DIU A;  1KT0 A;  3ARV A;  4XAK A;  3ARW A;  1WNO A;  3TDB A;  2DPE A;  2WM0 A;  4MNL A;  1M5Y A;  2PV2 A;  4P8X A;  4ODM A;  1FKS A;  1FKH A;  2KI3 A;  2IF4 A;  4NSB A;  3RM4 A;  1TCO C;  4IQ2 A;  3KAF A;  4IPX A;  3IHZ A;  4DWS A;  4W9Q A;  1J4I A;  4IT4 A;  4WKA A;  3B9D A;  1LJY A;  3G6L A;  4LAW A;  3NI6 A;  1GPF A;  4JFL A;  1ZB5 A;  2Y78 A;  1FJD A;  4W5U A;  1P5Q A;  2DSV A;  2ITK A;  1FKK A;  2B31 A;  4Z2H A;  4TX0 A;  2F21 A;  3BXW A;  2DG9 A;  5HBF A;  3UQB A;  3ARY A;  4TYO A;  1R9H A;  3QOK A;  4TW8 A;  4DRO A;  1W1P A;  3NRK A;  1VF8 A;  1Q1C A;  4Q22 A;  1NMW A;  3RME A;  4HAR A;  1PIN A;  1D7H A;  2M1I A;  1W9V A;  4JYS A;  3WL0 A;  4IT6 A;  1FKD A;  2ETN A;  5HT1 A;  4QT3 A;  2ZQS A;  5HUA A;  1LG1 A;  4JFI A;  1XRV A;  4WK9 A;  4QIB A;  1SYT A;  2XP6 A;  2K8I A;  3UQA A;  4KQZ A;  4P8W A;  3KCE A;  3FAP A;  2MLZ A;  1JCH B;  1X6N A;  4MNJ A;  1HKJ A;  3JYJ A;  4IQC A;  1HJX A;  2DSZ A;  1FKT A;  3O5E A;  3ARP A;  1HJV A;  4ZPV R;  3KAB A;  1LL7 A;  2QF8 A;  3O5L A;  4G2P A;  1LQ0 A;  4W9O A;  3WH0 A;  2PPP A;  2RUC A;  1A7X A;  1E15 A;  1ZBV A;  1H0I A;  2A3A A;  5JH8 A;  2ZQT A;  3O5D A;  1OGB A;  5GPG A;  1NH6 A;  2KO7 A;  1ZL1 A;  2F23 A;  2KE0 A;  2ZQV A;  3O5K A;  5HW8 A;  3WQV A;  3UI5 A;  1LG2 A;  4MNM A;  3CH9 A;  3AS1 A;  4ML4 A;  2XP8 A;  1NSG A;  3GTY X;  1OGG A;  3CZ8 A;  3ODK A;  3B9A A;  1NWR A;  2M2A A;  3O5Q A;  3ARR A;  4LAY A;  2MPH A;  2LGO A;  1J6Y A;  1TFV A;  2MLX A;  3EY6 A;  1LL6 A;  3RFW A;  3WD3 A;  4P8U A;  3WL1 A;  1J4H A;  1K9T A;  2PBC A;  3WIJ A;  4ODO A;  3PRD A;  1HKK A;  1B6C A;  3ARU A;  1QZ2 A;  1E9L A;  2OLH A;  1FFR A;  2KGJ A;  3IK8 A;  1ZBK A;  4JFM A;  1HXV A;  1ZBW A;  2LKN A;  4TW6 A;  4JFJ A;  4MSP A;  3AS2 A;  3ALF A;  3CHE A;  4L72 B;  1NWU A;  3ARO A;  5GQB A;  4JFK A;  4NNR A;  1U79 A;  1ZU8 A;  2DSU A;  1Q6U A;  3B7X A;  1GOI A;  5HKG A;  3WD2 A;  2LPV A;  2MNT A;  1E6P A;  2XP5 A;  2XP9 A;  3ART A;  1ZBC A;  3GPK A;  4UDM A;  4U84 A;  3H9R B;  4URI A;  1ZK6 A;  3IKG A;  1CTN A;  5HWC A;  2D9F A;  2EUL A;  2A3E A;  4BF8 A;  4AY1 A;  3UI6 A;  2G41 A;  3TCZ A;  1SR0 A;  1ITX A;  1UR8 A;  3JYM A;  3KAC A;  3ARS A;  5GPR A;  1Q6I A;  5DO2 A;  4TW7 A;  1NWT A;  4ODR A;  2O92 A;  3AS0 A;  2DT0 A;  1O6I A;  4DWS D;  2PPN A;  3AQU A;  4DRJ A;  4U85 A;  5J6E A;  4DIP A;  1FKI A;  4HBE A;  2VN1 A;  3PR9 A;  2KR7 A;  4Z2K A;  4ITZ A;  1HKM A;  1KT1 A;  4DRK A;  4DRM A;  4O2T A;  4MTV A;  4DZ2 A;  4PTM A;  1HJW A;  2FKE A;  4DRP A;  4MPK A;  2RUD A;  1EQ3 A;  2YBT A;  3B9E A;  2RUQ A;  3AS3 A;  1EYM A;  5HTG A;  2P4V A;  3WQW A;  5HW6 A;  2A3C A;  1C9H A;  4N19 A;  4LAV A;  4WIW A;  4ZPT R;  5B8I C;  2WLY A;  4C02 B;  1E44 A;  4HBO A;  1IX5 A;  3O5F A;  4Z2J A;  3O5M A;  4MAV A;  4ZS6 A;  3ALG A;  3G6M A;  2PV1 A;  1E6Z A;  2UZ5 A;  5BXJ A;  3BMB A;  3O5O A;  3ARQ A;  2DSW A;  1D7I A;  2XPB A;  3UF8 A;  1YAT A;  1JNS A;  5DIV A;  3WD1 A;  4R5E A;  2Q5A A;  1EHN A;  4ODQ A;  2FDM A;  1HKI A;  2F2D A;  3OOB A;  4FAP A;  3O5J A;  1W1Y A;  5HW7 A;  4ODK A;  1X6L A;  4ODN A;  2LJ4 A;  2AOS A;  3I6C A;  1Y0O A;  5DF0 A;  2PN0 A;  2ZR4 A;  3CGN A;  3KAG A;  1N1A A;  2ESC A;  2ZR5 A;  3CHD A;  3ARX A;  1FKJ A;  4GIV A;  2IUZ A;  2PI6 A;  1GRJ A;  2VCD A;  1EDQ A;  2RQS A;  1FD9 A;  2MLY A;  4S3K A;  4Q7N A;  1BKF A;  4NZC A;  1FFQ A;  4DRI A;  1F8A B;  4S3J A;  2L2S A;  1GUV A;  2XP7 A;  4QT2 A;  1JNT A;  2YBU A;  1QPL A;  3FXY A;  1JVW A;  3GU0 A;  4J4N A;  1D7J A;  1ROT A;  3O5P A;  4ZPW R;  1FKR A;  2DT3 A;  3RM9 A;  4R0X A;  1JND A;  1D2K A;  4U86 A;  1T11 A;  2WLZ A;  2N87 A;  3PA7 A;  4DRH A;  1W26 A;  1ZCN A;  4ODL A;  3KZ7 A;  3WKZ A;  2KFW A;  2WK2 A;  4LAX A;  3UQI A;  4L3N A;  2ZQU A;  4ODP A;  3ARZ A;  4DT4 A;  1H0G A;  2XPA A;  2DG3 A;  4P8V A;  3O5I A;  5DIT A;  3CHF A;  4MGV A;  3VAW A;  2JZV A;  2PV3 A;  3EIP A;  1EIB A;  3NTP A;  2RUR A;  1NMV A;  1XHG A;  4WKH A;  4Z2L A;  1E6R A;  1PBK A;  3RM8 A;  1Q6H A;  4G50 A;  3UI4 A;  3MDY B;  3WD0 A; 
#chains in the Genus database with same CATH homology
 4WJX A;  2DG4 A;  3RGC A;  1FAP A;  4DRN A;  1YW5 A;  2G8Z A;  3KAD A;  4DZ3 A;  4DWS B;  1FKF A;  3KAH A;  1QPF A;  2XP4 A;  1OWQ A;  1RD6 A;  3IKD A;  3PRB A;  1KFW A;  3W4R A;  2AWG A;  1D6O A;  2PPO A;  4Z2G A;  4WKF A;  1FKB A;  3CHC A;  1W1T A;  1J4R A;  3TC5 A;  2A3B A;  1WB0 A;  5D75 A;  1F40 A;  3OA5 A;  1W9P A;  4KR0 B;  1ROU A;  4Z2I A;  5DEZ A;  1BL4 A;  4FN2 A;  2OFN A;  1L1P A;  4DWS C;  3LUO A;  4W9P A;  4MNK A;  1FKG A;  2O9O A;  1NWS A;  3FY1 A;  3PRA A;  4DRQ A;  3O5R A;  5HWB A;  1W1V A;  1W9U A;  2M08 A;  2ZR6 A;  2XP3 A;  2FAP A;  1UR9 A;  4LGX A;  1LL4 A;  2MF9 A;  4QZV B;  1WAW A;  2DT2 A;  3O5G A;  1JNE A;  3B8S A;  3CGM A;  4DH0 A;  2RSE A;  1E6N A;  4TNS A;  3JXV A;  2DT1 A;  4J4O A;  1FKL A;  4GGQ A;  5I98 A;  3KAI A;  2F4E A;  3WD4 A;  5DIU A;  1KT0 A;  3ARV A;  4XAK A;  3ARW A;  1WNO A;  3TDB A;  2DPE A;  2WM0 A;  4MNL A;  1M5Y A;  2PV2 A;  4P8X A;  4ODM A;  1FKS A;  1FKH A;  2KI3 A;  2IF4 A;  4NSB A;  3RM4 A;  1TCO C;  4IQ2 A;  3KAF A;  4IPX A;  3IHZ A;  4DWS A;  4W9Q A;  1J4I A;  4IT4 A;  4WKA A;  3B9D A;  1LJY A;  3G6L A;  4LAW A;  3NI6 A;  1GPF A;  4JFL A;  1ZB5 A;  2Y78 A;  1FJD A;  4W5U A;  1P5Q A;  2DSV A;  2ITK A;  1FKK A;  2B31 A;  4Z2H A;  4TX0 A;  2F21 A;  3BXW A;  2DG9 A;  5HBF A;  3UQB A;  3ARY A;  4TYO A;  1R9H A;  3QOK A;  4TW8 A;  4DRO A;  1W1P A;  3NRK A;  1VF8 A;  1Q1C A;  4Q22 A;  1NMW A;  3RME A;  4HAR A;  1PIN A;  1D7H A;  2M1I A;  1W9V A;  4JYS A;  3WL0 A;  4IT6 A;  1FKD A;  5HT1 A;  4QT3 A;  2ZQS A;  5HUA A;  1LG1 A;  4JFI A;  1XRV A;  4WK9 A;  4QIB A;  1SYT A;  2XP6 A;  2K8I A;  3UQA A;  4KQZ A;  4P8W A;  3KCE A;  3FAP A;  2MLZ A;  1X6N A;  4MNJ A;  1HKJ A;  3JYJ A;  4IQC A;  1HJX A;  2DSZ A;  1FKT A;  3O5E A;  3ARP A;  1HJV A;  4ZPV R;  3KAB A;  1LL7 A;  2QF8 A;  3O5L A;  4G2P A;  1LQ0 A;  4W9O A;  3WH0 A;  2PPP A;  2RUC A;  1A7X A;  1E15 A;  1ZBV A;  1H0I A;  2A3A A;  5JH8 A;  2ZQT A;  3O5D A;  1OGB A;  5GPG A;  1NH6 A;  2KO7 A;  1ZL1 A;  2KE0 A;  2ZQV A;  3O5K A;  5HW8 A;  3WQV A;  3UI5 A;  1LG2 A;  4MNM A;  3CH9 A;  3AS1 A;  4ML4 A;  2XP8 A;  1NSG A;  1OGG A;  3CZ8 A;  3ODK A;  3B9A A;  1NWR A;  2M2A A;  3O5Q A;  3ARR A;  4LAY A;  2MPH A;  2LGO A;  1J6Y A;  1TFV A;  2MLX A;  3EY6 A;  1LL6 A;  3RFW A;  3WD3 A;  4P8U A;  3WL1 A;  1J4H A;  1K9T A;  2PBC A;  3WIJ A;  4ODO A;  3PRD A;  1HKK A;  1B6C A;  3ARU A;  1QZ2 A;  1E9L A;  2OLH A;  1FFR A;  2KGJ A;  3IK8 A;  1ZBK A;  4JFM A;  1HXV A;  1ZBW A;  2LKN A;  4TW6 A;  4JFJ A;  4MSP A;  3AS2 A;  3ALF A;  3CHE A;  4L72 B;  1NWU A;  3ARO A;  5GQB A;  4JFK A;  4NNR A;  1U79 A;  1ZU8 A;  2DSU A;  1Q6U A;  3B7X A;  1GOI A;  5HKG A;  3WD2 A;  2LPV A;  2MNT A;  1E6P A;  2XP5 A;  2XP9 A;  3ART A;  1ZBC A;  3GPK A;  4U84 A;  3H9R B;  4URI A;  1ZK6 A;  3IKG A;  1CTN A;  5HWC A;  2D9F A;  2A3E A;  4BF8 A;  4AY1 A;  3UI6 A;  2G41 A;  3TCZ A;  1SR0 A;  1ITX A;  1UR8 A;  3JYM A;  3KAC A;  3ARS A;  5GPR A;  1Q6I A;  5DO2 A;  4TW7 A;  1NWT A;  4ODR A;  2O92 A;  3AS0 A;  2DT0 A;  1O6I A;  4DWS D;  2PPN A;  3AQU A;  4DRJ A;  4U85 A;  5J6E A;  4DIP A;  1FKI A;  4HBE A;  2VN1 A;  3PR9 A;  2KR7 A;  4Z2K A;  4ITZ A;  1HKM A;  1KT1 A;  4DRK A;  4DRM A;  4O2T A;  4MTV A;  4DZ2 A;  4PTM A;  1HJW A;  2FKE A;  4DRP A;  4MPK A;  2RUD A;  1EQ3 A;  2YBT A;  3B9E A;  2RUQ A;  3AS3 A;  1EYM A;  5HTG A;  3WQW A;  5HW6 A;  2A3C A;  1C9H A;  4N19 A;  4LAV A;  4WIW A;  4ZPT R;  5B8I C;  2WLY A;  4C02 B;  4HBO A;  1IX5 A;  3O5F A;  4Z2J A;  3O5M A;  4MAV A;  4ZS6 A;  3ALG A;  3G6M A;  2PV1 A;  1E6Z A;  2UZ5 A;  5BXJ A;  3O5O A;  3ARQ A;  2DSW A;  1D7I A;  2XPB A;  3UF8 A;  1YAT A;  1JNS A;  5DIV A;  3WD1 A;  4R5E A;  2Q5A A;  1EHN A;  4ODQ A;  2FDM A;  1HKI A;  2F2D A;  3OOB A;  4FAP A;  3O5J A;  1W1Y A;  5HW7 A;  4ODK A;  1X6L A;  4ODN A;  2LJ4 A;  2AOS A;  3I6C A;  1Y0O A;  5DF0 A;  2ZR4 A;  3CGN A;  3KAG A;  1N1A A;  2ESC A;  2ZR5 A;  3CHD A;  3ARX A;  1FKJ A;  4GIV A;  2IUZ A;  2PI6 A;  2VCD A;  1EDQ A;  2RQS A;  1FD9 A;  2MLY A;  4S3K A;  4Q7N A;  1BKF A;  4NZC A;  1FFQ A;  4DRI A;  1F8A B;  4S3J A;  2L2S A;  1GUV A;  2XP7 A;  4QT2 A;  1JNT A;  2YBU A;  1QPL A;  3FXY A;  1JVW A;  4J4N A;  1D7J A;  1ROT A;  3O5P A;  4ZPW R;  1FKR A;  2DT3 A;  3RM9 A;  4R0X A;  1JND A;  1D2K A;  4U86 A;  1T11 A;  2WLZ A;  2N87 A;  3PA7 A;  4DRH A;  1W26 A;  1ZCN A;  4ODL A;  3KZ7 A;  3WKZ A;  2KFW A;  2WK2 A;  4LAX A;  3UQI A;  4L3N A;  2ZQU A;  4ODP A;  3ARZ A;  4DT4 A;  1H0G A;  2XPA A;  2DG3 A;  4P8V A;  3O5I A;  5DIT A;  3CHF A;  4MGV A;  3VAW A;  2JZV A;  2PV3 A;  1EIB A;  3NTP A;  2RUR A;  1NMV A;  1XHG A;  4WKH A;  4Z2L A;  1E6R A;  1PBK A;  3RM8 A;  1Q6H A;  4G50 A;  3UI4 A;  3MDY B;  3WD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...