2KOEA

Human cannabinoid receptor 1 - helix 7/8 peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
40
structure length
40
Chain Sequence
TVFAFASMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of human cannabinoid receptor-1 helix 7/8 peptide: candidate electrostatic interactions and microdomain formation.
pubmed doi rcsb
molecule tags Membrane protein, signaling protein
molecule keywords human cannabinoid receptor 1 - helix 7/8 peptide
total genus 9
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2009-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.70 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 2koeA00
2KOEA
chains in the Genus database with same CATH superfamily
1EA4A 3FMTA 1SH0A 3VEAA 2HZVA 1SIWA 3BSNA 1Q16A 1MYLA 4ME7E 2ADLA 3H87C 1X93A 3G5OA 1MYKA 3QIDA 2AY0A 2K6LA 1BDTA 1BAZA 2JBVA 2Q2KA 2KELA 3NAHA 2CAXA 3UQSA 3UPFA 2A2BA 2CAJA 3OD2A 4QPXA 2K29A 2BJ8A 2K1OA 1PARA 1MNTA 3NNEA 2BJ1A 2WK4A 4NRUA 1SH2A 2AN7A 4AAIA 2BJ3A 1ARQA 1IRQA 3VEBA 2KKEA 2WVDA 4FXEA 1OHNA 3FT7A 4HV0A 2JXHA 4D8JA 1ARRA 2WVFA 3UR0A 1SH3A 3H5XA 2WVBA 3LJPA 2BSQE 3SFGA 2JXIA 4LQ3A 2BJ7A 1B01A 2JXGA 1P94A 1BDVA 4LRVA 4LQ9A 2RBFA 2KOEA 4MJWA 1Q5VA 3LGHA 2UUTA 2HZAA 2WVCA 3SFUA 3NAIA 3H5YA 1B28A 2BA3A 3NO7A 3VW4A 2CADA 4NRTA 1NLAA 1OG7A 2BNZA 2CA9A 2H3AA 2K5JA 1U9PA 2H1OE 3QOQA 2K9IA 2B43A 2CKWA 2CPGA 2GPEA 2UUWA 2BJ9A 1QTGA 2BNWA 2WVEA 3GXQA 3BSOA 4O4RA 3IR7A
chains in the Genus database with same CATH topology
3SFUA 3NAIA 2A2BA 3H5YA 4QPXA 1SH0A 1SIWA 3NO7A 3NNEA 3UR0A 3BSNA 1Q16A 2WK4A 1SH3A 4NRUA 1SH2A 2ADLA 3H5XA 4NRTA 1OG7A 2AN7A 3LJPA 3G5OA 4AAIA 2H3AA 3SFGA 4LQ3A 3QIDA 2B43A 2KKEA 2CKWA 4LRVA 4LQ9A 2UUWA 2JBVA 2Q2KA 3NAHA 1OHNA 2KOEA 4MJWA 3UQSA 3UPFA 3BSOA 4O4RA 2UUTA 3IR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOE A; 
#chains in the Genus database with same CATH topology
 1EA4 A;  3FMT A;  1SH0 A;  3VEA A;  2HZV A;  1SIW A;  3BSN A;  1Q16 A;  1MYL A;  4ME7 E;  2ADL A;  3H87 C;  1X93 A;  3G5O A;  1MYK A;  3QID A;  2AY0 A;  2K6L A;  1BDT A;  1BAZ A;  2JBV A;  2Q2K A;  2KEL A;  3NAH A;  2CAX A;  3UQS A;  3UPF A;  2A2B A;  2CAJ A;  3OD2 A;  4QPX A;  2K29 A;  2BJ8 A;  2K1O A;  1PAR A;  1MNT A;  3NNE A;  2BJ1 A;  2WK4 A;  4NRU A;  1SH2 A;  2AN7 A;  4AAI A;  2BJ3 A;  1ARQ A;  1IRQ A;  3VEB A;  2KKE A;  2WVD A;  4FXE A;  1OHN A;  3FT7 A;  4HV0 A;  2JXH A;  4D8J A;  1ARR A;  2WVF A;  3UR0 A;  1SH3 A;  3H5X A;  2WVB A;  3LJP A;  2BSQ E;  3SFG A;  2JXI A;  4LQ3 A;  2BJ7 A;  1B01 A;  2JXG A;  1P94 A;  1BDV A;  4LRV A;  4LQ9 A;  2RBF A;  2KOE A;  4MJW A;  1Q5V A;  3LGH A;  2UUT A;  2HZA A;  2WVC A;  3SFU A;  3NAI A;  3H5Y A;  1B28 A;  2BA3 A;  3NO7 A;  3VW4 A;  2CAD A;  4NRT A;  1NLA A;  1OG7 A;  2BNZ A;  2CA9 A;  2H3A A;  2K5J A;  1U9P A;  2H1O E;  3QOQ A;  2K9I A;  2B43 A;  2CKW A;  2CPG A;  2GPE A;  2UUW A;  2BJ9 A;  1QTG A;  2BNW A;  2WVE A;  3GXQ A;  3BSO A;  4O4R A;  3IR7 A; 
#chains in the Genus database with same CATH homology
 3SFU A;  3NAI A;  2A2B A;  3H5Y A;  4QPX A;  1SH0 A;  1SIW A;  3NO7 A;  3NNE A;  3UR0 A;  3BSN A;  1Q16 A;  2WK4 A;  1SH3 A;  4NRU A;  1SH2 A;  2ADL A;  3H5X A;  4NRT A;  1OG7 A;  2AN7 A;  3LJP A;  3G5O A;  4AAI A;  2H3A A;  3SFG A;  4LQ3 A;  3QID A;  2B43 A;  2KKE A;  2CKW A;  4LRV A;  4LQ9 A;  2UUW A;  2JBV A;  2Q2K A;  3NAH A;  1OHN A;  2KOE A;  4MJW A;  3UQS A;  3UPF A;  3BSO A;  4O4R A;  2UUT A;  3IR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...