2KOEA

Human cannabinoid receptor 1 - helix 7/8 peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
40
structure length
40
Chain Sequence
b'TVFAFASMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords human cannabinoid receptor 1 - helix 7/8 peptide
publication title NMR solution structure of human cannabinoid receptor-1 helix 7/8 peptide: candidate electrostatic interactions and microdomain formation.
pubmed doi rcsb
molecule tags Membrane protein, signaling protein
total genus 9
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2009-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.70 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 2koeA00
2KOEA
chains in the Genus database with same CATH superfamily
2K5JA 3H5YA 2KKEA 3G5OA 1ARQA 4AAIA 3QIDA 2BSQE 1BAZA 2CAXA 2B43A 2AN7A 2K9IA 2UUTA 1OG7A 4LQ9A 2CA9A 1QTGA 3FT7A 3H5XA 2UUWA 3FMTA 2ADLA 4ME7E 3UPFA 3NAIA 2JXGA 1Q5VA 2K29A 2A2BA 2H3AA 1BDVA 2BJ3A 3QOQA 2BJ7A 1X93A 2K1OA 2WVBA 2CPGA 3IR7A 4NRTA 1MYKA 3H87C 2BJ1A 3NNEA 1SH3A 3SFUA 2JXHA 2Q2KA 1NLAA 2JXIA 3VW4A 2WVFA 2BA3A 1SIWA 2CADA 2WVDA 2RBFA 2JBVA 1U9PA 4LRVA 3SFGA 3UR0A 3LJPA 4NRUA 1P94A 2CAJA 4QPXA 1SH2A 3NAHA 2WVCA 4FXEA 2KELA 3VEAA 2BJ8A 1IRQA 2BNWA 4LQ3A 3UQSA 3OD2A 2GPEA 1B28A 1Q16A 2WK4A 3BSNA 1ARRA 2HZVA 2WVEA 2CKWA 1B01A 4O4RA 2BNZA 1MYLA 2H1OE 2HZAA 3NO7A 1EA4A 1BDTA 3GXQA 2K6LA 2AY0A 2BJ9A 2KOEA 1OHNA 1MNTA 1PARA 3VEBA 1SH0A 4MJWA 4HV0A 4D8JA 3LGHA 3BSOA
chains in the Genus database with same CATH topology
1SIWA 3NAIA 2CKWA 2A2BA 4O4RA 2H3AA 3H5YA 2JBVA 3NO7A 4LRVA 2KKEA 3G5OA 3SFGA 3UR0A 3LJPA 3IR7A 4NRUA 4AAIA 4NRTA 3QIDA 1SH2A 4QPXA 3NAHA 2KOEA 3BSNA 1OHNA 2B43A 2AN7A 1SH0A 2UUTA 1OG7A 3NNEA 4LQ9A 1SH3A 4MJWA 3SFUA 4LQ3A 3UQSA 3H5XA 2UUWA 2Q2KA 3BSOA 2ADLA 1Q16A 2WK4A 3UPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOE A; 
#chains in the Genus database with same CATH topology
 2K5J A;  3H5Y A;  2KKE A;  3G5O A;  1ARQ A;  4AAI A;  3QID A;  2BSQ E;  1BAZ A;  2CAX A;  2B43 A;  2AN7 A;  2K9I A;  2UUT A;  1OG7 A;  4LQ9 A;  2CA9 A;  1QTG A;  3FT7 A;  3H5X A;  2UUW A;  3FMT A;  2ADL A;  4ME7 E;  3UPF A;  3NAI A;  2JXG A;  1Q5V A;  2K29 A;  2A2B A;  2H3A A;  1BDV A;  2BJ3 A;  3QOQ A;  2BJ7 A;  1X93 A;  2K1O A;  2WVB A;  2CPG A;  3IR7 A;  4NRT A;  1MYK A;  3H87 C;  2BJ1 A;  3NNE A;  1SH3 A;  3SFU A;  2JXH A;  2Q2K A;  1NLA A;  2JXI A;  3VW4 A;  2WVF A;  2BA3 A;  1SIW A;  2CAD A;  2WVD A;  2RBF A;  2JBV A;  1U9P A;  4LRV A;  3SFG A;  3UR0 A;  3LJP A;  4NRU A;  1P94 A;  2CAJ A;  4QPX A;  1SH2 A;  3NAH A;  2WVC A;  4FXE A;  2KEL A;  3VEA A;  2BJ8 A;  1IRQ A;  2BNW A;  4LQ3 A;  3UQS A;  3OD2 A;  2GPE A;  1B28 A;  1Q16 A;  2WK4 A;  3BSN A;  1ARR A;  2HZV A;  2WVE A;  2CKW A;  1B01 A;  4O4R A;  2BNZ A;  1MYL A;  2H1O E;  2HZA A;  3NO7 A;  1EA4 A;  1BDT A;  3GXQ A;  2K6L A;  2AY0 A;  2BJ9 A;  2KOE A;  1OHN A;  1MNT A;  1PAR A;  3VEB A;  1SH0 A;  4MJW A;  4HV0 A;  4D8J A;  3LGH A;  3BSO A; 
#chains in the Genus database with same CATH homology
 1SIW A;  3NAI A;  2CKW A;  2A2B A;  4O4R A;  2H3A A;  3H5Y A;  2JBV A;  3NO7 A;  4LRV A;  2KKE A;  3G5O A;  3SFG A;  3UR0 A;  3LJP A;  3IR7 A;  4NRU A;  4AAI A;  4NRT A;  3QID A;  1SH2 A;  4QPX A;  3NAH A;  2KOE A;  3BSN A;  1OHN A;  2B43 A;  2AN7 A;  1SH0 A;  2UUT A;  1OG7 A;  3NNE A;  4LQ9 A;  1SH3 A;  4MJW A;  3SFU A;  4LQ3 A;  3UQS A;  3H5X A;  2UUW A;  2Q2K A;  3BSO A;  2ADL A;  1Q16 A;  2WK4 A;  3UPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...