2KOKA

Solution structure of an arsenate reductase (arsc) related protein from brucella melitensis. seattle structural genomics center for infectious disease target braba.00007.a.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
GPGSMSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASARELMLAQPSMVKRPVLERDGKLMVGFKPAQYEAYFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arsenate reductase
publication title Solution structure of an arsenate reductase-related protein, YffB, from Brucella melitensis, the etiological agent responsible for brucellosis.
pubmed doi rcsb
source organism Brucella abortus
molecule tags Oxidoreductase
total genus 25
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03960 ArsC ArsC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2kokA00
5DCHA 1MEKA 5G30A 2O85A 4ZBAA 3EU4A 4RUVA 1Y6EA 4ZL9A 3UMAA 4K7IA 2YJ7A 1WMJA 6GSTA 1XOAA 4ZIJA 1UN2A 2WZ9A 5DQYA 1EOGA 1FW1A 3IAM2 3GTUB 1O8XA 3RDWA 4JBBA 3KP8A 3HKRA 4BWQA 5J9CA 4WF5A 3QAGA 3U6VA 3ZTLA 3LYKA 1GSEA 3I43A 3P2AA 1X9WB 3TKQA 2D2ZA 1AQWA 1PKZA 2VD1A 4WXTA 2VL9A 3IA1A 2HRNA 2PPTA 5FWGA 3UIWA 3KH7A 5ECNB 4XS4A 4KW6A 2H8LA 2LSTA 5D9WA 1U88A 4KSMA 4Q5FA 1NW2A 3IPZA 3G7IA 2EC4A 4OMVA 2GLRA 1F37A 2DIYA 1QUWA 2V41A 4AJ6A 3U5RE 3P8WA 3ERGA 1EZKA 2GDRA 3A5WA 5D9XA 1G7EA 4NPBA 1RK4A 3FR3A 2YWOA 2N5AA 3FEUA 2YOIA 2YZHA 4BVXA 5ECSA 3GL5A 3UBLA 3ZRDA 2R2JA 3CMIA 2VCWA 2N5FA 5D8IA 3FW2A 2FA4A 3GKNA 3VWVA 2HFDA 3C7MA 4NHZA 1XZOA 3ZIJA 2M72A 2VIMA 1PD21 5ID2A 1A2LA 2AJQB 3TRPA 1WOUA 1AUCA 2PMTA 4DEJA 5DCGA 3HVXA 3C1RA 1FB0A 3Q74A 2CZ2A 4HEA2 1GTBA 3LORA 3DEXA 3KZQA 2DSAA 2KOKA 3HZ8A 2CT6A 1PQNA 1Q4JA 4F82A 3FK8A 3W8SA 4PNFA 4HU7A 1T1VA 3P7XA 1YDKA 1BJXA 1GNEA 3DVXA 4ZBDA 4FO5A 1Y25A 3I69A 4TN8A 2JZSA 2PVOC 4HQSA 2KLXA 1K3LA 2CX3A 4POBA 2H0HA 1O85A 4DVCA 1W89A 3GKKA 5JWOB 1PA3A 3GKXA 1NSWA 3CSJA 4OO5A 6GSUA 4G2EA 1LBKA 5IIZA 1GTUA 4WKWA 2CVDA 3KGKA 16GSA 3GYKA 1FB6A 2WS2A 1XWGA 1UVZA 2BJXA 1ERVA 3TGZA 5CRHA 5ECOB 2REMA 3GN3A 5HR0A 2DMLA 2JACA 3D22A 5EY6A 2HZFA 2AYTA 4D73A 2MZCA 2KP2A 1B4PA 3GNJA 1BAYA 3DXBA 8GSSA 5IQYA 1KEBA 2NBSA 1ZOFA 3IK7A 4K8MA 1WRYA 5B6MA 3GRXA 1A0FA 2FWEA 1V2AA 4DSSB 2H19A 1Z7RA 1HNBA 1IYHA 1TXXA 4HU9A 4L0UA 5D96A 1OVNA 3BBYA 3KTBA 3PGTA 4EVMA 3DYRA 2JADA 4O32A 3CTFA 3I6AA 3VI5A 1QMVA 1G7OA 4ML1A 4ZILA 2VM1A 3GA4A 4IKHA 2L4QA 2V1MA 3KTLA 5B7CA 2R3XA 4QL7A 3WGDA 2GT5A 1T4YA 2JSYA 4NWYA 5LCZA 2RLIA 3LSZA 2P0GA 3FZAA 4LMVA 1WPIA 5A4VA 4NXIA 2E2GA 2AB6A 1TRVA 3RPNA 1HD2A 4GWRA 3E3EA 1MD4A 2HNLA 3TKSE 3EWLA 3G7YA 4MZWA 1Z7PA 4EO3A 4N11A 4MP4A 11GSA 3QDNA 3LYPA 2P5QA 1K0AA 5L71A 1OYJA 4TR1A 4GF0A 1SK0A 3JCML 2V32A 6GSXA 2PGTA 3BJ5A 3UVHA 1JZRA 1PN9A 3GUSA 3Q6OA 2VLVA 2O8VB 2X8HA 1M7TA 4NV5A 4Q5NA 4MJAA 5JCWA 2B5YA 1V58A 3HDCA 2YWIA 3KJYA 3LG6A 5ID2B 6GSVA 1PGTA 1GUKA 1K0DA 3SWLA 3DWVA 1K0OA 2DJJA 4WBRD 2LNTA 4L0WA 2XPEA 2O87A 4MK3A 5D9VA 3FZ4A 1ML6A 5HFIA 4EDZA 2F51A 2IN3A 1JHBA 2DJ1A 2L4CA 3ZLPA 2OBKA 2DJ0A 1T8EB 5C00A 5B8AA 1XWKA 1M9AA 3ERFA 3VFIA 1TKDB 3D0ZA 1J08A 3DVWA 2VL2C 3RPPA 2IL3A 3SBCA 3TJKA 2EIOA 3Q18A 1J0FA 2VCTA 2VAFA 2VLUA 1OE8A 4QL9A 3L9VA 1A8LA 1GSDA 1N2AA 2HRFA 2XHFA 2QKEA 2KHPA 2R37A 4I2UA 4YQMA 2H01A 5JCGA 2YNXA 2C80A 5GSTA 1JZWA 5ECHB 2BTOT 4YQVA 2H73A 2HXKA 2OJLA 3QAWA 2DJKA 3WGEA 2V6OA 1SYRA 2H1GA 4ZB6A 1ERUA 4EL1A 3FY7A 5EL8A 3QOUA 4D73B 2CVKA 2H0IA 4Q5RA 5KEJA 5FHIA 3FRCA 5H5QA 2B7JA 1DSBA 2X99A 4IP1A 4XRAA 2IFQA 2CVBA 1AXDA 1XFLA 2LTKA 5ECPB 2WJUA 4ECBA 1CQGA 4F9ZA 3F3RA 5D9TA 2GGTA 4RI6A 5AISA 1AQVA 3H1NA 3GFKA 4IHUA 4ECJA 5KN1A 4WEYA 2HE3A 4MMMA 4ID0A 1SL0B 2MYGA 3US3A 3FKFA 1GSUA 22GSA 1H75A 1WJKA 5AN1A 2I1UA 1M9BA 3CSIA 1GSYA 4OFNA 3F8UA 2F8FA 4F03A 1GTIA 2JZRA 5KN2A 1EOHA 1PRXA 3TOTA 2E2MA 2C0EA 5D93A 3ERWA 2CV4A 5CRGA 3WGXA 3DIEA 3VPTA 3EURA 3EYTA 3RAZA 1X5EA 4KSOA 1B8XA 1AQXA 2RM6A 4L5OA 5DJMA 5IMFA 3NIVA 3D4MA 4ECIA 2J9HA 2LS5A 3ISOA 1DE1A 3K8NA 5JWRB 2PERA 4IQAA 2ZCTA 2YP6A 5FT3A 1GL8A 1AW9A 1T3BA 3HHVA 3LEFA 1XWCA 1UA5A 2B5XA 2FWHA 5DJLA 5LD0A 5B6NA 4JEDA 1YQ1A 5CREA 5CO3A 5IPHA 2XBIA 4TVEA 5ELAA 3ZREA 3HYPA 2FWFA 2LRTA 3C1SA 4MJCA 2H74A 5ECIB 5IMDA 1HYUA 2K9FA 4KDXA 2I3YA 2CAQA 3F6DA 2H0GA 5HR3A 2FD3A 2C3QA 1K0BA 5COHA 5J4UA 2GSRA 1AC1A 1A0RP 1GH2A 3F4TA 4KNDA 4KGIA 2GT6A 2YWMA 3IBHA 2F8AA 2GTUA 3UL3A 5H5RA 2QSIA 3O76A 1YF0A 4HQZA 3VWUA 1I9DA 1VF1A 2OADA 2DMMA 1TRUA 4PUFC 3TRQA 1GTAA 1A2MA 3UOMA 2IMEA 1K3OA 1F6MC 2OE1A 1ILOA 1V9WA 3VWWA 4K0GA 5H5SA 3UAPA 2OACA 1BG5A 2IMKA 1BYEA 2I81A 4K7NA 4K9ZA 1Z5YE 2GQLA 3ZIVA 3APOA 1O81A 1UC7A 3LXTA 4GLTA 2YN1A 5G31A 4GQCA 1B9YC 5DAKA 3UARA 1QGVA 1EWXA 4XS1A 1DUGA 2C3TA 1PMTA 5AGYA 3L78A 5G2ZA 5GAND 4IQ1A 4KX4A 4PNGA 1ZYEA 2AV4A 1A2JA 4V2MA 18GSA 5ECRB 5AIVA 2DJ3A 3GSSA 5DVBA 1Z9HA 2HZEA 2ZUPA 3LXZA 4I5QA 2LKUA 3KP9A 2FHEA 1K3YA 2QC7A 3LFLA 3TKRA 12GSA 4WETA 3VI7A 3NZNA 2LRCA 5GAPD 3FZ9A 3KIJA 3I9V2 1JLVA 5INYA 4POMA 4IP6A 3L9SA 2B1LA 1TK0B 1EV4A 1XBSA 4N10A 5J5NA 4LL1B 1RW1A 1H4OA 4OCEA 4K6XA 1OC8A 3EMXA 1GSQA 2YANA 2IMIA 1ABAA 2ON5A 5DQSA 3D21A 1Z6NA 4KA0A 2WDUA 3FR6A 2O7KA 4K1FA 3TOUA 2NDOA 4MH2A 2IPAA 4MPGA 3UBKA 3MWHA 1V98A 4MA9A 3TDGA 4TXOA 3LWAA 4NMUA 2TRCP 3GHAA 4BVYA 2HYXA 3IDVA 4CDOA 2GZZA 4MDCA 1B48A 1R26A 1TI3A 4KH7A 2PWJA 1SKRB 1EGRA 3F63A 4V2LA 5CP1A 3F6FA 5EPFA 1FG4A 2MMOA 2HI7A 2YJHA 3ME7A 3DGQA 2MMNA 3CRUA 4FYCA 2JSZA 1NHYA 2WCIA 3E0UA 5KN0A 1WE0A 3EC3A 2H1BA 2LJKA 5ECQB 2H76A 3FHKA 5DALA 14GSA 3VLNA 2PU9C 3F0IA 1XCCA 1S3DA 1TDIA 3E9JB 1K0CA 1G6WA 17GSA 1JFUA 3IV4A 1SK2A 1TP9A 4XS4B 1YY7A 2FGXA 2H1AA 2YV9A 4F0CA 5F06A 1ERTA 3TJJA 3Q19A 4MJBA 1HNCA 2DLXA 3KH9A 6GSYA 2GSSA 2ZNMA 2BMXA 2HSYA 1FAAA 3EVIA 2WULA 4G9HA 1S3AA 3IC4A 1Z3EA 2MBTA 4MF6A 2O89A 4BWSA 3IHQA 3RHBA 2V2GA 3APSA 1XVQA 3S9FA 4X1UA 4HZ4A 3HD5A 1SL2B 2CX4A 2E0QA 3ZL5A 4ML6A 1TRSA 2K6VA 4LMWA 1TRWA 2LEGA 4ZB8A 3KM6A 4AGSA 1ACVA 1ST9A 4DSQA 3WT2A 4O5RA 3RHCA 2RUFA 1KBNA 2MBSA 5DAKB 1GUHA 2Z9SA 4ZBBA 1XW6A 4HUAA 19GSA 3CTGA 2WGRA 2H6YA 4XIHA 3VK9A 4TOPA 1BEDA 5G5EA 2C4JA 5A5KA 2RUEA 4KE3A 2GVPA 2VO4A 3HY2A 4POLA 2OE3A 1W4VA 4KCAA 2GQMA 5F07A 2HZEB 1EEMA 2LNSA 2L59A 1YEXA 4PXOA 3F4RA 2C1YA 1MDJA 2P31A 3C73A 2VCZA 4QQ7A 1U6TA 3KMNA 1MDKA 4KDUA 1QFNA 4RQRA 1U87A 2VOCA 3O6TA 3A2XA 2FUG2 5JWQB 1TU7A 5DBQA 3EMPA 5ELGA 4O7HA 3WD6A 3FR9A 1QXHA 2F3MA 4GXZA 7GSSA 4IS0A 4G10A 4BPYA 4OO4A 5CNWA 4WR4A 3TJGA 2K8VA 1PKWA 4PQ1A 2L6CA 2R6KA 1R4WA 2FWGA 2OA7A 4E8EA 6GSWA 1TK5B 1PSQA 5ECMB 3IR4A 5G1LA 1X5DA 4HS1A 4TXOB 1X9MB 4X43A 2CZ3A 2C0FA 2KP1A 3BD2A 5HFKA 3QFBC 3TKSC 1A8YA 5EVOA 2OE0A 1THXA 4GSNA 4EC0A 1OC3A 2C0DA 3TKPA 3TRXA 2L57A 1O6JA 3RBTA 1T4ZA 3TJFA 4ISDA 1WIKA 3L9UA 2FLSA 3J7Yb 4PURA 4PQIA 1TI1A 1F2EA 1SD9A 1URMA 3BCKA 2LQOA 1SJ6A 1GNWA 2JZTA 5DALB 2VLTA 4IBPA 1IYIA 1OKTA 4E8HA 3J7Yk 5IMZA 3F3QA 1TU8A 2WRTA 3EINA 2PBJA 5IO0A 1DBYA 2I9HA 2IIYA 4MZCA 1MD3A 4I6XA 4KCEA 3ZITA 3OR5A 2HLSA 3UVTA 10GSA 4POKA 1F9MA 2F9SA 2K18A 4TRXA 1PL1A 3VURA 1ERWA 4IELA 4YQUA 5J41A 4WR5A 1EEJA 1M2DA 2OKAA 2VCVA 4YAVA 4I2TA 5GSSA 1O8WA 5D73A 2WFCA 4TR1B 2LV3A 2M80A 1XIYA 1KNGA 2JL4A 2CA8A 2X8GA 1PL2A 1M2AA 3LQ7A 4CHSA 2FA8A 2MMZA 2CQ9A 2G2QA 3VWXA 4YH2A 2N5BA 1SD8A 3DRNA 1OAZA 2G0FA 2ON7A 1GULA 3HZ4A 5E4WA 3C8EA 2IWTA 4PQHA 20GSA 5IPGA 2NVLA 3HJPA 1RQMA 4I8BA 3IE3A 4AF2A 3L4NA 1GRXA 2IMDA 4WF4A 4RQXA 3KCMA 2A2SA 2R5GA 3L0HA 3R2QA 4HJMA 1XXUA 4CW9A 4ZL7A 4TR4A 3FYGA 1EP7A 9GSSA 3GX8A 4DSSA 1FHEA 4V1Ag 3EE2A 3UJ1A 4EDYA 5GZZB 1SL1B 2XC2A 1X0RA 4TXVA 1TJDA 4XHMA 1R5PA 1EV9A 3GMFA 3M9JA 2FY6A 1ZZYA 1Q98A 3CSHA 4K7OA 1BX9A 2AHEA 3A3TA 4JRRA 3KMOA 5IM9A 1I5GA 1THOA 1SKSB 4V1Ap 4FYUA 3ZVJD 5IOWA 1GWCA 1SENA 4HJ2A 3D5JA 2VL2A 1SYXA 4PGTA 1PX6A 4O92A 4GRFA 3PINA 3IOSA 2HT9A 3W6GA 4LL4B 2PUKC 2NPBA 2QGVA 3FZ5A 4LA1A 1TOFA 1OKDA 3G7JA 1V57A 1YEPA 1AIUA 1SJZA 3HVSA 4MZBA 4L5LA 1XWAA 5C04A 4IJIA 1TK8B 3W8JA 1YZXA 1VRSD 2DJ2A 2JU5A 2IFQB 2NTOA 2YCDA 1X9SB 5IMCA 3NOFA 1AAZA 3KEBA 1ZGNA 2R4VA 4FYBA 2XBQA 3GV1A 4KB3A 4L8EA 4J56E 1OE7A 2A4VA 1XOBA 2B3SA 4JR6A 2DIZA 1ON4A 2C0GA 5IMAA 4MLYA 2IJYA 4GQFA 2I4AA 3EU3A 1LU4A 4GCIA 2TIRA 4EXJA 2LRNA 4MCUA 5ABRA 3CYNA 1JLWA 4BA7A 2VCXA 3TKSA 3ZMKA 1X5CA 2H70A 5IMVA 1GP1A 3IK9A 1FO5A 1QQ2A 3ED3A 1OC9A 1HQOA 3GH6A 4DSRA 2J23A 3F4SA 3QPMA 2B7KA 3LJRA 2LQQA 2YV7A 2VCQA 1K0MA 4AJ7A 4GSSA 3N9JA 3QCPA 4OFTA 4LLRA 5G1KA 1ZMAA 2RIIA 4ZXGA 3HCZA 1NM3A 1BQ7A 4TKYA 5G5FA 1YKCA 3GSTA 5HQPA 3QR6A 4GSTA 4ULXA 4MABA 1HNAA 1SK1A 2TRXA 3QFAC 5F0GA 3IXRA 4F0BA 2FCHA 1TW9A 1GSSA 3KD0A 1C72A 1QK8A 5ENUA 4G19A 4KUNA 1U3AA 4TW5A 2P5RA 2C3NA 2FNOA 4JZQA 2IMFA 4XCSA 1MTCA 1WP0A 1R5AA 5JCUA 2DC5A 2KUCA 2LUSA 4TR0A 1GLPA 3TB2A 2LJAA 5ECLB 3UEMA 2GQKA 5DDLA 1ZYQB 1O73A 3M0FA 5CYYA 1FVJA 3GKMA 2H75A 1SKWB 5CAXA 1VF3A 3LGCA 2L5OA 4EF0A 4XS6A 3ZFLA 4N0ZA 3TUEA 1M2BA 4OWYA 1XVWA 2AUVA 3GURA 1O7UA 2VUPA 4OD7A 1PX7A 3ME8A 1F3BA 3GX0A 2VD0A 3AY8A 1CQHA 2CAIA 3PR8A 4JE1A 3M1GA 1YKAA 1S3CA 3M9KA 1E6BA 5IOXA 2B6MA 1LJRA 2GZPA 1ZL9A 2XPDA 4MF7A 4V2NA 3MAKA 4JU5A 4WBJA 4XRDA 3TJBA 2YZUA 3D6IA 4NHWA 4Z7XA 5CRWA 5B8BA 4N30A 3ZMLA 1DE2A 3D4TA 1U3IA 3H4KA 2X64A 3O3TA 4RI7A 2ALBA 2DBCA 2B5EA 3M8NA 4HDEA 5HFGA 5A4UA 2RM5A 2L6DA 4ACSA 2VL3A 4ILFA 4MH3A 4J2FA 4OFMA 2H71A 2H72A 4TR3A 3QAVA 1VGLA 4EE0A 4K0NA 1J9BA 4NAXA 5ECKB 3GTUA 1Z6MA 5E59A 4F2IA 1USBA 4MJEA 3P90A 1YJ6A 3H79A 4PUAA 1SU9A 3ZVJA 4OCFA 4IVFA 4FIWA 1JZDA 3HVVA 1JZOA 2LJRA 13GSA 2E7PA 4ZL8A 2H1DA 3H93A 3A2VA 2V6KA 1XW5A 1T7PB 4PX1A 1GSFA 5KN3A 3H8QA 3ZFBA 3V1WA 4ECCA 1OC9B 3HJMA 5CRDA 2MMAA 1SJIA 4I97A 5J3RA 1K0NA 5J9BA 2HSHA 2B1KA 1R7HA 1G6YA 3DMLA 3WYWA 3QD9A 2YPMA 1FVKA 1XW9A 3GH9A 1NHOA 3IRAA 4N0VA 2GSQA 5LNKe 2GZYA 2H6ZA 1N8JA 1M99A 1VF2A 3TCOA 3IAS2 5F05A 4AJ8A 4HZ2A 3QMXA 5A4WA 4HOJA 1T00A 1KTEA 3WT1A 1A23A 1F3AA 2AAWA 4K2DA 4MF5A 1XWBA 3CBUA 1ZCPA 4EKZA 2C8UA 2K8SA 4J57E 2H30A 2L5LA 4GTUA 1M0UA 3N5OA 3BCIA 3HA9A 1YF1A 4XTSA 3GL3A 3GIXA 1WWJA 4H86A 4FH8A 3DKSA 4KAEA 3M3MA 4ZB9A 5F8BA 4JR4A 1MDIA 4IW9A 5AIXA 4IGJA 3CXGA 4IN0A 2PVQA 1GLQA 2M46A 3PH9A 3APQA 1V40A 3MDKA 1E2YA 3C71A 3HJOA 2PN8A 2WB9A 3A2WA 3ZZXA 3MNGA 1EP8A 1G0TA 3BOAA 3VPQA 1VF4A 1FOVA 4NV2A 6GSSA 3ZYWA 4YAPA 3DD3A 3HXSA 2VM2A 2X8CA 1A24A 3G9BA 5HR1A 4KDYA 1GUMA 2GS3A 4IJ3A 3MSZA 2YWNA 1B4QA 4HI7A 2H66A 2OBIA 5IO2A 4MPFA 4P3YB 3F9UA 4EUYA 4BL7A 2EIRA 2H6XA 5HR2A 2A2RA 1EGOA 1XPVA 2EIQA 1B9XC 2GSTA 4X0XA 1TTZA 4Q5QA 3KXOA 2ES7A 3CRTA
chains in the Genus database with same CATH superfamily
5DCHA 1MEKA 5G30A 2O85A 4ZBAA 3EU4A 4RUVA 1Y6EA 4ZL9A 3UMAA 4K7IA 2YJ7A 4K2XA 1WMJA 6GSTA 1XOAA 4ZIJA 1UN2A 2WZ9A 5DQYA 1EOGA 1FW1A 3IAM2 3GTUB 1O8XA 3RDWA 4JBBA 3KP8A 3HKRA 4BWQA 5J9CA 4WF5A 3QAGA 3U6VA 3ZTLA 3LYKA 1GSEA 3I43A 3P2AA 1X9WB 3TKQA 2D2ZA 1AQWA 1PKZA 2VD1A 4WXTA 2VL9A 3IA1A 2HRNA 2PPTA 5FWGA 3UIWA 3KH7A 5ECNB 4XS4A 4KW6A 2H8LA 2LSTA 5D9WA 1U88A 4KSMA 4Q5FA 1NW2A 3IPZA 3G7IA 2EC4A 4OMVA 2GLRA 1F37A 2DIYA 1QUWA 2V41A 4AJ6A 3U5RE 3P8WA 3ERGA 1EZKA 2GDRA 3A5WA 5D9XA 1G7EA 4NPBA 1RK4A 3FR3A 2YWOA 2N5AA 3FEUA 2YOIA 2YZHA 4BVXA 5ECSA 3GL5A 3UBLA 3ZRDA 2R2JA 3CMIA 2VCWA 2N5FA 5D8IA 3FW2A 1ZYNA 2FA4A 4CY8A 3GKNA 3VWVA 2HFDA 3C7MA 4NHZA 1XZOA 3ZIJA 2M72A 2VIMA 1PD21 5ID2A 1A2LA 2AJQB 3TRPA 1WOUA 1AUCA 2PMTA 4DEJA 1PN0A 5DCGA 1S3RA 3HVXA 3C1RA 1FB0A 3Q74A 2CZ2A 4HEA2 1GTBA 3LORA 3DEXA 3KZQA 2DSAA 2KOKA 3HZ8A 2CT6A 1PQNA 4O5QA 1Q4JA 4F82A 3FK8A 3W8SA 4PNFA 4HU7A 1T1VA 3P7XA 1YDKA 1BJXA 1GNEA 3DVXA 4ZBDA 4FO5A 1Y25A 3I69A 4TN8A 2JZSA 2PVOC 4HQSA 2KLXA 1K3LA 2CX3A 4POBA 2H0HA 1O85A 4DVCA 1W89A 3GKKA 5JWOB 1PA3A 3GKXA 1NSWA 3CSJA 4OO5A 6GSUA 4BL7B 4G2EA 1LBKA 5IIZA 1GTUA 4WKWA 2CVDA 3KGKA 16GSA 3GYKA 1FB6A 2WS2A 1XWGA 1UVZA 2BJXA 1ERVA 3TGZA 5CRHA 5ECOB 2REMA 3GN3A 5HR0A 4Z2RA 2DMLA 2JACA 3D22A 5EY6A 2HZFA 2AYTA 4D73A 2MZCA 2KP2A 1M3IA 1B4PA 3GNJA 1BAYA 3DXBA 8GSSA 5IQYA 4HSCX 1KEBA 2NBSA 1ZOFA 3IK7A 4K8MA 1WRYA 5B6MA 3GRXA 1A0FA 2FWEA 1V2AA 4DSSB 2H19A 1Z7RA 3R3EA 1HNBA 1IYHA 1TXXA 4HU9A 4L0UA 5D96A 1OVNA 3BBYA 3KTBA 3PGTA 4EVMA 3DYRA 2JADA 4O32A 3CTFA 3I6AA 3VI5A 1QMVA 1G7OA 4ML1A 4ZILA 2VM1A 3GA4A 4IKHA 2L4QA 2V1MA 4O5UA 3KTLA 5B7CA 2R3XA 4QL7A 3WGDA 2HRAA 2GT5A 1T4YA 2JSYA 4NWYA 5LCZA 2RLIA 3LSZA 2P0GA 3FZAA 2A4HA 4LMVA 1WPIA 5A4VA 4NXIA 2E2GA 2AB6A 1TRVA 3RPNA 5BMUA 1HD2A 4GWRA 3E3EA 1MD4A 2HNLA 3TKSE 3EWLA 3G7YA 4MZWA 1Z7PA 4EO3A 4N11A 4MP4A 4BVXB 11GSA 3QDNA 3LYPA 2P5QA 1K0AA 5L71A 1OYJA 4TR1A 4GF0A 1SK0A 3JCML 2V32A 6GSXA 2PGTA 3BJ5A 3UVHA 1JZRA 1PN9A 3GUSA 3Q6OA 2VLVA 2O8VB 2X8HA 1M7TA 4NV5A 4Q5NA 4MJAA 5JCWA 2B5YA 1V58A 3HDCA 2YWIA 3KJYA 3LG6A 4CY6A 5ID2B 6GSVA 1PGTA 1GUKA 1K0DA 3SWLA 3DWVA 1K0OA 2DJJA 4WBRD 2LNTA 4L0WA 2XPEA 2O87A 4MK3A 5D9VA 3FZ4A 1ML6A 5HFIA 4EDZA 2F51A 2IN3A 1JHBA 2DJ1A 2L4CA 3ZLPA 2OBKA 2DJ0A 1T8EB 5C00A 5B8AA 1XWKA 1M9AA 3ERFA 3VFIA 1TKDB 3D0ZA 1J08A 3DVWA 2VL2C 3RPPA 2IL3A 3SBCA 3TJKA 2EIOA 3Q18A 1J0FA 2VCTA 2VAFA 2VLUA 1OE8A 4QL9A 3L9VA 1A8LA 1GSDA 1N2AA 2HRFA 2XHFA 2QKEA 2KHPA 2R37A 4I2UA 4YQMA 2H01A 5KOXA 5JCGA 2YNXA 2C80A 5GSTA 1JZWA 5ECHB 2BTOT 4YQVA 2H73A 2HXKA 2OJLA 3QAWA 2DJKA 3WGEA 2V6OA 1PFOA 1SYRA 2H1GA 4ZB6A 4PTSA 1ERUA 4EL1A 3FY7A 5EL8A 3QOUA 4D73B 2CVKA 2H0IA 4Q5RA 5KEJA 5FHIA 3FRCA 5H5QA 2B7JA 1DSBA 2X99A 4IP1A 4XRAA 2IFQA 2CVBA 1AXDA 1XFLA 2LTKA 5ECPB 2WJUA 4ECBA 1CQGA 4F9ZA 3F3RA 5D9TA 2GGTA 4RI6A 5AISA 1AQVA 3H1NA 3GFKA 4IHUA 4ECJA 5KN1A 4WEYA 2HE3A 4MMMA 4ID0A 1SL0B 2MYGA 3US3A 3FKFA 1GSUA 22GSA 4ICYA 1H75A 1WJKA 5AN1A 2I1UA 1M9BA 3CSIA 1GSYA 4OFNA 3F8UA 2F8FA 3MIXA 4F03A 1GTIA 2JZRA 5KN2A 1EOHA 1PRXA 3TOTA 2E2MA 2C0EA 5D93A 3ERWA 2CV4A 5CRGA 3WGXA 3MYDA 3DIEA 3VPTA 3EURA 3EYTA 3RAZA 1X5EA 4KSOA 1B8XA 4MNNA 1AQXA 2RM6A 4L5OA 5DJMA 5IMFA 3NIVA 3D4MA 4ECIA 2J9HA 2LS5A 3ISOA 1DE1A 3K8NA 5JWRB 2HSMA 2PERA 4IQAA 2ZCTA 2YP6A 5FT3A 1GL8A 1AW9A 1T3BA 3HHVA 3LEFA 1XWCA 1UA5A 2B5XA 2FWHA 5DJLA 5LD0A 5B6NA 4JEDA 1YQ1A 5CREA 5CO3A 5IPHA 2XBIA 4TVEA 5ELAA 3ZREA 3HYPA 2FWFA 2LRTA 3C1SA 4MJCA 2H74A 5ECIB 5IMDA 1HYUA 2K9FA 4KDXA 2I3YA 2CAQA 3F6DA 2H0GA 5HR3A 2FD3A 2C3QA 1K0BA 5COHA 5J4UA 2GSRA 1AC1A 1A0RP 1GH2A 3F4TA 2A2PA 4KNDA 4KGIA 2GT6A 2YWMA 3IBHA 2F8AA 2GTUA 3UL3A 4EIPA 3LW9A 4FQUA 5H5RA 2QSIA 3O76A 1YF0A 4HQZA 3VWUA 1I9DA 1VF1A 2OADA 2DMMA 1TRUA 4G0LA 4PUFC 2QA2A 3TRQA 1GTAA 1A2MA 3UOMA 2IMEA 1K3OA 1F6MC 2OE1A 1ILOA 1V9WA 3VWWA 4K0GA 5H5SA 3UAPA 2OACA 1BG5A 2IMKA 1BYEA 2I81A 4K7NA 4K9ZA 1Z5YE 2GQLA 3ZIVA 3APOA 1O81A 1UC7A 3LXTA 4GLTA 2YN1A 5G31A 4GQCA 1B9YC 5DAKA 3UARA 1QGVA 1EWXA 4XS1A 1DUGA 2C3TA 1PMTA 5AGYA 3L78A 5G2ZA 5GAND 4IQ1A 4KX4A 4PNGA 1ZYEA 2AV4A 1A2JA 4V2MA 18GSA 5ECRB 5AIVA 2DJ3A 3GSSA 5DVBA 1Z9HA 2HZEA 2ZUPA 3LXZA 4I5QA 2LKUA 3KP9A 2FHEA 1K3YA 2QC7A 3LFLA 3TKRA 12GSA 4WETA 3VI7A 3NZNA 2LRCA 5GAPD 3FZ9A 3KIJA 3I9V2 1JLVA 5INYA 4POMA 4IP6A 3L9SA 2B1LA 1TK0B 1EV4A 1XBSA 4N10A 5J5NA 4LL1B 1RW1A 1H4OA 4OCEA 4K6XA 1OC8A 3EMXA 1GSQA 2YANA 2IMIA 1ABAA 2ON5A 5DQSA 3D21A 1Z6NA 4KA0A 2WDUA 3FR6A 2O7KA 4K1FA 3TOUA 2NDOA 4MH2A 2IPAA 4MPGA 3EPTA 3UBKA 3A5IA 3MWHA 1V98A 4MA9A 3TDGA 4TXOA 5KOWA 3LWAA 4NMUA 2TRCP 3GHAA 4BVYA 2HYXA 4YKGA 3IDVA 4CDOA 2UZ8A 2GZZA 4MDCA 1B48A 1R26A 1TI3A 4KH7A 2PWJA 1SKRB 1EGRA 3F63A 4V2LA 5CP1A 3F6FA 5EPFA 1FG4A 2MMOA 2HI7A 2YJHA 3ME7A 3DGQA 2MMNA 3CRUA 4FYCA 2JSZA 1NHYA 2WCIA 3E0UA 5KN0A 1WE0A 3EC3A 2H1BA 2LJKA 5ECQB 2R0PA 2H76A 3FHKA 5DALA 14GSA 4BIKA 3VLNA 2PU9C 3F0IA 1XCCA 1S3DA 1TDIA 3E9JB 1K0CA 1G6WA 17GSA 1JFUA 3IV4A 1SK2A 1TP9A 4XS4B 1YY7A 2FGXA 2H1AA 2YV9A 4F0CA 5F06A 1ERTA 3TJJA 3Q19A 4MJBA 1HNCA 2DLXA 3KH9A 6GSYA 2GSSA 2ZNMA 2BMXA 2HSYA 1FAAA 3EVIA 2WULA 4G9HA 1S3AA 3IC4A 1Z3EA 2MBTA 4MF6A 2O89A 4BWSA 3IHQA 3RHBA 2V2GA 3APSA 1XVQA 3S9FA 4X1UA 4HZ4A 3HD5A 1SL2B 2CX4A 2E0QA 3ZL5A 4ML6A 1TRSA 2K6VA 4LMWA 1TRWA 2LEGA 4ZB8A 3KM6A 4AGSA 1ACVA 1ST9A 4DSQA 3WT2A 4O5RA 3RHCA 2DKHA 2RUFA 1KBNA 2MBSA 5DAKB 1GUHA 2HRKA 2Z9SA 4ZBBA 1XW6A 4HUAA 19GSA 3CTGA 2WGRA 2H6YA 4XIHA 3VK9A 5BRTA 4TOPA 1BEDA 5G5EA 2C4JA 5A5KA 2RUEA 4KE3A 2GVPA 2VO4A 3HY2A 4POLA 2OE3A 1W4VA 4KCAA 2GQMA 5F07A 2HZEB 1EEMA 4Z2TA 2LNSA 2L59A 1YEXA 4PXOA 3F4RA 2C1YA 1MDJA 2P31A 3C73A 2VCZA 4QQ7A 1U6TA 3KMNA 1MDKA 4KDUA 1QFNA 4RQRA 1U87A 2VOCA 3O6TA 3A2XA 2FUG2 5JWQB 1TU7A 5DBQA 3EMPA 4X4JA 5ELGA 4O7HA 3WD6A 3FR9A 3IHGA 1QXHA 2F3MA 4GXZA 7GSSA 4IS0A 4G10A 4BPYA 4OO4A 5CNWA 4WR4A 3TJGA 2K8VA 1PKWA 4PQ1A 2L6CA 2R6KA 1R4WA 2FWGA 2OA7A 4EIQA 4E8EA 6GSWA 1TK5B 1PSQA 5ECMB 3IR4A 5G1LA 1X5DA 4HS1A 4TXOB 1X9MB 4X43A 2CZ3A 2C0FA 2KP1A 3BD2A 4BVYB 5HFKA 3QFBC 3TKSC 1A8YA 5EVOA 2OE0A 1THXA 4GSNA 4EC0A 1OC3A 2C0DA 3TKPA 3TRXA 2L57A 1O6JA 3RBTA 1T4ZA 3TJFA 4ISDA 1WIKA 3L9UA 2FLSA 3J7Yb 4PURA 4PQIA 1TI1A 1F2EA 1SD9A 1URMA 2X4AA 3BCKA 2LQOA 1SJ6A 1GNWA 2JZTA 5DALB 2VLTA 4IBPA 1IYIA 1OKTA 4E8HA 3J7Yk 5IMZA 3F3QA 1TU8A 2WRTA 3EINA 2PBJA 5IO0A 1DBYA 2I9HA 2IIYA 4MZCA 1MD3A 4I6XA 4KCEA 3ZITA 3OR5A 2HLSA 3UVTA 10GSA 4POKA 1F9MA 2F9SA 2K18A 4TRXA 1PL1A 3VURA 1ERWA 4IELA 4YQUA 2QA1A 5J41A 4WR5A 1EEJA 1M2DA 2OKAA 2VCVA 4YAVA 4I2TA 5GSSA 1O8WA 5D73A 2WFCA 4TR1B 2LV3A 2M80A 1XIYA 1KNGA 2JL4A 2CA8A 2X8GA 1PL2A 1M2AA 3LQ7A 4CHSA 2FA8A 2MMZA 2CQ9A 2G2QA 3VWXA 4YH2A 2N5BA 1SD8A 3DRNA 1OAZA 2G0FA 2ON7A 4K5SA 1GULA 3HZ4A 5E4WA 3C8EA 2IWTA 4PQHA 20GSA 5IPGA 2NVLA 3HJPA 1RQMA 4I8BA 3IE3A 4AF2A 3L4NA 1GRXA 2IMDA 4WF4A 4RQXA 3KCMA 2A2SA 2R5GA 3L0HA 3R2QA 4HJMA 1XXUA 4CW9A 4ZL7A 4TR4A 3FYGA 1EP7A 9GSSA 3GX8A 4DSSA 1FHEA 4V1Ag 3EE2A 3UJ1A 4EDYA 5GZZB 1SL1B 2XC2A 1X0RA 4TXVA 1TJDA 4XHMA 1R5PA 1EV9A 3GMFA 3M9JA 2FY6A 1ZZYA 1Q98A 3CSHA 4K7OA 1BX9A 2AHEA 3A3TA 4JRRA 3KMOA 5IM9A 1I5GA 1THOA 1SKSB 4V1Ap 4FYUA 3ZVJD 5IOWA 1GWCA 1SENA 4HJ2A 3D5JA 2VL2A 1SYXA 4PGTA 1PX6A 4O92A 4GRFA 3PINA 3IOSA 2HT9A 3W6GA 4LL4B 4K5RA 2PUKC 2NPBA 2QGVA 3FZ5A 4LA1A 1TOFA 1OKDA 3G7JA 4G0KA 1V57A 1YEPA 1AIUA 2R0GA 1SJZA 4G0IA 3HVSA 4MZBA 4L5LA 1XWAA 5C04A 4IJIA 1TK8B 3W8JA 1YZXA 1VRSD 2DJ2A 2JU5A 2IFQB 2NTOA 2YCDA 1X9SB 5IMCA 3NOFA 1AAZA 3KEBA 1ZGNA 2R4VA 4FYBA 2XBQA 3GV1A 4KB3A 4L8EA 4J56E 1OE7A 2A4VA 1XOBA 2B3SA 4A5PA 4JR6A 2DIZA 1ON4A 2C0GA 5IMAA 4MLYA 2IJYA 4GQFA 2I4AA 3EU3A 4Z2UA 1LU4A 4GCIA 1XG8A 2TIRA 4EXJA 2LRNA 4MCUA 5ABRA 3CYNA 1JLWA 4BA7A 2VCXA 3TKSA 3ZMKA 1X5CA 2H70A 5IMVA 1GP1A 3IK9A 1FO5A 1QQ2A 3ED3A 1OC9A 1HQOA 3GH6A 4DSRA 2J23A 3F4SA 2R0CA 3QPMA 1ZYPA 2B7KA 3LJRA 2LQQA 2YV7A 2VCQA 1K0MA 4AJ7A 4GSSA 3N9JA 3QCPA 4OFTA 4LLRA 5G1KA 1ZMAA 2RIIA 4ZXGA 3HCZA 1NM3A 1BQ7A 4TKYA 5G5FA 1YKCA 3GSTA 5HQPA 3QR6A 4GSTA 4ULXA 4MABA 1HNAA 1SK1A 2TRXA 3QFAC 5F0GA 3IXRA 4F0BA 1FOHA 2FCHA 1TW9A 1GSSA 3KD0A 1C72A 1QK8A 5ENUA 4G19A 4KUNA 1U3AA 4TW5A 2P5RA 2C3NA 2FNOA 4JZQA 2DKIA 2IMFA 4XCSA 1MTCA 1WP0A 1R5AA 5JCUA 2DC5A 3IC8A 2KUCA 2LUSA 4TR0A 1GLPA 3TB2A 2LJAA 5ECLB 3UEMA 2GQKA 4USSA 5DDLA 1ZYQB 1O73A 3M0FA 5CYYA 1FVJA 3GKMA 2H75A 1SKWB 5CAXA 1VF3A 3LGCA 2L5OA 4EF0A 4XS6A 3ZFLA 4N0ZA 3TUEA 1M2BA 3FMWA 4OWYA 1XVWA 2AUVA 3GURA 1O7UA 2VUPA 4OD7A 1PX7A 4KF9A 3ME8A 1F3BA 3GX0A 2VD0A 3AY8A 1CQHA 2CAIA 3PR8A 3PPUA 4JE1A 3M1GA 1YKAA 1S3CA 3M9KA 1E6BA 5IOXA 2B6MA 1LJRA 2GZPA 1ZL9A 2XPDA 4MF7A 4V2NA 3MAKA 4JU5A 4WBJA 4XRDA 3TJBA 2YZUA 3D6IA 4NHWA 4Z7XA 5CRWA 5B8BA 4YKFA 4N30A 3ZMLA 1DE2A 3D4TA 1U3IA 3H4KA 2X64A 3O3TA 4RI7A 2ALBA 2DBCA 2B5EA 3M8NA 4HDEA 5HFGA 5A4UA 2RM5A 2L6DA 4ACSA 2VL3A 4ILFA 4MH3A 4J2FA 4OFMA 2H71A 2H72A 4TR3A 3QAVA 1VGLA 4EE0A 4K0NA 1J9BA 4NAXA 5ECKB 3GTUA 1Z6MA 5E59A 4F2IA 4MJEA 1USBA 3P90A 1YJ6A 3H79A 4PUAA 1SU9A 3ZVJA 4OCFA 4IVFA 4FIWA 1JZDA 3HVVA 1JZOA 2LJRA 13GSA 2E7PA 4ZL8A 2H1DA 3H93A 3A2VA 2V6KA 1XW5A 1T7PB 4PX1A 1GSFA 5KN3A 3H8QA 3ZFBA 3V1WA 4ECCA 1OC9B 3HJMA 5CRDA 2MMAA 1SJIA 4I97A 5J3RA 1K0NA 5J9BA 1M3JA 2HSHA 2B1KA 1R7HA 1G6YA 3DMLA 3WYWA 3QD9A 2YPMA 1FVKA 1XW9A 3GH9A 1NHOA 3IRAA 4N0VA 2GSQA 5LNKe 2GZYA 2H6ZA 1N8JA 1M99A 1VF2A 3TCOA 3IAS2 5F05A 4AJ8A 4HZ2A 3QMXA 5A4WA 4HOJA 1T00A 1KTEA 3WT1A 1A23A 1F3AA 2AAWA 4K2DA 4MF5A 1XWBA 3CBUA 1ZCPA 2X49A 4EKZA 2C8UA 2K8SA 3HVNA 4J57E 2H30A 2L5LA 4GTUA 1M0UA 3N5OA 3BCIA 3HA9A 1YF1A 4XTSA 3GL3A 3GIXA 1WWJA 4H86A 4FH8A 3DKSA 4KAEA 3M3MA 4ZB9A 5F8BA 4JR4A 1MDIA 4IW9A 5AIXA 4IGJA 3CXGA 4IN0A 2PVQA 1GLQA 2M46A 3PH9A 3APQA 3CQFA 1V40A 3MDKA 1E2YA 3C71A 3HJOA 2PN8A 2WB9A 3A2WA 3ZZXA 3MNGA 1EP8A 1G0TA 3BOAA 3VPQA 1VF4A 1FOVA 4NV2A 6GSSA 3ZYWA 4YAPA 3DD3A 3HXSA 2VM2A 2X8CA 1A24A 3G9BA 5HR1A 4KDYA 1GUMA 2GS3A 4IJ3A 3MSZA 2YWNA 1B4QA 4HI7A 2H66A 2OBIA 5IO2A 4MPFA 4P3YB 3F9UA 4EUYA 4BL7A 2EIRA 2H6XA 5HR2A 2A2RA 1EGOA 1XPVA 2EIQA 1B9XC 2GSTA 4X0XA 1TTZA 4Q5QA 3KXOA 2ES7A 3CRTA
chains in the Genus database with same CATH topology
5DCHA 1MEKA 5G30A 2O85A 4ZBAA 3EU4A 4RUVA 1Y6EA 4ZL9A 3UMAA 4K7IA 2YJ7A 4K2XA 1WMJA 6GSTA 1XOAA 4ZIJA 1UN2A 2WZ9A 5DQYA 1EOGA 1FW1A 3IAM2 3GTUB 1O8XA 3RDWA 4JBBA 3KP8A 3HKRA 4BWQA 5J9CA 4WF5A 3QAGA 3U6VA 3ZTLA 3LYKA 1GSEA 3I43A 3P2AA 1X9WB 3TKQA 2D2ZA 1AQWA 1PKZA 2VD1A 4WXTA 2VL9A 3IA1A 2HRNA 2PPTA 5FWGA 3UIWA 3KH7A 5ECNB 4XS4A 4KW6A 2H8LA 2LSTA 5D9WA 1U88A 4KSMA 4Q5FA 1NW2A 3IPZA 3G7IA 2EC4A 4OMVA 2GLRA 1F37A 2DIYA 1QUWA 2V41A 4AJ6A 3U5RE 3P8WA 3ERGA 1EZKA 2GDRA 3A5WA 5D9XA 1G7EA 4NPBA 1RK4A 3FR3A 2YWOA 2N5AA 3FEUA 2YOIA 2YZHA 4BVXA 5ECSA 3GL5A 3UBLA 3ZRDA 2R2JA 3CMIA 2VCWA 2N5FA 5D8IA 3FW2A 1ZYNA 2FA4A 4CY8A 3GKNA 3VWVA 2HFDA 3C7MA 4NHZA 1XZOA 3ZIJA 2M72A 2VIMA 1PD21 5ID2A 1A2LA 2AJQB 3TRPA 1WOUA 1AUCA 2PMTA 4DEJA 1PN0A 5DCGA 3HVXA 3C1RA 1FB0A 3Q74A 2CZ2A 4HEA2 1GTBA 3LORA 3DEXA 3KZQA 2DSAA 2KOKA 3HZ8A 2CT6A 1PQNA 4O5QA 1Q4JA 4F82A 3FK8A 3W8SA 4PNFA 4HU7A 1T1VA 3P7XA 1YDKA 1BJXA 1GNEA 3DVXA 4ZBDA 4FO5A 1Y25A 3I69A 4TN8A 2JZSA 2PVOC 4HQSA 2KLXA 1K3LA 2CX3A 4POBA 2H0HA 1O85A 4DVCA 1W89A 3GKKA 5JWOB 1PA3A 3GKXA 1NSWA 3CSJA 4OO5A 6GSUA 4BL7B 4G2EA 1LBKA 5IIZA 1GTUA 4WKWA 2CVDA 3KGKA 16GSA 3GYKA 1FB6A 2WS2A 1XWGA 1UVZA 2BJXA 1ERVA 3TGZA 5CRHA 5ECOB 2REMA 3GN3A 5HR0A 4Z2RA 2DMLA 2JACA 3D22A 5EY6A 2HZFA 2AYTA 4D73A 2MZCA 2KP2A 1B4PA 3GNJA 1BAYA 3DXBA 8GSSA 5IQYA 1KEBA 2NBSA 1ZOFA 3IK7A 4K8MA 1WRYA 5B6MA 3GRXA 1A0FA 2FWEA 1V2AA 4DSSB 2H19A 1Z7RA 3R3EA 1HNBA 1IYHA 1TXXA 4HU9A 4L0UA 5D96A 1OVNA 3BBYA 3KTBA 3PGTA 4EVMA 3DYRA 2JADA 4O32A 3CTFA 3I6AA 3VI5A 1QMVA 1G7OA 4ML1A 4ZILA 2VM1A 3GA4A 4IKHA 2L4QA 2V1MA 4O5UA 3KTLA 5B7CA 2R3XA 4QL7A 3WGDA 2HRAA 2GT5A 1T4YA 2JSYA 4NWYA 5LCZA 2RLIA 3LSZA 2P0GA 3FZAA 2A4HA 4LMVA 1WPIA 5A4VA 4NXIA 2E2GA 2AB6A 1TRVA 3RPNA 5BMUA 1HD2A 4GWRA 3E3EA 1MD4A 2HNLA 3TKSE 3EWLA 3G7YA 4MZWA 1Z7PA 4EO3A 4N11A 4MP4A 4BVXB 11GSA 3QDNA 3LYPA 2P5QA 1K0AA 5L71A 1OYJA 4TR1A 4GF0A 1SK0A 3JCML 2V32A 6GSXA 2PGTA 3BJ5A 3UVHA 1JZRA 1PN9A 3GUSA 3Q6OA 2VLVA 2O8VB 2X8HA 1M7TA 4NV5A 4Q5NA 4MJAA 5JCWA 2B5YA 1V58A 3HDCA 2YWIA 3KJYA 3LG6A 4CY6A 5ID2B 6GSVA 1PGTA 1GUKA 1K0DA 3SWLA 3DWVA 1K0OA 2DJJA 4WBRD 2LNTA 4L0WA 2XPEA 2O87A 4MK3A 5D9VA 3FZ4A 1ML6A 5HFIA 4EDZA 2F51A 2IN3A 1JHBA 2DJ1A 2L4CA 3ZLPA 2OBKA 2DJ0A 1T8EB 5C00A 5B8AA 1XWKA 1M9AA 3ERFA 3VFIA 1TKDB 3D0ZA 1J08A 3DVWA 2VL2C 3RPPA 2IL3A 3SBCA 3TJKA 2EIOA 3Q18A 1J0FA 2VCTA 2VAFA 2VLUA 1OE8A 4QL9A 3L9VA 1A8LA 1GSDA 1N2AA 2HRFA 2XHFA 2QKEA 2KHPA 2R37A 4I2UA 4YQMA 2H01A 5KOXA 5JCGA 2YNXA 2C80A 5GSTA 1JZWA 5ECHB 2BTOT 4YQVA 2H73A 2HXKA 2OJLA 3QAWA 2DJKA 3WGEA 2V6OA 1SYRA 2H1GA 4ZB6A 4PTSA 1ERUA 4EL1A 3FY7A 5EL8A 3QOUA 4D73B 2CVKA 2H0IA 4Q5RA 5KEJA 5FHIA 3FRCA 5H5QA 2B7JA 1DSBA 2X99A 4IP1A 4XRAA 2IFQA 2CVBA 1AXDA 1XFLA 2LTKA 5ECPB 2WJUA 4ECBA 1CQGA 4F9ZA 3F3RA 5D9TA 2GGTA 4RI6A 5AISA 1AQVA 3H1NA 3GFKA 4IHUA 4ECJA 5KN1A 4WEYA 2HE3A 4MMMA 4ID0A 1SL0B 2MYGA 3US3A 3FKFA 1GSUA 22GSA 4ICYA 1H75A 1WJKA 5AN1A 2I1UA 1M9BA 3CSIA 1GSYA 4OFNA 3F8UA 2F8FA 3MIXA 4F03A 1GTIA 2JZRA 5KN2A 1EOHA 1PRXA 3TOTA 2E2MA 2C0EA 5D93A 3ERWA 2CV4A 5CRGA 3WGXA 3MYDA 3DIEA 3VPTA 3EURA 3EYTA 3RAZA 1X5EA 4KSOA 1B8XA 4MNNA 1AQXA 2RM6A 4L5OA 5DJMA 5IMFA 3NIVA 3D4MA 4ECIA 2J9HA 2LS5A 3ISOA 1DE1A 3K8NA 5JWRB 2HSMA 2PERA 4IQAA 2ZCTA 2YP6A 5FT3A 1GL8A 1AW9A 1T3BA 3HHVA 3LEFA 1XWCA 1UA5A 2B5XA 2FWHA 5DJLA 5LD0A 5B6NA 4JEDA 1YQ1A 5CREA 5CO3A 5IPHA 2XBIA 4TVEA 5ELAA 3ZREA 3HYPA 2FWFA 2LRTA 3C1SA 4MJCA 2H74A 5ECIB 5IMDA 1HYUA 2K9FA 4KDXA 2I3YA 2CAQA 3F6DA 2H0GA 5HR3A 2FD3A 2C3QA 1K0BA 5COHA 5J4UA 2GSRA 1AC1A 1A0RP 1GH2A 3F4TA 2A2PA 4KNDA 4KGIA 2GT6A 2YWMA 3IBHA 2F8AA 2GTUA 3UL3A 4EIPA 3LW9A 4FQUA 5H5RA 2QSIA 3O76A 1YF0A 4HQZA 3VWUA 1I9DA 1VF1A 2OADA 2DMMA 1TRUA 4G0LA 4PUFC 2QA2A 3TRQA 1GTAA 1A2MA 3UOMA 2IMEA 1K3OA 1F6MC 2OE1A 1ILOA 1V9WA 3VWWA 4K0GA 5H5SA 3UAPA 2OACA 1BG5A 2IMKA 1BYEA 2I81A 4K7NA 4K9ZA 1Z5YE 2GQLA 3ZIVA 3APOA 1O81A 1UC7A 3LXTA 4GLTA 2YN1A 5G31A 4GQCA 1B9YC 5DAKA 3UARA 1QGVA 1EWXA 4XS1A 1DUGA 2C3TA 1PMTA 5AGYA 3L78A 5G2ZA 5GAND 4IQ1A 4KX4A 4PNGA 1ZYEA 2AV4A 1A2JA 4V2MA 18GSA 5ECRB 5AIVA 2DJ3A 3GSSA 5DVBA 1Z9HA 2HZEA 2ZUPA 3LXZA 4I5QA 2LKUA 3KP9A 2FHEA 1K3YA 2QC7A 3LFLA 3TKRA 12GSA 4WETA 3VI7A 3NZNA 2LRCA 5GAPD 3FZ9A 3KIJA 3I9V2 1JLVA 5INYA 4POMA 4IP6A 3L9SA 2B1LA 1TK0B 1EV4A 1XBSA 4N10A 5J5NA 4LL1B 1RW1A 1H4OA 4OCEA 4K6XA 1OC8A 3EMXA 1GSQA 2YANA 2IMIA 1ABAA 2ON5A 5DQSA 3D21A 1Z6NA 4KA0A 2WDUA 3FR6A 2O7KA 4K1FA 3TOUA 2NDOA 4MH2A 2IPAA 4MPGA 3EPTA 3UBKA 3A5IA 3MWHA 1V98A 4MA9A 3TDGA 4TXOA 5KOWA 3LWAA 4NMUA 2TRCP 3GHAA 4BVYA 2HYXA 4YKGA 3IDVA 4CDOA 2UZ8A 2GZZA 4MDCA 1B48A 1R26A 1TI3A 4KH7A 2PWJA 1SKRB 1EGRA 3F63A 4V2LA 5CP1A 3F6FA 5EPFA 1FG4A 2MMOA 2HI7A 2YJHA 3ME7A 3DGQA 2MMNA 3CRUA 4FYCA 2JSZA 1NHYA 2WCIA 3E0UA 5KN0A 1WE0A 3EC3A 2H1BA 2LJKA 5ECQB 2R0PA 2H76A 3FHKA 5DALA 14GSA 3VLNA 2PU9C 3F0IA 1XCCA 1S3DA 1TDIA 3E9JB 1K0CA 1G6WA 17GSA 1JFUA 3IV4A 1SK2A 1TP9A 4XS4B 1YY7A 2FGXA 2H1AA 2YV9A 4F0CA 5F06A 1ERTA 3TJJA 3Q19A 4MJBA 1HNCA 2DLXA 3KH9A 6GSYA 2GSSA 2ZNMA 2BMXA 2HSYA 1FAAA 3EVIA 2WULA 4G9HA 1S3AA 3IC4A 1Z3EA 2MBTA 4MF6A 2O89A 4BWSA 3IHQA 3RHBA 2V2GA 3APSA 1XVQA 3S9FA 4X1UA 4HZ4A 3HD5A 1SL2B 2CX4A 2E0QA 3ZL5A 4ML6A 1TRSA 2K6VA 4LMWA 1TRWA 2LEGA 4ZB8A 3KM6A 4AGSA 1ACVA 1ST9A 4DSQA 3WT2A 4O5RA 3RHCA 2DKHA 2RUFA 1KBNA 2MBSA 5DAKB 1GUHA 2HRKA 2Z9SA 4ZBBA 1XW6A 4HUAA 19GSA 3CTGA 2WGRA 2H6YA 4XIHA 3VK9A 5BRTA 4TOPA 1BEDA 5G5EA 2C4JA 5A5KA 2RUEA 4KE3A 2GVPA 2VO4A 3HY2A 4POLA 2OE3A 1W4VA 4KCAA 2GQMA 5F07A 2HZEB 1EEMA 4Z2TA 2LNSA 2L59A 1YEXA 4PXOA 3F4RA 2C1YA 1MDJA 2P31A 3C73A 2VCZA 4QQ7A 1U6TA 3KMNA 1MDKA 4KDUA 1QFNA 4RQRA 1U87A 2VOCA 3O6TA 3A2XA 2FUG2 5JWQB 1TU7A 5DBQA 3EMPA 4X4JA 5ELGA 4O7HA 3WD6A 3FR9A 3IHGA 1QXHA 2F3MA 4GXZA 7GSSA 4IS0A 4G10A 4BPYA 4OO4A 5CNWA 4WR4A 3TJGA 2K8VA 1PKWA 4PQ1A 2L6CA 2R6KA 1R4WA 2FWGA 2OA7A 4EIQA 4E8EA 6GSWA 1TK5B 1PSQA 5ECMB 3IR4A 5G1LA 1X5DA 4HS1A 4TXOB 1X9MB 4X43A 2CZ3A 2C0FA 2KP1A 3BD2A 4BVYB 5HFKA 3QFBC 3TKSC 1A8YA 5EVOA 2OE0A 1THXA 4GSNA 4EC0A 1OC3A 2C0DA 3TKPA 3TRXA 2L57A 1O6JA 3RBTA 1T4ZA 3TJFA 4ISDA 1WIKA 3L9UA 2FLSA 3J7Yb 4PURA 4PQIA 1TI1A 1F2EA 1SD9A 1URMA 2X4AA 3BCKA 2LQOA 1SJ6A 1GNWA 2JZTA 5DALB 2VLTA 4IBPA 1IYIA 1OKTA 4E8HA 3J7Yk 5IMZA 3F3QA 1TU8A 2WRTA 3EINA 2PBJA 5IO0A 1DBYA 2I9HA 2IIYA 4MZCA 1MD3A 4I6XA 4KCEA 3ZITA 3OR5A 2HLSA 3UVTA 10GSA 4POKA 1F9MA 2F9SA 2K18A 4TRXA 1PL1A 3VURA 1ERWA 4IELA 4YQUA 2QA1A 5J41A 4WR5A 1EEJA 1M2DA 2OKAA 2VCVA 4YAVA 4I2TA 5GSSA 1O8WA 5D73A 2WFCA 4TR1B 2LV3A 2M80A 1XIYA 1KNGA 2JL4A 2CA8A 2X8GA 1PL2A 1M2AA 3LQ7A 4CHSA 2FA8A 2MMZA 2CQ9A 2G2QA 3VWXA 4YH2A 2N5BA 1SD8A 3DRNA 1OAZA 2G0FA 2ON7A 4K5SA 1GULA 3HZ4A 5E4WA 3C8EA 2IWTA 4PQHA 20GSA 5IPGA 2NVLA 3HJPA 1RQMA 4I8BA 3IE3A 4AF2A 3L4NA 1GRXA 2IMDA 4WF4A 4RQXA 3KCMA 2A2SA 2R5GA 3L0HA 3R2QA 4HJMA 1XXUA 4CW9A 4ZL7A 4TR4A 3FYGA 1EP7A 9GSSA 3GX8A 4DSSA 1FHEA 4V1Ag 3EE2A 3UJ1A 4EDYA 5GZZB 1SL1B 2XC2A 1X0RA 4TXVA 1TJDA 4XHMA 1R5PA 1EV9A 3GMFA 3M9JA 2FY6A 1ZZYA 1Q98A 3CSHA 4K7OA 1BX9A 2AHEA 3A3TA 4JRRA 3KMOA 5IM9A 1I5GA 1THOA 1SKSB 4V1Ap 4FYUA 3ZVJD 5IOWA 1GWCA 1SENA 4HJ2A 3D5JA 2VL2A 1SYXA 4PGTA 1PX6A 4O92A 4GRFA 3PINA 3IOSA 2HT9A 3W6GA 4LL4B 4K5RA 2PUKC 2NPBA 2QGVA 3FZ5A 4LA1A 1TOFA 1OKDA 3G7JA 4G0KA 1V57A 1YEPA 1AIUA 2R0GA 1SJZA 4G0IA 3HVSA 4MZBA 4L5LA 1XWAA 5C04A 4IJIA 1TK8B 3W8JA 1YZXA 1VRSD 2DJ2A 2JU5A 2IFQB 2NTOA 2YCDA 1X9SB 5IMCA 3NOFA 1AAZA 3KEBA 1ZGNA 2R4VA 4FYBA 2XBQA 3GV1A 4KB3A 4L8EA 4J56E 1OE7A 2A4VA 1XOBA 2B3SA 4A5PA 4JR6A 2DIZA 1ON4A 2C0GA 5IMAA 4MLYA 2IJYA 4GQFA 2I4AA 3EU3A 4Z2UA 1LU4A 4GCIA 2TIRA 4EXJA 2LRNA 4MCUA 5ABRA 3CYNA 1JLWA 4BA7A 2VCXA 3TKSA 3ZMKA 1X5CA 2H70A 5IMVA 1GP1A 3IK9A 1FO5A 1QQ2A 3ED3A 1OC9A 1HQOA 3GH6A 4DSRA 2J23A 3F4SA 2R0CA 3QPMA 1ZYPA 2B7KA 3LJRA 2LQQA 2YV7A 2VCQA 1K0MA 4AJ7A 4GSSA 3N9JA 3QCPA 4OFTA 4LLRA 5G1KA 1ZMAA 2RIIA 4ZXGA 3HCZA 1NM3A 1BQ7A 4TKYA 5G5FA 1YKCA 3GSTA 5HQPA 3QR6A 4GSTA 4ULXA 4MABA 1HNAA 1SK1A 2TRXA 3QFAC 5F0GA 3IXRA 4F0BA 1FOHA 2FCHA 1TW9A 1GSSA 3KD0A 1C72A 1QK8A 5ENUA 4G19A 4KUNA 1U3AA 4TW5A 2P5RA 2C3NA 2FNOA 4JZQA 2DKIA 2IMFA 4XCSA 1MTCA 1WP0A 1R5AA 5JCUA 2DC5A 3IC8A 2KUCA 2LUSA 4TR0A 1GLPA 3TB2A 2LJAA 5ECLB 3UEMA 2GQKA 4USSA 5DDLA 1ZYQB 1O73A 3M0FA 5CYYA 1FVJA 3GKMA 2H75A 1SKWB 5CAXA 1VF3A 3LGCA 2L5OA 4EF0A 4XS6A 3ZFLA 4N0ZA 3TUEA 1M2BA 3FMWA 4OWYA 1XVWA 2AUVA 3GURA 1O7UA 2VUPA 4OD7A 1PX7A 4KF9A 3ME8A 1F3BA 3GX0A 2VD0A 3AY8A 1CQHA 2CAIA 3PR8A 3PPUA 4JE1A 3M1GA 1YKAA 1S3CA 3M9KA 1E6BA 5IOXA 2B6MA 1LJRA 2GZPA 1ZL9A 2XPDA 4MF7A 4V2NA 3MAKA 4JU5A 4WBJA 4XRDA 3TJBA 2YZUA 3D6IA 4NHWA 4Z7XA 5CRWA 5B8BA 4YKFA 4N30A 3ZMLA 1DE2A 3D4TA 1U3IA 3H4KA 2X64A 3O3TA 4RI7A 2ALBA 2DBCA 2B5EA 3M8NA 4HDEA 5HFGA 5A4UA 2RM5A 2L6DA 4ACSA 2VL3A 4ILFA 4MH3A 4J2FA 4OFMA 2H71A 2H72A 4TR3A 3QAVA 1VGLA 4EE0A 4K0NA 1J9BA 4NAXA 5ECKB 3GTUA 1Z6MA 5E59A 4F2IA 4MJEA 1USBA 3P90A 1YJ6A 3H79A 4PUAA 1SU9A 3ZVJA 4OCFA 4IVFA 4FIWA 1JZDA 3HVVA 1JZOA 2LJRA 13GSA 2E7PA 4ZL8A 2H1DA 3H93A 3A2VA 2V6KA 1XW5A 1T7PB 4PX1A 1GSFA 5KN3A 3H8QA 3ZFBA 3V1WA 4ECCA 1OC9B 3HJMA 5CRDA 2MMAA 1SJIA 4I97A 5J3RA 1K0NA 5J9BA 2HSHA 2B1KA 1R7HA 1G6YA 3DMLA 3WYWA 3QD9A 2YPMA 1FVKA 1XW9A 3GH9A 1NHOA 3IRAA 4N0VA 2GSQA 5LNKe 2GZYA 2H6ZA 1N8JA 1M99A 1VF2A 3TCOA 3IAS2 5F05A 4AJ8A 4HZ2A 3QMXA 5A4WA 4HOJA 1T00A 1KTEA 3WT1A 1A23A 1F3AA 2AAWA 4K2DA 4MF5A 1XWBA 3CBUA 1ZCPA 2X49A 4EKZA 2C8UA 2K8SA 4J57E 2H30A 2L5LA 4GTUA 1M0UA 3N5OA 3BCIA 3HA9A 1YF1A 4XTSA 3GL3A 3GIXA 1WWJA 4H86A 4FH8A 3DKSA 4KAEA 3M3MA 4ZB9A 5F8BA 4JR4A 1MDIA 4IW9A 5AIXA 4IGJA 3CXGA 4IN0A 2PVQA 1GLQA 2M46A 3PH9A 3APQA 1V40A 3MDKA 1E2YA 3C71A 3HJOA 2PN8A 2WB9A 3A2WA 3ZZXA 3MNGA 1EP8A 1G0TA 3BOAA 3VPQA 1VF4A 1FOVA 4NV2A 6GSSA 3ZYWA 4YAPA 3DD3A 3HXSA 2VM2A 2X8CA 1A24A 3G9BA 5HR1A 4KDYA 1GUMA 2GS3A 4IJ3A 3MSZA 2YWNA 1B4QA 4HI7A 2H66A 2OBIA 5IO2A 4MPFA 4P3YB 3F9UA 4EUYA 4BL7A 2EIRA 2H6XA 5HR2A 2A2RA 1EGOA 1XPVA 2EIQA 1B9XC 2GSTA 4X0XA 1TTZA 4Q5QA 3KXOA 2ES7A 3CRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DCH A;  1MEK A;  5G30 A;  2O85 A;  4ZBA A;  3EU4 A;  4RUV A;  1Y6E A;  4ZL9 A;  3UMA A;  4K7I A;  2YJ7 A;  1WMJ A;  6GST A;  1XOA A;  4ZIJ A;  1UN2 A;  2WZ9 A;  5DQY A;  1EOG A;  1FW1 A;  3IAM 2;  3GTU B;  1O8X A;  3RDW A;  4JBB A;  3KP8 A;  3HKR A;  4BWQ A;  5J9C A;  4WF5 A;  3QAG A;  3U6V A;  3ZTL A;  3LYK A;  1GSE A;  3I43 A;  3P2A A;  1X9W B;  3TKQ A;  2D2Z A;  1AQW A;  1PKZ A;  2VD1 A;  4WXT A;  2VL9 A;  3IA1 A;  2HRN A;  2PPT A;  5FWG A;  3UIW A;  3KH7 A;  5ECN B;  4XS4 A;  4KW6 A;  2H8L A;  2LST A;  5D9W A;  1U88 A;  4KSM A;  4Q5F A;  1NW2 A;  3IPZ A;  3G7I A;  2EC4 A;  4OMV A;  2GLR A;  1F37 A;  2DIY A;  1QUW A;  2V41 A;  4AJ6 A;  3U5R E;  3P8W A;  3ERG A;  1EZK A;  2GDR A;  3A5W A;  5D9X A;  1G7E A;  4NPB A;  1RK4 A;  3FR3 A;  2YWO A;  2N5A A;  3FEU A;  2YOI A;  2YZH A;  4BVX A;  5ECS A;  3GL5 A;  3UBL A;  3ZRD A;  2R2J A;  3CMI A;  2VCW A;  2N5F A;  5D8I A;  3FW2 A;  2FA4 A;  3GKN A;  3VWV A;  2HFD A;  3C7M A;  4NHZ A;  1XZO A;  3ZIJ A;  2M72 A;  2VIM A;  1PD2 1;  5ID2 A;  1A2L A;  2AJQ B;  3TRP A;  1WOU A;  1AUC A;  2PMT A;  4DEJ A;  5DCG A;  3HVX A;  3C1R A;  1FB0 A;  3Q74 A;  2CZ2 A;  4HEA 2;  1GTB A;  3LOR A;  3DEX A;  3KZQ A;  2DSA A;  2KOK A;  3HZ8 A;  2CT6 A;  1PQN A;  1Q4J A;  4F82 A;  3FK8 A;  3W8S A;  4PNF A;  4HU7 A;  1T1V A;  3P7X A;  1YDK A;  1BJX A;  1GNE A;  3DVX A;  4ZBD A;  4FO5 A;  1Y25 A;  3I69 A;  4TN8 A;  2JZS A;  2PVO C;  4HQS A;  2KLX A;  1K3L A;  2CX3 A;  4POB A;  2H0H A;  1O85 A;  4DVC A;  1W89 A;  3GKK A;  5JWO B;  1PA3 A;  3GKX A;  1NSW A;  3CSJ A;  4OO5 A;  6GSU A;  4G2E A;  1LBK A;  5IIZ A;  1GTU A;  4WKW A;  2CVD A;  3KGK A;  16GS A;  3GYK A;  1FB6 A;  2WS2 A;  1XWG A;  1UVZ A;  2BJX A;  1ERV A;  3TGZ A;  5CRH A;  5ECO B;  2REM A;  3GN3 A;  5HR0 A;  2DML A;  2JAC A;  3D22 A;  5EY6 A;  2HZF A;  2AYT A;  4D73 A;  2MZC A;  2KP2 A;  1B4P A;  3GNJ A;  1BAY A;  3DXB A;  8GSS A;  5IQY A;  1KEB A;  2NBS A;  1ZOF A;  3IK7 A;  4K8M A;  1WRY A;  5B6M A;  3GRX A;  1A0F A;  2FWE A;  1V2A A;  4DSS B;  2H19 A;  1Z7R A;  1HNB A;  1IYH A;  1TXX A;  4HU9 A;  4L0U A;  5D96 A;  1OVN A;  3BBY A;  3KTB A;  3PGT A;  4EVM A;  3DYR A;  2JAD A;  4O32 A;  3CTF A;  3I6A A;  3VI5 A;  1QMV A;  1G7O A;  4ML1 A;  4ZIL A;  2VM1 A;  3GA4 A;  4IKH A;  2L4Q A;  2V1M A;  3KTL A;  5B7C A;  2R3X A;  4QL7 A;  3WGD A;  2GT5 A;  1T4Y A;  2JSY A;  4NWY A;  5LCZ A;  2RLI A;  3LSZ A;  2P0G A;  3FZA A;  4LMV A;  1WPI A;  5A4V A;  4NXI A;  2E2G A;  2AB6 A;  1TRV A;  3RPN A;  1HD2 A;  4GWR A;  3E3E A;  1MD4 A;  2HNL A;  3TKS E;  3EWL A;  3G7Y A;  4MZW A;  1Z7P A;  4EO3 A;  4N11 A;  4MP4 A;  11GS A;  3QDN A;  3LYP A;  2P5Q A;  1K0A A;  5L71 A;  1OYJ A;  4TR1 A;  4GF0 A;  1SK0 A;  3JCM L;  2V32 A;  6GSX A;  2PGT A;  3BJ5 A;  3UVH A;  1JZR A;  1PN9 A;  3GUS A;  3Q6O A;  2VLV A;  2O8V B;  2X8H A;  1M7T A;  4NV5 A;  4Q5N A;  4MJA A;  5JCW A;  2B5Y A;  1V58 A;  3HDC A;  2YWI A;  3KJY A;  3LG6 A;  5ID2 B;  6GSV A;  1PGT A;  1GUK A;  1K0D A;  3SWL A;  3DWV A;  1K0O A;  2DJJ A;  4WBR D;  2LNT A;  4L0W A;  2XPE A;  2O87 A;  4MK3 A;  5D9V A;  3FZ4 A;  1ML6 A;  5HFI A;  4EDZ A;  2F51 A;  2IN3 A;  1JHB A;  2DJ1 A;  2L4C A;  3ZLP A;  2OBK A;  2DJ0 A;  1T8E B;  5C00 A;  5B8A A;  1XWK A;  1M9A A;  3ERF A;  3VFI A;  1TKD B;  3D0Z A;  1J08 A;  3DVW A;  2VL2 C;  3RPP A;  2IL3 A;  3SBC A;  3TJK A;  2EIO A;  3Q18 A;  1J0F A;  2VCT A;  2VAF A;  2VLU A;  1OE8 A;  4QL9 A;  3L9V A;  1A8L A;  1GSD A;  1N2A A;  2HRF A;  2XHF A;  2QKE A;  2KHP A;  2R37 A;  4I2U A;  4YQM A;  2H01 A;  5JCG A;  2YNX A;  2C80 A;  5GST A;  1JZW A;  5ECH B;  2BTO T;  4YQV A;  2H73 A;  2HXK A;  2OJL A;  3QAW A;  2DJK A;  3WGE A;  2V6O A;  1SYR A;  2H1G A;  4ZB6 A;  1ERU A;  4EL1 A;  3FY7 A;  5EL8 A;  3QOU A;  4D73 B;  2CVK A;  2H0I A;  4Q5R A;  5KEJ A;  5FHI A;  3FRC A;  5H5Q A;  2B7J A;  1DSB A;  2X99 A;  4IP1 A;  4XRA A;  2IFQ A;  2CVB A;  1AXD A;  1XFL A;  2LTK A;  5ECP B;  2WJU A;  4ECB A;  1CQG A;  4F9Z A;  3F3R A;  5D9T A;  2GGT A;  4RI6 A;  5AIS A;  1AQV A;  3H1N A;  3GFK A;  4IHU A;  4ECJ A;  5KN1 A;  4WEY A;  2HE3 A;  4MMM A;  4ID0 A;  1SL0 B;  2MYG A;  3US3 A;  3FKF A;  1GSU A;  22GS A;  1H75 A;  1WJK A;  5AN1 A;  2I1U A;  1M9B A;  3CSI A;  1GSY A;  4OFN A;  3F8U A;  2F8F A;  4F03 A;  1GTI A;  2JZR A;  5KN2 A;  1EOH A;  1PRX A;  3TOT A;  2E2M A;  2C0E A;  5D93 A;  3ERW A;  2CV4 A;  5CRG A;  3WGX A;  3DIE A;  3VPT A;  3EUR A;  3EYT A;  3RAZ A;  1X5E A;  4KSO A;  1B8X A;  1AQX A;  2RM6 A;  4L5O A;  5DJM A;  5IMF A;  3NIV A;  3D4M A;  4ECI A;  2J9H A;  2LS5 A;  3ISO A;  1DE1 A;  3K8N A;  5JWR B;  2PER A;  4IQA A;  2ZCT A;  2YP6 A;  5FT3 A;  1GL8 A;  1AW9 A;  1T3B A;  3HHV A;  3LEF A;  1XWC A;  1UA5 A;  2B5X A;  2FWH A;  5DJL A;  5LD0 A;  5B6N A;  4JED A;  1YQ1 A;  5CRE A;  5CO3 A;  5IPH A;  2XBI A;  4TVE A;  5ELA A;  3ZRE A;  3HYP A;  2FWF A;  2LRT A;  3C1S A;  4MJC A;  2H74 A;  5ECI B;  5IMD A;  1HYU A;  2K9F A;  4KDX A;  2I3Y A;  2CAQ A;  3F6D A;  2H0G A;  5HR3 A;  2FD3 A;  2C3Q A;  1K0B A;  5COH A;  5J4U A;  2GSR A;  1AC1 A;  1A0R P;  1GH2 A;  3F4T A;  4KND A;  4KGI A;  2GT6 A;  2YWM A;  3IBH A;  2F8A A;  2GTU A;  3UL3 A;  5H5R A;  2QSI A;  3O76 A;  1YF0 A;  4HQZ A;  3VWU A;  1I9D A;  1VF1 A;  2OAD A;  2DMM A;  1TRU A;  4PUF C;  3TRQ A;  1GTA A;  1A2M A;  3UOM A;  2IME A;  1K3O A;  1F6M C;  2OE1 A;  1ILO A;  1V9W A;  3VWW A;  4K0G A;  5H5S A;  3UAP A;  2OAC A;  1BG5 A;  2IMK A;  1BYE A;  2I81 A;  4K7N A;  4K9Z A;  1Z5Y E;  2GQL A;  3ZIV A;  3APO A;  1O81 A;  1UC7 A;  3LXT A;  4GLT A;  2YN1 A;  5G31 A;  4GQC A;  1B9Y C;  5DAK A;  3UAR A;  1QGV A;  1EWX A;  4XS1 A;  1DUG A;  2C3T A;  1PMT A;  5AGY A;  3L78 A;  5G2Z A;  5GAN D;  4IQ1 A;  4KX4 A;  4PNG A;  1ZYE A;  2AV4 A;  1A2J A;  4V2M A;  18GS A;  5ECR B;  5AIV A;  2DJ3 A;  3GSS A;  5DVB A;  1Z9H A;  2HZE A;  2ZUP A;  3LXZ A;  4I5Q A;  2LKU A;  3KP9 A;  2FHE A;  1K3Y A;  2QC7 A;  3LFL A;  3TKR A;  12GS A;  4WET A;  3VI7 A;  3NZN A;  2LRC A;  5GAP D;  3FZ9 A;  3KIJ A;  3I9V 2;  1JLV A;  5INY A;  4POM A;  4IP6 A;  3L9S A;  2B1L A;  1TK0 B;  1EV4 A;  1XBS A;  4N10 A;  5J5N A;  4LL1 B;  1RW1 A;  1H4O A;  4OCE A;  4K6X A;  1OC8 A;  3EMX A;  1GSQ A;  2YAN A;  2IMI A;  1ABA A;  2ON5 A;  5DQS A;  3D21 A;  1Z6N A;  4KA0 A;  2WDU A;  3FR6 A;  2O7K A;  4K1F A;  3TOU A;  2NDO A;  4MH2 A;  2IPA A;  4MPG A;  3UBK A;  3MWH A;  1V98 A;  4MA9 A;  3TDG A;  4TXO A;  3LWA A;  4NMU A;  2TRC P;  3GHA A;  4BVY A;  2HYX A;  3IDV A;  4CDO A;  2GZZ A;  4MDC A;  1B48 A;  1R26 A;  1TI3 A;  4KH7 A;  2PWJ A;  1SKR B;  1EGR A;  3F63 A;  4V2L A;  5CP1 A;  3F6F A;  5EPF A;  1FG4 A;  2MMO A;  2HI7 A;  2YJH A;  3ME7 A;  3DGQ A;  2MMN A;  3CRU A;  4FYC A;  2JSZ A;  1NHY A;  2WCI A;  3E0U A;  5KN0 A;  1WE0 A;  3EC3 A;  2H1B A;  2LJK A;  5ECQ B;  2H76 A;  3FHK A;  5DAL A;  14GS A;  3VLN A;  2PU9 C;  3F0I A;  1XCC A;  1S3D A;  1TDI A;  3E9J B;  1K0C A;  1G6W A;  17GS A;  1JFU A;  3IV4 A;  1SK2 A;  1TP9 A;  4XS4 B;  1YY7 A;  2FGX A;  2H1A A;  2YV9 A;  4F0C A;  5F06 A;  1ERT A;  3TJJ A;  3Q19 A;  4MJB A;  1HNC A;  2DLX A;  3KH9 A;  6GSY A;  2GSS A;  2ZNM A;  2BMX A;  2HSY A;  1FAA A;  3EVI A;  2WUL A;  4G9H A;  1S3A A;  3IC4 A;  1Z3E A;  2MBT A;  4MF6 A;  2O89 A;  4BWS A;  3IHQ A;  3RHB A;  2V2G A;  3APS A;  1XVQ A;  3S9F A;  4X1U A;  4HZ4 A;  3HD5 A;  1SL2 B;  2CX4 A;  2E0Q A;  3ZL5 A;  4ML6 A;  1TRS A;  2K6V A;  4LMW A;  1TRW A;  2LEG A;  4ZB8 A;  3KM6 A;  4AGS A;  1ACV A;  1ST9 A;  4DSQ A;  3WT2 A;  4O5R A;  3RHC A;  2RUF A;  1KBN A;  2MBS A;  5DAK B;  1GUH A;  2Z9S A;  4ZBB A;  1XW6 A;  4HUA A;  19GS A;  3CTG A;  2WGR A;  2H6Y A;  4XIH A;  3VK9 A;  4TOP A;  1BED A;  5G5E A;  2C4J A;  5A5K A;  2RUE A;  4KE3 A;  2GVP A;  2VO4 A;  3HY2 A;  4POL A;  2OE3 A;  1W4V A;  4KCA A;  2GQM A;  5F07 A;  2HZE B;  1EEM A;  2LNS A;  2L59 A;  1YEX A;  4PXO A;  3F4R A;  2C1Y A;  1MDJ A;  2P31 A;  3C73 A;  2VCZ A;  4QQ7 A;  1U6T A;  3KMN A;  1MDK A;  4KDU A;  1QFN A;  4RQR A;  1U87 A;  2VOC A;  3O6T A;  3A2X A;  2FUG 2;  5JWQ B;  1TU7 A;  5DBQ A;  3EMP A;  5ELG A;  4O7H A;  3WD6 A;  3FR9 A;  1QXH A;  2F3M A;  4GXZ A;  7GSS A;  4IS0 A;  4G10 A;  4BPY A;  4OO4 A;  5CNW A;  4WR4 A;  3TJG A;  2K8V A;  1PKW A;  4PQ1 A;  2L6C A;  2R6K A;  1R4W A;  2FWG A;  2OA7 A;  4E8E A;  6GSW A;  1TK5 B;  1PSQ A;  5ECM B;  3IR4 A;  5G1L A;  1X5D A;  4HS1 A;  4TXO B;  1X9M B;  4X43 A;  2CZ3 A;  2C0F A;  2KP1 A;  3BD2 A;  5HFK A;  3QFB C;  3TKS C;  1A8Y A;  5EVO A;  2OE0 A;  1THX A;  4GSN A;  4EC0 A;  1OC3 A;  2C0D A;  3TKP A;  3TRX A;  2L57 A;  1O6J A;  3RBT A;  1T4Z A;  3TJF A;  4ISD A;  1WIK A;  3L9U A;  2FLS A;  3J7Y b;  4PUR A;  4PQI A;  1TI1 A;  1F2E A;  1SD9 A;  1URM A;  3BCK A;  2LQO A;  1SJ6 A;  1GNW A;  2JZT A;  5DAL B;  2VLT A;  4IBP A;  1IYI A;  1OKT A;  4E8H A;  3J7Y k;  5IMZ A;  3F3Q A;  1TU8 A;  2WRT A;  3EIN A;  2PBJ A;  5IO0 A;  1DBY A;  2I9H A;  2IIY A;  4MZC A;  1MD3 A;  4I6X A;  4KCE A;  3ZIT A;  3OR5 A;  2HLS A;  3UVT A;  10GS A;  4POK A;  1F9M A;  2F9S A;  2K18 A;  4TRX A;  1PL1 A;  3VUR A;  1ERW A;  4IEL A;  4YQU A;  5J41 A;  4WR5 A;  1EEJ A;  1M2D A;  2OKA A;  2VCV A;  4YAV A;  4I2T A;  5GSS A;  1O8W A;  5D73 A;  2WFC A;  4TR1 B;  2LV3 A;  2M80 A;  1XIY A;  1KNG A;  2JL4 A;  2CA8 A;  2X8G A;  1PL2 A;  1M2A A;  3LQ7 A;  4CHS A;  2FA8 A;  2MMZ A;  2CQ9 A;  2G2Q A;  3VWX A;  4YH2 A;  2N5B A;  1SD8 A;  3DRN A;  1OAZ A;  2G0F A;  2ON7 A;  1GUL A;  3HZ4 A;  5E4W A;  3C8E A;  2IWT A;  4PQH A;  20GS A;  5IPG A;  2NVL A;  3HJP A;  1RQM A;  4I8B A;  3IE3 A;  4AF2 A;  3L4N A;  1GRX A;  2IMD A;  4WF4 A;  4RQX A;  3KCM A;  2A2S A;  2R5G A;  3L0H A;  3R2Q A;  4HJM A;  1XXU A;  4CW9 A;  4ZL7 A;  4TR4 A;  3FYG A;  1EP7 A;  9GSS A;  3GX8 A;  4DSS A;  1FHE A;  4V1A g;  3EE2 A;  3UJ1 A;  4EDY A;  5GZZ B;  1SL1 B;  2XC2 A;  1X0R A;  4TXV A;  1TJD A;  4XHM A;  1R5P A;  1EV9 A;  3GMF A;  3M9J A;  2FY6 A;  1ZZY A;  1Q98 A;  3CSH A;  4K7O A;  1BX9 A;  2AHE A;  3A3T A;  4JRR A;  3KMO A;  5IM9 A;  1I5G A;  1THO A;  1SKS B;  4V1A p;  4FYU A;  3ZVJ D;  5IOW A;  1GWC A;  1SEN A;  4HJ2 A;  3D5J A;  2VL2 A;  1SYX A;  4PGT A;  1PX6 A;  4O92 A;  4GRF A;  3PIN A;  3IOS A;  2HT9 A;  3W6G A;  4LL4 B;  2PUK C;  2NPB A;  2QGV A;  3FZ5 A;  4LA1 A;  1TOF A;  1OKD A;  3G7J A;  1V57 A;  1YEP A;  1AIU A;  1SJZ A;  3HVS A;  4MZB A;  4L5L A;  1XWA A;  5C04 A;  4IJI A;  1TK8 B;  3W8J A;  1YZX A;  1VRS D;  2DJ2 A;  2JU5 A;  2IFQ B;  2NTO A;  2YCD A;  1X9S B;  5IMC A;  3NOF A;  1AAZ A;  3KEB A;  1ZGN A;  2R4V A;  4FYB A;  2XBQ A;  3GV1 A;  4KB3 A;  4L8E A;  4J56 E;  1OE7 A;  2A4V A;  1XOB A;  2B3S A;  4JR6 A;  2DIZ A;  1ON4 A;  2C0G A;  5IMA A;  4MLY A;  2IJY A;  4GQF A;  2I4A A;  3EU3 A;  1LU4 A;  4GCI A;  2TIR A;  4EXJ A;  2LRN A;  4MCU A;  5ABR A;  3CYN A;  1JLW A;  4BA7 A;  2VCX A;  3TKS A;  3ZMK A;  1X5C A;  2H70 A;  5IMV A;  1GP1 A;  3IK9 A;  1FO5 A;  1QQ2 A;  3ED3 A;  1OC9 A;  1HQO A;  3GH6 A;  4DSR A;  2J23 A;  3F4S A;  3QPM A;  2B7K A;  3LJR A;  2LQQ A;  2YV7 A;  2VCQ A;  1K0M A;  4AJ7 A;  4GSS A;  3N9J A;  3QCP A;  4OFT A;  4LLR A;  5G1K A;  1ZMA A;  2RII A;  4ZXG A;  3HCZ A;  1NM3 A;  1BQ7 A;  4TKY A;  5G5F A;  1YKC A;  3GST A;  5HQP A;  3QR6 A;  4GST A;  4ULX A;  4MAB A;  1HNA A;  1SK1 A;  2TRX A;  3QFA C;  5F0G A;  3IXR A;  4F0B A;  2FCH A;  1TW9 A;  1GSS A;  3KD0 A;  1C72 A;  1QK8 A;  5ENU A;  4G19 A;  4KUN A;  1U3A A;  4TW5 A;  2P5R A;  2C3N A;  2FNO A;  4JZQ A;  2IMF A;  4XCS A;  1MTC A;  1WP0 A;  1R5A A;  5JCU A;  2DC5 A;  2KUC A;  2LUS A;  4TR0 A;  1GLP A;  3TB2 A;  2LJA A;  5ECL B;  3UEM A;  2GQK A;  5DDL A;  1ZYQ B;  1O73 A;  3M0F A;  5CYY A;  1FVJ A;  3GKM A;  2H75 A;  1SKW B;  5CAX A;  1VF3 A;  3LGC A;  2L5O A;  4EF0 A;  4XS6 A;  3ZFL A;  4N0Z A;  3TUE A;  1M2B A;  4OWY A;  1XVW A;  2AUV A;  3GUR A;  1O7U A;  2VUP A;  4OD7 A;  1PX7 A;  3ME8 A;  1F3B A;  3GX0 A;  2VD0 A;  3AY8 A;  1CQH A;  2CAI A;  3PR8 A;  4JE1 A;  3M1G A;  1YKA A;  1S3C A;  3M9K A;  1E6B A;  5IOX A;  2B6M A;  1LJR A;  2GZP A;  1ZL9 A;  2XPD A;  4MF7 A;  4V2N A;  3MAK A;  4JU5 A;  4WBJ A;  4XRD A;  3TJB A;  2YZU A;  3D6I A;  4NHW A;  4Z7X A;  5CRW A;  5B8B A;  4N30 A;  3ZML A;  1DE2 A;  3D4T A;  1U3I A;  3H4K A;  2X64 A;  3O3T A;  4RI7 A;  2ALB A;  2DBC A;  2B5E A;  3M8N A;  4HDE A;  5HFG A;  5A4U A;  2RM5 A;  2L6D A;  4ACS A;  2VL3 A;  4ILF A;  4MH3 A;  4J2F A;  4OFM A;  2H71 A;  2H72 A;  4TR3 A;  3QAV A;  1VGL A;  4EE0 A;  4K0N A;  1J9B A;  4NAX A;  5ECK B;  3GTU A;  1Z6M A;  5E59 A;  4F2I A;  1USB A;  4MJE A;  3P90 A;  1YJ6 A;  3H79 A;  4PUA A;  1SU9 A;  3ZVJ A;  4OCF A;  4IVF A;  4FIW A;  1JZD A;  3HVV A;  1JZO A;  2LJR A;  13GS A;  2E7P A;  4ZL8 A;  2H1D A;  3H93 A;  3A2V A;  2V6K A;  1XW5 A;  1T7P B;  4PX1 A;  1GSF A;  5KN3 A;  3H8Q A;  3ZFB A;  3V1W A;  4ECC A;  1OC9 B;  3HJM A;  5CRD A;  2MMA A;  1SJI A;  4I97 A;  5J3R A;  1K0N A;  5J9B A;  2HSH A;  2B1K A;  1R7H A;  1G6Y A;  3DML A;  3WYW A;  3QD9 A;  2YPM A;  1FVK A;  1XW9 A;  3GH9 A;  1NHO A;  3IRA A;  4N0V A;  2GSQ A;  5LNK e;  2GZY A;  2H6Z A;  1N8J A;  1M99 A;  1VF2 A;  3TCO A;  3IAS 2;  5F05 A;  4AJ8 A;  4HZ2 A;  3QMX A;  5A4W A;  4HOJ A;  1T00 A;  1KTE A;  3WT1 A;  1A23 A;  1F3A A;  2AAW A;  4K2D A;  4MF5 A;  1XWB A;  3CBU A;  1ZCP A;  4EKZ A;  2C8U A;  2K8S A;  4J57 E;  2H30 A;  2L5L A;  4GTU A;  1M0U A;  3N5O A;  3BCI A;  3HA9 A;  1YF1 A;  4XTS A;  3GL3 A;  3GIX A;  1WWJ A;  4H86 A;  4FH8 A;  3DKS A;  4KAE A;  3M3M A;  4ZB9 A;  5F8B A;  4JR4 A;  1MDI A;  4IW9 A;  5AIX A;  4IGJ A;  3CXG A;  4IN0 A;  2PVQ A;  1GLQ A;  2M46 A;  3PH9 A;  3APQ A;  1V40 A;  3MDK A;  1E2Y A;  3C71 A;  3HJO A;  2PN8 A;  2WB9 A;  3A2W A;  3ZZX A;  3MNG A;  1EP8 A;  1G0T A;  3BOA A;  3VPQ A;  1VF4 A;  1FOV A;  4NV2 A;  6GSS A;  3ZYW A;  4YAP A;  3DD3 A;  3HXS A;  2VM2 A;  2X8C A;  1A24 A;  3G9B A;  5HR1 A;  4KDY A;  1GUM A;  2GS3 A;  4IJ3 A;  3MSZ A;  2YWN A;  1B4Q A;  4HI7 A;  2H66 A;  2OBI A;  5IO2 A;  4MPF A;  4P3Y B;  3F9U A;  4EUY A;  4BL7 A;  2EIR A;  2H6X A;  5HR2 A;  2A2R A;  1EGO A;  1XPV A;  2EIQ A;  1B9X C;  2GST A;  4X0X A;  1TTZ A;  4Q5Q A;  3KXO A;  2ES7 A;  3CRT A; 
#chains in the Genus database with same CATH topology
 5DCH A;  1MEK A;  5G30 A;  2O85 A;  4ZBA A;  3EU4 A;  4RUV A;  1Y6E A;  4ZL9 A;  3UMA A;  4K7I A;  2YJ7 A;  4K2X A;  1WMJ A;  6GST A;  1XOA A;  4ZIJ A;  1UN2 A;  2WZ9 A;  5DQY A;  1EOG A;  1FW1 A;  3IAM 2;  3GTU B;  1O8X A;  3RDW A;  4JBB A;  3KP8 A;  3HKR A;  4BWQ A;  5J9C A;  4WF5 A;  3QAG A;  3U6V A;  3ZTL A;  3LYK A;  1GSE A;  3I43 A;  3P2A A;  1X9W B;  3TKQ A;  2D2Z A;  1AQW A;  1PKZ A;  2VD1 A;  4WXT A;  2VL9 A;  3IA1 A;  2HRN A;  2PPT A;  5FWG A;  3UIW A;  3KH7 A;  5ECN B;  4XS4 A;  4KW6 A;  2H8L A;  2LST A;  5D9W A;  1U88 A;  4KSM A;  4Q5F A;  1NW2 A;  3IPZ A;  3G7I A;  2EC4 A;  4OMV A;  2GLR A;  1F37 A;  2DIY A;  1QUW A;  2V41 A;  4AJ6 A;  3U5R E;  3P8W A;  3ERG A;  1EZK A;  2GDR A;  3A5W A;  5D9X A;  1G7E A;  4NPB A;  1RK4 A;  3FR3 A;  2YWO A;  2N5A A;  3FEU A;  2YOI A;  2YZH A;  4BVX A;  5ECS A;  3GL5 A;  3UBL A;  3ZRD A;  2R2J A;  3CMI A;  2VCW A;  2N5F A;  5D8I A;  3FW2 A;  1ZYN A;  2FA4 A;  4CY8 A;  3GKN A;  3VWV A;  2HFD A;  3C7M A;  4NHZ A;  1XZO A;  3ZIJ A;  2M72 A;  2VIM A;  1PD2 1;  5ID2 A;  1A2L A;  2AJQ B;  3TRP A;  1WOU A;  1AUC A;  2PMT A;  4DEJ A;  1PN0 A;  5DCG A;  1S3R A;  3HVX A;  3C1R A;  1FB0 A;  3Q74 A;  2CZ2 A;  4HEA 2;  1GTB A;  3LOR A;  3DEX A;  3KZQ A;  2DSA A;  2KOK A;  3HZ8 A;  2CT6 A;  1PQN A;  4O5Q A;  1Q4J A;  4F82 A;  3FK8 A;  3W8S A;  4PNF A;  4HU7 A;  1T1V A;  3P7X A;  1YDK A;  1BJX A;  1GNE A;  3DVX A;  4ZBD A;  4FO5 A;  1Y25 A;  3I69 A;  4TN8 A;  2JZS A;  2PVO C;  4HQS A;  2KLX A;  1K3L A;  2CX3 A;  4POB A;  2H0H A;  1O85 A;  4DVC A;  1W89 A;  3GKK A;  5JWO B;  1PA3 A;  3GKX A;  1NSW A;  3CSJ A;  4OO5 A;  6GSU A;  4BL7 B;  4G2E A;  1LBK A;  5IIZ A;  1GTU A;  4WKW A;  2CVD A;  3KGK A;  16GS A;  3GYK A;  1FB6 A;  2WS2 A;  1XWG A;  1UVZ A;  2BJX A;  1ERV A;  3TGZ A;  5CRH A;  5ECO B;  2REM A;  3GN3 A;  5HR0 A;  4Z2R A;  2DML A;  2JAC A;  3D22 A;  5EY6 A;  2HZF A;  2AYT A;  4D73 A;  2MZC A;  2KP2 A;  1M3I A;  1B4P A;  3GNJ A;  1BAY A;  3DXB A;  8GSS A;  5IQY A;  4HSC X;  1KEB A;  2NBS A;  1ZOF A;  3IK7 A;  4K8M A;  1WRY A;  5B6M A;  3GRX A;  1A0F A;  2FWE A;  1V2A A;  4DSS B;  2H19 A;  1Z7R A;  3R3E A;  1HNB A;  1IYH A;  1TXX A;  4HU9 A;  4L0U A;  5D96 A;  1OVN A;  3BBY A;  3KTB A;  3PGT A;  4EVM A;  3DYR A;  2JAD A;  4O32 A;  3CTF A;  3I6A A;  3VI5 A;  1QMV A;  1G7O A;  4ML1 A;  4ZIL A;  2VM1 A;  3GA4 A;  4IKH A;  2L4Q A;  2V1M A;  4O5U A;  3KTL A;  5B7C A;  2R3X A;  4QL7 A;  3WGD A;  2HRA A;  2GT5 A;  1T4Y A;  2JSY A;  4NWY A;  5LCZ A;  2RLI A;  3LSZ A;  2P0G A;  3FZA A;  2A4H A;  4LMV A;  1WPI A;  5A4V A;  4NXI A;  2E2G A;  2AB6 A;  1TRV A;  3RPN A;  5BMU A;  1HD2 A;  4GWR A;  3E3E A;  1MD4 A;  2HNL A;  3TKS E;  3EWL A;  3G7Y A;  4MZW A;  1Z7P A;  4EO3 A;  4N11 A;  4MP4 A;  4BVX B;  11GS A;  3QDN A;  3LYP A;  2P5Q A;  1K0A A;  5L71 A;  1OYJ A;  4TR1 A;  4GF0 A;  1SK0 A;  3JCM L;  2V32 A;  6GSX A;  2PGT A;  3BJ5 A;  3UVH A;  1JZR A;  1PN9 A;  3GUS A;  3Q6O A;  2VLV A;  2O8V B;  2X8H A;  1M7T A;  4NV5 A;  4Q5N A;  4MJA A;  5JCW A;  2B5Y A;  1V58 A;  3HDC A;  2YWI A;  3KJY A;  3LG6 A;  4CY6 A;  5ID2 B;  6GSV A;  1PGT A;  1GUK A;  1K0D A;  3SWL A;  3DWV A;  1K0O A;  2DJJ A;  4WBR D;  2LNT A;  4L0W A;  2XPE A;  2O87 A;  4MK3 A;  5D9V A;  3FZ4 A;  1ML6 A;  5HFI A;  4EDZ A;  2F51 A;  2IN3 A;  1JHB A;  2DJ1 A;  2L4C A;  3ZLP A;  2OBK A;  2DJ0 A;  1T8E B;  5C00 A;  5B8A A;  1XWK A;  1M9A A;  3ERF A;  3VFI A;  1TKD B;  3D0Z A;  1J08 A;  3DVW A;  2VL2 C;  3RPP A;  2IL3 A;  3SBC A;  3TJK A;  2EIO A;  3Q18 A;  1J0F A;  2VCT A;  2VAF A;  2VLU A;  1OE8 A;  4QL9 A;  3L9V A;  1A8L A;  1GSD A;  1N2A A;  2HRF A;  2XHF A;  2QKE A;  2KHP A;  2R37 A;  4I2U A;  4YQM A;  2H01 A;  5KOX A;  5JCG A;  2YNX A;  2C80 A;  5GST A;  1JZW A;  5ECH B;  2BTO T;  4YQV A;  2H73 A;  2HXK A;  2OJL A;  3QAW A;  2DJK A;  3WGE A;  2V6O A;  1PFO A;  1SYR A;  2H1G A;  4ZB6 A;  4PTS A;  1ERU A;  4EL1 A;  3FY7 A;  5EL8 A;  3QOU A;  4D73 B;  2CVK A;  2H0I A;  4Q5R A;  5KEJ A;  5FHI A;  3FRC A;  5H5Q A;  2B7J A;  1DSB A;  2X99 A;  4IP1 A;  4XRA A;  2IFQ A;  2CVB A;  1AXD A;  1XFL A;  2LTK A;  5ECP B;  2WJU A;  4ECB A;  1CQG A;  4F9Z A;  3F3R A;  5D9T A;  2GGT A;  4RI6 A;  5AIS A;  1AQV A;  3H1N A;  3GFK A;  4IHU A;  4ECJ A;  5KN1 A;  4WEY A;  2HE3 A;  4MMM A;  4ID0 A;  1SL0 B;  2MYG A;  3US3 A;  3FKF A;  1GSU A;  22GS A;  4ICY A;  1H75 A;  1WJK A;  5AN1 A;  2I1U A;  1M9B A;  3CSI A;  1GSY A;  4OFN A;  3F8U A;  2F8F A;  3MIX A;  4F03 A;  1GTI A;  2JZR A;  5KN2 A;  1EOH A;  1PRX A;  3TOT A;  2E2M A;  2C0E A;  5D93 A;  3ERW A;  2CV4 A;  5CRG A;  3WGX A;  3MYD A;  3DIE A;  3VPT A;  3EUR A;  3EYT A;  3RAZ A;  1X5E A;  4KSO A;  1B8X A;  4MNN A;  1AQX A;  2RM6 A;  4L5O A;  5DJM A;  5IMF A;  3NIV A;  3D4M A;  4ECI A;  2J9H A;  2LS5 A;  3ISO A;  1DE1 A;  3K8N A;  5JWR B;  2HSM A;  2PER A;  4IQA A;  2ZCT A;  2YP6 A;  5FT3 A;  1GL8 A;  1AW9 A;  1T3B A;  3HHV A;  3LEF A;  1XWC A;  1UA5 A;  2B5X A;  2FWH A;  5DJL A;  5LD0 A;  5B6N A;  4JED A;  1YQ1 A;  5CRE A;  5CO3 A;  5IPH A;  2XBI A;  4TVE A;  5ELA A;  3ZRE A;  3HYP A;  2FWF A;  2LRT A;  3C1S A;  4MJC A;  2H74 A;  5ECI B;  5IMD A;  1HYU A;  2K9F A;  4KDX A;  2I3Y A;  2CAQ A;  3F6D A;  2H0G A;  5HR3 A;  2FD3 A;  2C3Q A;  1K0B A;  5COH A;  5J4U A;  2GSR A;  1AC1 A;  1A0R P;  1GH2 A;  3F4T A;  2A2P A;  4KND A;  4KGI A;  2GT6 A;  2YWM A;  3IBH A;  2F8A A;  2GTU A;  3UL3 A;  4EIP A;  3LW9 A;  4FQU A;  5H5R A;  2QSI A;  3O76 A;  1YF0 A;  4HQZ A;  3VWU A;  1I9D A;  1VF1 A;  2OAD A;  2DMM A;  1TRU A;  4G0L A;  4PUF C;  2QA2 A;  3TRQ A;  1GTA A;  1A2M A;  3UOM A;  2IME A;  1K3O A;  1F6M C;  2OE1 A;  1ILO A;  1V9W A;  3VWW A;  4K0G A;  5H5S A;  3UAP A;  2OAC A;  1BG5 A;  2IMK A;  1BYE A;  2I81 A;  4K7N A;  4K9Z A;  1Z5Y E;  2GQL A;  3ZIV A;  3APO A;  1O81 A;  1UC7 A;  3LXT A;  4GLT A;  2YN1 A;  5G31 A;  4GQC A;  1B9Y C;  5DAK A;  3UAR A;  1QGV A;  1EWX A;  4XS1 A;  1DUG A;  2C3T A;  1PMT A;  5AGY A;  3L78 A;  5G2Z A;  5GAN D;  4IQ1 A;  4KX4 A;  4PNG A;  1ZYE A;  2AV4 A;  1A2J A;  4V2M A;  18GS A;  5ECR B;  5AIV A;  2DJ3 A;  3GSS A;  5DVB A;  1Z9H A;  2HZE A;  2ZUP A;  3LXZ A;  4I5Q A;  2LKU A;  3KP9 A;  2FHE A;  1K3Y A;  2QC7 A;  3LFL A;  3TKR A;  12GS A;  4WET A;  3VI7 A;  3NZN A;  2LRC A;  5GAP D;  3FZ9 A;  3KIJ A;  3I9V 2;  1JLV A;  5INY A;  4POM A;  4IP6 A;  3L9S A;  2B1L A;  1TK0 B;  1EV4 A;  1XBS A;  4N10 A;  5J5N A;  4LL1 B;  1RW1 A;  1H4O A;  4OCE A;  4K6X A;  1OC8 A;  3EMX A;  1GSQ A;  2YAN A;  2IMI A;  1ABA A;  2ON5 A;  5DQS A;  3D21 A;  1Z6N A;  4KA0 A;  2WDU A;  3FR6 A;  2O7K A;  4K1F A;  3TOU A;  2NDO A;  4MH2 A;  2IPA A;  4MPG A;  3EPT A;  3UBK A;  3A5I A;  3MWH A;  1V98 A;  4MA9 A;  3TDG A;  4TXO A;  5KOW A;  3LWA A;  4NMU A;  2TRC P;  3GHA A;  4BVY A;  2HYX A;  4YKG A;  3IDV A;  4CDO A;  2UZ8 A;  2GZZ A;  4MDC A;  1B48 A;  1R26 A;  1TI3 A;  4KH7 A;  2PWJ A;  1SKR B;  1EGR A;  3F63 A;  4V2L A;  5CP1 A;  3F6F A;  5EPF A;  1FG4 A;  2MMO A;  2HI7 A;  2YJH A;  3ME7 A;  3DGQ A;  2MMN A;  3CRU A;  4FYC A;  2JSZ A;  1NHY A;  2WCI A;  3E0U A;  5KN0 A;  1WE0 A;  3EC3 A;  2H1B A;  2LJK A;  5ECQ B;  2R0P A;  2H76 A;  3FHK A;  5DAL A;  14GS A;  4BIK A;  3VLN A;  2PU9 C;  3F0I A;  1XCC A;  1S3D A;  1TDI A;  3E9J B;  1K0C A;  1G6W A;  17GS A;  1JFU A;  3IV4 A;  1SK2 A;  1TP9 A;  4XS4 B;  1YY7 A;  2FGX A;  2H1A A;  2YV9 A;  4F0C A;  5F06 A;  1ERT A;  3TJJ A;  3Q19 A;  4MJB A;  1HNC A;  2DLX A;  3KH9 A;  6GSY A;  2GSS A;  2ZNM A;  2BMX A;  2HSY A;  1FAA A;  3EVI A;  2WUL A;  4G9H A;  1S3A A;  3IC4 A;  1Z3E A;  2MBT A;  4MF6 A;  2O89 A;  4BWS A;  3IHQ A;  3RHB A;  2V2G A;  3APS A;  1XVQ A;  3S9F A;  4X1U A;  4HZ4 A;  3HD5 A;  1SL2 B;  2CX4 A;  2E0Q A;  3ZL5 A;  4ML6 A;  1TRS A;  2K6V A;  4LMW A;  1TRW A;  2LEG A;  4ZB8 A;  3KM6 A;  4AGS A;  1ACV A;  1ST9 A;  4DSQ A;  3WT2 A;  4O5R A;  3RHC A;  2DKH A;  2RUF A;  1KBN A;  2MBS A;  5DAK B;  1GUH A;  2HRK A;  2Z9S A;  4ZBB A;  1XW6 A;  4HUA A;  19GS A;  3CTG A;  2WGR A;  2H6Y A;  4XIH A;  3VK9 A;  5BRT A;  4TOP A;  1BED A;  5G5E A;  2C4J A;  5A5K A;  2RUE A;  4KE3 A;  2GVP A;  2VO4 A;  3HY2 A;  4POL A;  2OE3 A;  1W4V A;  4KCA A;  2GQM A;  5F07 A;  2HZE B;  1EEM A;  4Z2T A;  2LNS A;  2L59 A;  1YEX A;  4PXO A;  3F4R A;  2C1Y A;  1MDJ A;  2P31 A;  3C73 A;  2VCZ A;  4QQ7 A;  1U6T A;  3KMN A;  1MDK A;  4KDU A;  1QFN A;  4RQR A;  1U87 A;  2VOC A;  3O6T A;  3A2X A;  2FUG 2;  5JWQ B;  1TU7 A;  5DBQ A;  3EMP A;  4X4J A;  5ELG A;  4O7H A;  3WD6 A;  3FR9 A;  3IHG A;  1QXH A;  2F3M A;  4GXZ A;  7GSS A;  4IS0 A;  4G10 A;  4BPY A;  4OO4 A;  5CNW A;  4WR4 A;  3TJG A;  2K8V A;  1PKW A;  4PQ1 A;  2L6C A;  2R6K A;  1R4W A;  2FWG A;  2OA7 A;  4EIQ A;  4E8E A;  6GSW A;  1TK5 B;  1PSQ A;  5ECM B;  3IR4 A;  5G1L A;  1X5D A;  4HS1 A;  4TXO B;  1X9M B;  4X43 A;  2CZ3 A;  2C0F A;  2KP1 A;  3BD2 A;  4BVY B;  5HFK A;  3QFB C;  3TKS C;  1A8Y A;  5EVO A;  2OE0 A;  1THX A;  4GSN A;  4EC0 A;  1OC3 A;  2C0D A;  3TKP A;  3TRX A;  2L57 A;  1O6J A;  3RBT A;  1T4Z A;  3TJF A;  4ISD A;  1WIK A;  3L9U A;  2FLS A;  3J7Y b;  4PUR A;  4PQI A;  1TI1 A;  1F2E A;  1SD9 A;  1URM A;  2X4A A;  3BCK A;  2LQO A;  1SJ6 A;  1GNW A;  2JZT A;  5DAL B;  2VLT A;  4IBP A;  1IYI A;  1OKT A;  4E8H A;  3J7Y k;  5IMZ A;  3F3Q A;  1TU8 A;  2WRT A;  3EIN A;  2PBJ A;  5IO0 A;  1DBY A;  2I9H A;  2IIY A;  4MZC A;  1MD3 A;  4I6X A;  4KCE A;  3ZIT A;  3OR5 A;  2HLS A;  3UVT A;  10GS A;  4POK A;  1F9M A;  2F9S A;  2K18 A;  4TRX A;  1PL1 A;  3VUR A;  1ERW A;  4IEL A;  4YQU A;  2QA1 A;  5J41 A;  4WR5 A;  1EEJ A;  1M2D A;  2OKA A;  2VCV A;  4YAV A;  4I2T A;  5GSS A;  1O8W A;  5D73 A;  2WFC A;  4TR1 B;  2LV3 A;  2M80 A;  1XIY A;  1KNG A;  2JL4 A;  2CA8 A;  2X8G A;  1PL2 A;  1M2A A;  3LQ7 A;  4CHS A;  2FA8 A;  2MMZ A;  2CQ9 A;  2G2Q A;  3VWX A;  4YH2 A;  2N5B A;  1SD8 A;  3DRN A;  1OAZ A;  2G0F A;  2ON7 A;  4K5S A;  1GUL A;  3HZ4 A;  5E4W A;  3C8E A;  2IWT A;  4PQH A;  20GS A;  5IPG A;  2NVL A;  3HJP A;  1RQM A;  4I8B A;  3IE3 A;  4AF2 A;  3L4N A;  1GRX A;  2IMD A;  4WF4 A;  4RQX A;  3KCM A;  2A2S A;  2R5G A;  3L0H A;  3R2Q A;  4HJM A;  1XXU A;  4CW9 A;  4ZL7 A;  4TR4 A;  3FYG A;  1EP7 A;  9GSS A;  3GX8 A;  4DSS A;  1FHE A;  4V1A g;  3EE2 A;  3UJ1 A;  4EDY A;  5GZZ B;  1SL1 B;  2XC2 A;  1X0R A;  4TXV A;  1TJD A;  4XHM A;  1R5P A;  1EV9 A;  3GMF A;  3M9J A;  2FY6 A;  1ZZY A;  1Q98 A;  3CSH A;  4K7O A;  1BX9 A;  2AHE A;  3A3T A;  4JRR A;  3KMO A;  5IM9 A;  1I5G A;  1THO A;  1SKS B;  4V1A p;  4FYU A;  3ZVJ D;  5IOW A;  1GWC A;  1SEN A;  4HJ2 A;  3D5J A;  2VL2 A;  1SYX A;  4PGT A;  1PX6 A;  4O92 A;  4GRF A;  3PIN A;  3IOS A;  2HT9 A;  3W6G A;  4LL4 B;  4K5R A;  2PUK C;  2NPB A;  2QGV A;  3FZ5 A;  4LA1 A;  1TOF A;  1OKD A;  3G7J A;  4G0K A;  1V57 A;  1YEP A;  1AIU A;  2R0G A;  1SJZ A;  4G0I A;  3HVS A;  4MZB A;  4L5L A;  1XWA A;  5C04 A;  4IJI A;  1TK8 B;  3W8J A;  1YZX A;  1VRS D;  2DJ2 A;  2JU5 A;  2IFQ B;  2NTO A;  2YCD A;  1X9S B;  5IMC A;  3NOF A;  1AAZ A;  3KEB A;  1ZGN A;  2R4V A;  4FYB A;  2XBQ A;  3GV1 A;  4KB3 A;  4L8E A;  4J56 E;  1OE7 A;  2A4V A;  1XOB A;  2B3S A;  4A5P A;  4JR6 A;  2DIZ A;  1ON4 A;  2C0G A;  5IMA A;  4MLY A;  2IJY A;  4GQF A;  2I4A A;  3EU3 A;  4Z2U A;  1LU4 A;  4GCI A;  1XG8 A;  2TIR A;  4EXJ A;  2LRN A;  4MCU A;  5ABR A;  3CYN A;  1JLW A;  4BA7 A;  2VCX A;  3TKS A;  3ZMK A;  1X5C A;  2H70 A;  5IMV A;  1GP1 A;  3IK9 A;  1FO5 A;  1QQ2 A;  3ED3 A;  1OC9 A;  1HQO A;  3GH6 A;  4DSR A;  2J23 A;  3F4S A;  2R0C A;  3QPM A;  1ZYP A;  2B7K A;  3LJR A;  2LQQ A;  2YV7 A;  2VCQ A;  1K0M A;  4AJ7 A;  4GSS A;  3N9J A;  3QCP A;  4OFT A;  4LLR A;  5G1K A;  1ZMA A;  2RII A;  4ZXG A;  3HCZ A;  1NM3 A;  1BQ7 A;  4TKY A;  5G5F A;  1YKC A;  3GST A;  5HQP A;  3QR6 A;  4GST A;  4ULX A;  4MAB A;  1HNA A;  1SK1 A;  2TRX A;  3QFA C;  5F0G A;  3IXR A;  4F0B A;  1FOH A;  2FCH A;  1TW9 A;  1GSS A;  3KD0 A;  1C72 A;  1QK8 A;  5ENU A;  4G19 A;  4KUN A;  1U3A A;  4TW5 A;  2P5R A;  2C3N A;  2FNO A;  4JZQ A;  2DKI A;  2IMF A;  4XCS A;  1MTC A;  1WP0 A;  1R5A A;  5JCU A;  2DC5 A;  3IC8 A;  2KUC A;  2LUS A;  4TR0 A;  1GLP A;  3TB2 A;  2LJA A;  5ECL B;  3UEM A;  2GQK A;  4USS A;  5DDL A;  1ZYQ B;  1O73 A;  3M0F A;  5CYY A;  1FVJ A;  3GKM A;  2H75 A;  1SKW B;  5CAX A;  1VF3 A;  3LGC A;  2L5O A;  4EF0 A;  4XS6 A;  3ZFL A;  4N0Z A;  3TUE A;  1M2B A;  3FMW A;  4OWY A;  1XVW A;  2AUV A;  3GUR A;  1O7U A;  2VUP A;  4OD7 A;  1PX7 A;  4KF9 A;  3ME8 A;  1F3B A;  3GX0 A;  2VD0 A;  3AY8 A;  1CQH A;  2CAI A;  3PR8 A;  3PPU A;  4JE1 A;  3M1G A;  1YKA A;  1S3C A;  3M9K A;  1E6B A;  5IOX A;  2B6M A;  1LJR A;  2GZP A;  1ZL9 A;  2XPD A;  4MF7 A;  4V2N A;  3MAK A;  4JU5 A;  4WBJ A;  4XRD A;  3TJB A;  2YZU A;  3D6I A;  4NHW A;  4Z7X A;  5CRW A;  5B8B A;  4YKF A;  4N30 A;  3ZML A;  1DE2 A;  3D4T A;  1U3I A;  3H4K A;  2X64 A;  3O3T A;  4RI7 A;  2ALB A;  2DBC A;  2B5E A;  3M8N A;  4HDE A;  5HFG A;  5A4U A;  2RM5 A;  2L6D A;  4ACS A;  2VL3 A;  4ILF A;  4MH3 A;  4J2F A;  4OFM A;  2H71 A;  2H72 A;  4TR3 A;  3QAV A;  1VGL A;  4EE0 A;  4K0N A;  1J9B A;  4NAX A;  5ECK B;  3GTU A;  1Z6M A;  5E59 A;  4F2I A;  4MJE A;  1USB A;  3P90 A;  1YJ6 A;  3H79 A;  4PUA A;  1SU9 A;  3ZVJ A;  4OCF A;  4IVF A;  4FIW A;  1JZD A;  3HVV A;  1JZO A;  2LJR A;  13GS A;  2E7P A;  4ZL8 A;  2H1D A;  3H93 A;  3A2V A;  2V6K A;  1XW5 A;  1T7P B;  4PX1 A;  1GSF A;  5KN3 A;  3H8Q A;  3ZFB A;  3V1W A;  4ECC A;  1OC9 B;  3HJM A;  5CRD A;  2MMA A;  1SJI A;  4I97 A;  5J3R A;  1K0N A;  5J9B A;  1M3J A;  2HSH A;  2B1K A;  1R7H A;  1G6Y A;  3DML A;  3WYW A;  3QD9 A;  2YPM A;  1FVK A;  1XW9 A;  3GH9 A;  1NHO A;  3IRA A;  4N0V A;  2GSQ A;  5LNK e;  2GZY A;  2H6Z A;  1N8J A;  1M99 A;  1VF2 A;  3TCO A;  3IAS 2;  5F05 A;  4AJ8 A;  4HZ2 A;  3QMX A;  5A4W A;  4HOJ A;  1T00 A;  1KTE A;  3WT1 A;  1A23 A;  1F3A A;  2AAW A;  4K2D A;  4MF5 A;  1XWB A;  3CBU A;  1ZCP A;  2X49 A;  4EKZ A;  2C8U A;  2K8S A;  3HVN A;  4J57 E;  2H30 A;  2L5L A;  4GTU A;  1M0U A;  3N5O A;  3BCI A;  3HA9 A;  1YF1 A;  4XTS A;  3GL3 A;  3GIX A;  1WWJ A;  4H86 A;  4FH8 A;  3DKS A;  4KAE A;  3M3M A;  4ZB9 A;  5F8B A;  4JR4 A;  1MDI A;  4IW9 A;  5AIX A;  4IGJ A;  3CXG A;  4IN0 A;  2PVQ A;  1GLQ A;  2M46 A;  3PH9 A;  3APQ A;  3CQF A;  1V40 A;  3MDK A;  1E2Y A;  3C71 A;  3HJO A;  2PN8 A;  2WB9 A;  3A2W A;  3ZZX A;  3MNG A;  1EP8 A;  1G0T A;  3BOA A;  3VPQ A;  1VF4 A;  1FOV A;  4NV2 A;  6GSS A;  3ZYW A;  4YAP A;  3DD3 A;  3HXS A;  2VM2 A;  2X8C A;  1A24 A;  3G9B A;  5HR1 A;  4KDY A;  1GUM A;  2GS3 A;  4IJ3 A;  3MSZ A;  2YWN A;  1B4Q A;  4HI7 A;  2H66 A;  2OBI A;  5IO2 A;  4MPF A;  4P3Y B;  3F9U A;  4EUY A;  4BL7 A;  2EIR A;  2H6X A;  5HR2 A;  2A2R A;  1EGO A;  1XPV A;  2EIQ A;  1B9X C;  2GST A;  4X0X A;  1TTZ A;  4Q5Q A;  3KXO A;  2ES7 A;  3CRT A; 
#chains in the Genus database with same CATH homology
 5DCH A;  1MEK A;  5G30 A;  2O85 A;  4ZBA A;  3EU4 A;  4RUV A;  1Y6E A;  4ZL9 A;  3UMA A;  4K7I A;  2YJ7 A;  4K2X A;  1WMJ A;  6GST A;  1XOA A;  4ZIJ A;  1UN2 A;  2WZ9 A;  5DQY A;  1EOG A;  1FW1 A;  3IAM 2;  3GTU B;  1O8X A;  3RDW A;  4JBB A;  3KP8 A;  3HKR A;  4BWQ A;  5J9C A;  4WF5 A;  3QAG A;  3U6V A;  3ZTL A;  3LYK A;  1GSE A;  3I43 A;  3P2A A;  1X9W B;  3TKQ A;  2D2Z A;  1AQW A;  1PKZ A;  2VD1 A;  4WXT A;  2VL9 A;  3IA1 A;  2HRN A;  2PPT A;  5FWG A;  3UIW A;  3KH7 A;  5ECN B;  4XS4 A;  4KW6 A;  2H8L A;  2LST A;  5D9W A;  1U88 A;  4KSM A;  4Q5F A;  1NW2 A;  3IPZ A;  3G7I A;  2EC4 A;  4OMV A;  2GLR A;  1F37 A;  2DIY A;  1QUW A;  2V41 A;  4AJ6 A;  3U5R E;  3P8W A;  3ERG A;  1EZK A;  2GDR A;  3A5W A;  5D9X A;  1G7E A;  4NPB A;  1RK4 A;  3FR3 A;  2YWO A;  2N5A A;  3FEU A;  2YOI A;  2YZH A;  4BVX A;  5ECS A;  3GL5 A;  3UBL A;  3ZRD A;  2R2J A;  3CMI A;  2VCW A;  2N5F A;  5D8I A;  3FW2 A;  1ZYN A;  2FA4 A;  4CY8 A;  3GKN A;  3VWV A;  2HFD A;  3C7M A;  4NHZ A;  1XZO A;  3ZIJ A;  2M72 A;  2VIM A;  1PD2 1;  5ID2 A;  1A2L A;  2AJQ B;  3TRP A;  1WOU A;  1AUC A;  2PMT A;  4DEJ A;  1PN0 A;  5DCG A;  3HVX A;  3C1R A;  1FB0 A;  3Q74 A;  2CZ2 A;  4HEA 2;  1GTB A;  3LOR A;  3DEX A;  3KZQ A;  2DSA A;  2KOK A;  3HZ8 A;  2CT6 A;  1PQN A;  4O5Q A;  1Q4J A;  4F82 A;  3FK8 A;  3W8S A;  4PNF A;  4HU7 A;  1T1V A;  3P7X A;  1YDK A;  1BJX A;  1GNE A;  3DVX A;  4ZBD A;  4FO5 A;  1Y25 A;  3I69 A;  4TN8 A;  2JZS A;  2PVO C;  4HQS A;  2KLX A;  1K3L A;  2CX3 A;  4POB A;  2H0H A;  1O85 A;  4DVC A;  1W89 A;  3GKK A;  5JWO B;  1PA3 A;  3GKX A;  1NSW A;  3CSJ A;  4OO5 A;  6GSU A;  4BL7 B;  4G2E A;  1LBK A;  5IIZ A;  1GTU A;  4WKW A;  2CVD A;  3KGK A;  16GS A;  3GYK A;  1FB6 A;  2WS2 A;  1XWG A;  1UVZ A;  2BJX A;  1ERV A;  3TGZ A;  5CRH A;  5ECO B;  2REM A;  3GN3 A;  5HR0 A;  4Z2R A;  2DML A;  2JAC A;  3D22 A;  5EY6 A;  2HZF A;  2AYT A;  4D73 A;  2MZC A;  2KP2 A;  1B4P A;  3GNJ A;  1BAY A;  3DXB A;  8GSS A;  5IQY A;  1KEB A;  2NBS A;  1ZOF A;  3IK7 A;  4K8M A;  1WRY A;  5B6M A;  3GRX A;  1A0F A;  2FWE A;  1V2A A;  4DSS B;  2H19 A;  1Z7R A;  3R3E A;  1HNB A;  1IYH A;  1TXX A;  4HU9 A;  4L0U A;  5D96 A;  1OVN A;  3BBY A;  3KTB A;  3PGT A;  4EVM A;  3DYR A;  2JAD A;  4O32 A;  3CTF A;  3I6A A;  3VI5 A;  1QMV A;  1G7O A;  4ML1 A;  4ZIL A;  2VM1 A;  3GA4 A;  4IKH A;  2L4Q A;  2V1M A;  4O5U A;  3KTL A;  5B7C A;  2R3X A;  4QL7 A;  3WGD A;  2HRA A;  2GT5 A;  1T4Y A;  2JSY A;  4NWY A;  5LCZ A;  2RLI A;  3LSZ A;  2P0G A;  3FZA A;  2A4H A;  4LMV A;  1WPI A;  5A4V A;  4NXI A;  2E2G A;  2AB6 A;  1TRV A;  3RPN A;  5BMU A;  1HD2 A;  4GWR A;  3E3E A;  1MD4 A;  2HNL A;  3TKS E;  3EWL A;  3G7Y A;  4MZW A;  1Z7P A;  4EO3 A;  4N11 A;  4MP4 A;  4BVX B;  11GS A;  3QDN A;  3LYP A;  2P5Q A;  1K0A A;  5L71 A;  1OYJ A;  4TR1 A;  4GF0 A;  1SK0 A;  3JCM L;  2V32 A;  6GSX A;  2PGT A;  3BJ5 A;  3UVH A;  1JZR A;  1PN9 A;  3GUS A;  3Q6O A;  2VLV A;  2O8V B;  2X8H A;  1M7T A;  4NV5 A;  4Q5N A;  4MJA A;  5JCW A;  2B5Y A;  1V58 A;  3HDC A;  2YWI A;  3KJY A;  3LG6 A;  4CY6 A;  5ID2 B;  6GSV A;  1PGT A;  1GUK A;  1K0D A;  3SWL A;  3DWV A;  1K0O A;  2DJJ A;  4WBR D;  2LNT A;  4L0W A;  2XPE A;  2O87 A;  4MK3 A;  5D9V A;  3FZ4 A;  1ML6 A;  5HFI A;  4EDZ A;  2F51 A;  2IN3 A;  1JHB A;  2DJ1 A;  2L4C A;  3ZLP A;  2OBK A;  2DJ0 A;  1T8E B;  5C00 A;  5B8A A;  1XWK A;  1M9A A;  3ERF A;  3VFI A;  1TKD B;  3D0Z A;  1J08 A;  3DVW A;  2VL2 C;  3RPP A;  2IL3 A;  3SBC A;  3TJK A;  2EIO A;  3Q18 A;  1J0F A;  2VCT A;  2VAF A;  2VLU A;  1OE8 A;  4QL9 A;  3L9V A;  1A8L A;  1GSD A;  1N2A A;  2HRF A;  2XHF A;  2QKE A;  2KHP A;  2R37 A;  4I2U A;  4YQM A;  2H01 A;  5KOX A;  5JCG A;  2YNX A;  2C80 A;  5GST A;  1JZW A;  5ECH B;  2BTO T;  4YQV A;  2H73 A;  2HXK A;  2OJL A;  3QAW A;  2DJK A;  3WGE A;  2V6O A;  1SYR A;  2H1G A;  4ZB6 A;  4PTS A;  1ERU A;  4EL1 A;  3FY7 A;  5EL8 A;  3QOU A;  4D73 B;  2CVK A;  2H0I A;  4Q5R A;  5KEJ A;  5FHI A;  3FRC A;  5H5Q A;  2B7J A;  1DSB A;  2X99 A;  4IP1 A;  4XRA A;  2IFQ A;  2CVB A;  1AXD A;  1XFL A;  2LTK A;  5ECP B;  2WJU A;  4ECB A;  1CQG A;  4F9Z A;  3F3R A;  5D9T A;  2GGT A;  4RI6 A;  5AIS A;  1AQV A;  3H1N A;  3GFK A;  4IHU A;  4ECJ A;  5KN1 A;  4WEY A;  2HE3 A;  4MMM A;  4ID0 A;  1SL0 B;  2MYG A;  3US3 A;  3FKF A;  1GSU A;  22GS A;  4ICY A;  1H75 A;  1WJK A;  5AN1 A;  2I1U A;  1M9B A;  3CSI A;  1GSY A;  4OFN A;  3F8U A;  2F8F A;  3MIX A;  4F03 A;  1GTI A;  2JZR A;  5KN2 A;  1EOH A;  1PRX A;  3TOT A;  2E2M A;  2C0E A;  5D93 A;  3ERW A;  2CV4 A;  5CRG A;  3WGX A;  3MYD A;  3DIE A;  3VPT A;  3EUR A;  3EYT A;  3RAZ A;  1X5E A;  4KSO A;  1B8X A;  4MNN A;  1AQX A;  2RM6 A;  4L5O A;  5DJM A;  5IMF A;  3NIV A;  3D4M A;  4ECI A;  2J9H A;  2LS5 A;  3ISO A;  1DE1 A;  3K8N A;  5JWR B;  2HSM A;  2PER A;  4IQA A;  2ZCT A;  2YP6 A;  5FT3 A;  1GL8 A;  1AW9 A;  1T3B A;  3HHV A;  3LEF A;  1XWC A;  1UA5 A;  2B5X A;  2FWH A;  5DJL A;  5LD0 A;  5B6N A;  4JED A;  1YQ1 A;  5CRE A;  5CO3 A;  5IPH A;  2XBI A;  4TVE A;  5ELA A;  3ZRE A;  3HYP A;  2FWF A;  2LRT A;  3C1S A;  4MJC A;  2H74 A;  5ECI B;  5IMD A;  1HYU A;  2K9F A;  4KDX A;  2I3Y A;  2CAQ A;  3F6D A;  2H0G A;  5HR3 A;  2FD3 A;  2C3Q A;  1K0B A;  5COH A;  5J4U A;  2GSR A;  1AC1 A;  1A0R P;  1GH2 A;  3F4T A;  2A2P A;  4KND A;  4KGI A;  2GT6 A;  2YWM A;  3IBH A;  2F8A A;  2GTU A;  3UL3 A;  4EIP A;  3LW9 A;  4FQU A;  5H5R A;  2QSI A;  3O76 A;  1YF0 A;  4HQZ A;  3VWU A;  1I9D A;  1VF1 A;  2OAD A;  2DMM A;  1TRU A;  4G0L A;  4PUF C;  2QA2 A;  3TRQ A;  1GTA A;  1A2M A;  3UOM A;  2IME A;  1K3O A;  1F6M C;  2OE1 A;  1ILO A;  1V9W A;  3VWW A;  4K0G A;  5H5S A;  3UAP A;  2OAC A;  1BG5 A;  2IMK A;  1BYE A;  2I81 A;  4K7N A;  4K9Z A;  1Z5Y E;  2GQL A;  3ZIV A;  3APO A;  1O81 A;  1UC7 A;  3LXT A;  4GLT A;  2YN1 A;  5G31 A;  4GQC A;  1B9Y C;  5DAK A;  3UAR A;  1QGV A;  1EWX A;  4XS1 A;  1DUG A;  2C3T A;  1PMT A;  5AGY A;  3L78 A;  5G2Z A;  5GAN D;  4IQ1 A;  4KX4 A;  4PNG A;  1ZYE A;  2AV4 A;  1A2J A;  4V2M A;  18GS A;  5ECR B;  5AIV A;  2DJ3 A;  3GSS A;  5DVB A;  1Z9H A;  2HZE A;  2ZUP A;  3LXZ A;  4I5Q A;  2LKU A;  3KP9 A;  2FHE A;  1K3Y A;  2QC7 A;  3LFL A;  3TKR A;  12GS A;  4WET A;  3VI7 A;  3NZN A;  2LRC A;  5GAP D;  3FZ9 A;  3KIJ A;  3I9V 2;  1JLV A;  5INY A;  4POM A;  4IP6 A;  3L9S A;  2B1L A;  1TK0 B;  1EV4 A;  1XBS A;  4N10 A;  5J5N A;  4LL1 B;  1RW1 A;  1H4O A;  4OCE A;  4K6X A;  1OC8 A;  3EMX A;  1GSQ A;  2YAN A;  2IMI A;  1ABA A;  2ON5 A;  5DQS A;  3D21 A;  1Z6N A;  4KA0 A;  2WDU A;  3FR6 A;  2O7K A;  4K1F A;  3TOU A;  2NDO A;  4MH2 A;  2IPA A;  4MPG A;  3EPT A;  3UBK A;  3A5I A;  3MWH A;  1V98 A;  4MA9 A;  3TDG A;  4TXO A;  5KOW A;  3LWA A;  4NMU A;  2TRC P;  3GHA A;  4BVY A;  2HYX A;  4YKG A;  3IDV A;  4CDO A;  2UZ8 A;  2GZZ A;  4MDC A;  1B48 A;  1R26 A;  1TI3 A;  4KH7 A;  2PWJ A;  1SKR B;  1EGR A;  3F63 A;  4V2L A;  5CP1 A;  3F6F A;  5EPF A;  1FG4 A;  2MMO A;  2HI7 A;  2YJH A;  3ME7 A;  3DGQ A;  2MMN A;  3CRU A;  4FYC A;  2JSZ A;  1NHY A;  2WCI A;  3E0U A;  5KN0 A;  1WE0 A;  3EC3 A;  2H1B A;  2LJK A;  5ECQ B;  2R0P A;  2H76 A;  3FHK A;  5DAL A;  14GS A;  3VLN A;  2PU9 C;  3F0I A;  1XCC A;  1S3D A;  1TDI A;  3E9J B;  1K0C A;  1G6W A;  17GS A;  1JFU A;  3IV4 A;  1SK2 A;  1TP9 A;  4XS4 B;  1YY7 A;  2FGX A;  2H1A A;  2YV9 A;  4F0C A;  5F06 A;  1ERT A;  3TJJ A;  3Q19 A;  4MJB A;  1HNC A;  2DLX A;  3KH9 A;  6GSY A;  2GSS A;  2ZNM A;  2BMX A;  2HSY A;  1FAA A;  3EVI A;  2WUL A;  4G9H A;  1S3A A;  3IC4 A;  1Z3E A;  2MBT A;  4MF6 A;  2O89 A;  4BWS A;  3IHQ A;  3RHB A;  2V2G A;  3APS A;  1XVQ A;  3S9F A;  4X1U A;  4HZ4 A;  3HD5 A;  1SL2 B;  2CX4 A;  2E0Q A;  3ZL5 A;  4ML6 A;  1TRS A;  2K6V A;  4LMW A;  1TRW A;  2LEG A;  4ZB8 A;  3KM6 A;  4AGS A;  1ACV A;  1ST9 A;  4DSQ A;  3WT2 A;  4O5R A;  3RHC A;  2DKH A;  2RUF A;  1KBN A;  2MBS A;  5DAK B;  1GUH A;  2HRK A;  2Z9S A;  4ZBB A;  1XW6 A;  4HUA A;  19GS A;  3CTG A;  2WGR A;  2H6Y A;  4XIH A;  3VK9 A;  5BRT A;  4TOP A;  1BED A;  5G5E A;  2C4J A;  5A5K A;  2RUE A;  4KE3 A;  2GVP A;  2VO4 A;  3HY2 A;  4POL A;  2OE3 A;  1W4V A;  4KCA A;  2GQM A;  5F07 A;  2HZE B;  1EEM A;  4Z2T A;  2LNS A;  2L59 A;  1YEX A;  4PXO A;  3F4R A;  2C1Y A;  1MDJ A;  2P31 A;  3C73 A;  2VCZ A;  4QQ7 A;  1U6T A;  3KMN A;  1MDK A;  4KDU A;  1QFN A;  4RQR A;  1U87 A;  2VOC A;  3O6T A;  3A2X A;  2FUG 2;  5JWQ B;  1TU7 A;  5DBQ A;  3EMP A;  4X4J A;  5ELG A;  4O7H A;  3WD6 A;  3FR9 A;  3IHG A;  1QXH A;  2F3M A;  4GXZ A;  7GSS A;  4IS0 A;  4G10 A;  4BPY A;  4OO4 A;  5CNW A;  4WR4 A;  3TJG A;  2K8V A;  1PKW A;  4PQ1 A;  2L6C A;  2R6K A;  1R4W A;  2FWG A;  2OA7 A;  4EIQ A;  4E8E A;  6GSW A;  1TK5 B;  1PSQ A;  5ECM B;  3IR4 A;  5G1L A;  1X5D A;  4HS1 A;  4TXO B;  1X9M B;  4X43 A;  2CZ3 A;  2C0F A;  2KP1 A;  3BD2 A;  4BVY B;  5HFK A;  3QFB C;  3TKS C;  1A8Y A;  5EVO A;  2OE0 A;  1THX A;  4GSN A;  4EC0 A;  1OC3 A;  2C0D A;  3TKP A;  3TRX A;  2L57 A;  1O6J A;  3RBT A;  1T4Z A;  3TJF A;  4ISD A;  1WIK A;  3L9U A;  2FLS A;  3J7Y b;  4PUR A;  4PQI A;  1TI1 A;  1F2E A;  1SD9 A;  1URM A;  2X4A A;  3BCK A;  2LQO A;  1SJ6 A;  1GNW A;  2JZT A;  5DAL B;  2VLT A;  4IBP A;  1IYI A;  1OKT A;  4E8H A;  3J7Y k;  5IMZ A;  3F3Q A;  1TU8 A;  2WRT A;  3EIN A;  2PBJ A;  5IO0 A;  1DBY A;  2I9H A;  2IIY A;  4MZC A;  1MD3 A;  4I6X A;  4KCE A;  3ZIT A;  3OR5 A;  2HLS A;  3UVT A;  10GS A;  4POK A;  1F9M A;  2F9S A;  2K18 A;  4TRX A;  1PL1 A;  3VUR A;  1ERW A;  4IEL A;  4YQU A;  2QA1 A;  5J41 A;  4WR5 A;  1EEJ A;  1M2D A;  2OKA A;  2VCV A;  4YAV A;  4I2T A;  5GSS A;  1O8W A;  5D73 A;  2WFC A;  4TR1 B;  2LV3 A;  2M80 A;  1XIY A;  1KNG A;  2JL4 A;  2CA8 A;  2X8G A;  1PL2 A;  1M2A A;  3LQ7 A;  4CHS A;  2FA8 A;  2MMZ A;  2CQ9 A;  2G2Q A;  3VWX A;  4YH2 A;  2N5B A;  1SD8 A;  3DRN A;  1OAZ A;  2G0F A;  2ON7 A;  4K5S A;  1GUL A;  3HZ4 A;  5E4W A;  3C8E A;  2IWT A;  4PQH A;  20GS A;  5IPG A;  2NVL A;  3HJP A;  1RQM A;  4I8B A;  3IE3 A;  4AF2 A;  3L4N A;  1GRX A;  2IMD A;  4WF4 A;  4RQX A;  3KCM A;  2A2S A;  2R5G A;  3L0H A;  3R2Q A;  4HJM A;  1XXU A;  4CW9 A;  4ZL7 A;  4TR4 A;  3FYG A;  1EP7 A;  9GSS A;  3GX8 A;  4DSS A;  1FHE A;  4V1A g;  3EE2 A;  3UJ1 A;  4EDY A;  5GZZ B;  1SL1 B;  2XC2 A;  1X0R A;  4TXV A;  1TJD A;  4XHM A;  1R5P A;  1EV9 A;  3GMF A;  3M9J A;  2FY6 A;  1ZZY A;  1Q98 A;  3CSH A;  4K7O A;  1BX9 A;  2AHE A;  3A3T A;  4JRR A;  3KMO A;  5IM9 A;  1I5G A;  1THO A;  1SKS B;  4V1A p;  4FYU A;  3ZVJ D;  5IOW A;  1GWC A;  1SEN A;  4HJ2 A;  3D5J A;  2VL2 A;  1SYX A;  4PGT A;  1PX6 A;  4O92 A;  4GRF A;  3PIN A;  3IOS A;  2HT9 A;  3W6G A;  4LL4 B;  4K5R A;  2PUK C;  2NPB A;  2QGV A;  3FZ5 A;  4LA1 A;  1TOF A;  1OKD A;  3G7J A;  4G0K A;  1V57 A;  1YEP A;  1AIU A;  2R0G A;  1SJZ A;  4G0I A;  3HVS A;  4MZB A;  4L5L A;  1XWA A;  5C04 A;  4IJI A;  1TK8 B;  3W8J A;  1YZX A;  1VRS D;  2DJ2 A;  2JU5 A;  2IFQ B;  2NTO A;  2YCD A;  1X9S B;  5IMC A;  3NOF A;  1AAZ A;  3KEB A;  1ZGN A;  2R4V A;  4FYB A;  2XBQ A;  3GV1 A;  4KB3 A;  4L8E A;  4J56 E;  1OE7 A;  2A4V A;  1XOB A;  2B3S A;  4A5P A;  4JR6 A;  2DIZ A;  1ON4 A;  2C0G A;  5IMA A;  4MLY A;  2IJY A;  4GQF A;  2I4A A;  3EU3 A;  4Z2U A;  1LU4 A;  4GCI A;  2TIR A;  4EXJ A;  2LRN A;  4MCU A;  5ABR A;  3CYN A;  1JLW A;  4BA7 A;  2VCX A;  3TKS A;  3ZMK A;  1X5C A;  2H70 A;  5IMV A;  1GP1 A;  3IK9 A;  1FO5 A;  1QQ2 A;  3ED3 A;  1OC9 A;  1HQO A;  3GH6 A;  4DSR A;  2J23 A;  3F4S A;  2R0C A;  3QPM A;  1ZYP A;  2B7K A;  3LJR A;  2LQQ A;  2YV7 A;  2VCQ A;  1K0M A;  4AJ7 A;  4GSS A;  3N9J A;  3QCP A;  4OFT A;  4LLR A;  5G1K A;  1ZMA A;  2RII A;  4ZXG A;  3HCZ A;  1NM3 A;  1BQ7 A;  4TKY A;  5G5F A;  1YKC A;  3GST A;  5HQP A;  3QR6 A;  4GST A;  4ULX A;  4MAB A;  1HNA A;  1SK1 A;  2TRX A;  3QFA C;  5F0G A;  3IXR A;  4F0B A;  1FOH A;  2FCH A;  1TW9 A;  1GSS A;  3KD0 A;  1C72 A;  1QK8 A;  5ENU A;  4G19 A;  4KUN A;  1U3A A;  4TW5 A;  2P5R A;  2C3N A;  2FNO A;  4JZQ A;  2DKI A;  2IMF A;  4XCS A;  1MTC A;  1WP0 A;  1R5A A;  5JCU A;  2DC5 A;  3IC8 A;  2KUC A;  2LUS A;  4TR0 A;  1GLP A;  3TB2 A;  2LJA A;  5ECL B;  3UEM A;  2GQK A;  4USS A;  5DDL A;  1ZYQ B;  1O73 A;  3M0F A;  5CYY A;  1FVJ A;  3GKM A;  2H75 A;  1SKW B;  5CAX A;  1VF3 A;  3LGC A;  2L5O A;  4EF0 A;  4XS6 A;  3ZFL A;  4N0Z A;  3TUE A;  1M2B A;  3FMW A;  4OWY A;  1XVW A;  2AUV A;  3GUR A;  1O7U A;  2VUP A;  4OD7 A;  1PX7 A;  4KF9 A;  3ME8 A;  1F3B A;  3GX0 A;  2VD0 A;  3AY8 A;  1CQH A;  2CAI A;  3PR8 A;  3PPU A;  4JE1 A;  3M1G A;  1YKA A;  1S3C A;  3M9K A;  1E6B A;  5IOX A;  2B6M A;  1LJR A;  2GZP A;  1ZL9 A;  2XPD A;  4MF7 A;  4V2N A;  3MAK A;  4JU5 A;  4WBJ A;  4XRD A;  3TJB A;  2YZU A;  3D6I A;  4NHW A;  4Z7X A;  5CRW A;  5B8B A;  4YKF A;  4N30 A;  3ZML A;  1DE2 A;  3D4T A;  1U3I A;  3H4K A;  2X64 A;  3O3T A;  4RI7 A;  2ALB A;  2DBC A;  2B5E A;  3M8N A;  4HDE A;  5HFG A;  5A4U A;  2RM5 A;  2L6D A;  4ACS A;  2VL3 A;  4ILF A;  4MH3 A;  4J2F A;  4OFM A;  2H71 A;  2H72 A;  4TR3 A;  3QAV A;  1VGL A;  4EE0 A;  4K0N A;  1J9B A;  4NAX A;  5ECK B;  3GTU A;  1Z6M A;  5E59 A;  4F2I A;  4MJE A;  1USB A;  3P90 A;  1YJ6 A;  3H79 A;  4PUA A;  1SU9 A;  3ZVJ A;  4OCF A;  4IVF A;  4FIW A;  1JZD A;  3HVV A;  1JZO A;  2LJR A;  13GS A;  2E7P A;  4ZL8 A;  2H1D A;  3H93 A;  3A2V A;  2V6K A;  1XW5 A;  1T7P B;  4PX1 A;  1GSF A;  5KN3 A;  3H8Q A;  3ZFB A;  3V1W A;  4ECC A;  1OC9 B;  3HJM A;  5CRD A;  2MMA A;  1SJI A;  4I97 A;  5J3R A;  1K0N A;  5J9B A;  2HSH A;  2B1K A;  1R7H A;  1G6Y A;  3DML A;  3WYW A;  3QD9 A;  2YPM A;  1FVK A;  1XW9 A;  3GH9 A;  1NHO A;  3IRA A;  4N0V A;  2GSQ A;  5LNK e;  2GZY A;  2H6Z A;  1N8J A;  1M99 A;  1VF2 A;  3TCO A;  3IAS 2;  5F05 A;  4AJ8 A;  4HZ2 A;  3QMX A;  5A4W A;  4HOJ A;  1T00 A;  1KTE A;  3WT1 A;  1A23 A;  1F3A A;  2AAW A;  4K2D A;  4MF5 A;  1XWB A;  3CBU A;  1ZCP A;  2X49 A;  4EKZ A;  2C8U A;  2K8S A;  4J57 E;  2H30 A;  2L5L A;  4GTU A;  1M0U A;  3N5O A;  3BCI A;  3HA9 A;  1YF1 A;  4XTS A;  3GL3 A;  3GIX A;  1WWJ A;  4H86 A;  4FH8 A;  3DKS A;  4KAE A;  3M3M A;  4ZB9 A;  5F8B A;  4JR4 A;  1MDI A;  4IW9 A;  5AIX A;  4IGJ A;  3CXG A;  4IN0 A;  2PVQ A;  1GLQ A;  2M46 A;  3PH9 A;  3APQ A;  1V40 A;  3MDK A;  1E2Y A;  3C71 A;  3HJO A;  2PN8 A;  2WB9 A;  3A2W A;  3ZZX A;  3MNG A;  1EP8 A;  1G0T A;  3BOA A;  3VPQ A;  1VF4 A;  1FOV A;  4NV2 A;  6GSS A;  3ZYW A;  4YAP A;  3DD3 A;  3HXS A;  2VM2 A;  2X8C A;  1A24 A;  3G9B A;  5HR1 A;  4KDY A;  1GUM A;  2GS3 A;  4IJ3 A;  3MSZ A;  2YWN A;  1B4Q A;  4HI7 A;  2H66 A;  2OBI A;  5IO2 A;  4MPF A;  4P3Y B;  3F9U A;  4EUY A;  4BL7 A;  2EIR A;  2H6X A;  5HR2 A;  2A2R A;  1EGO A;  1XPV A;  2EIQ A;  1B9X C;  2GST A;  4X0X A;  1TTZ A;  4Q5Q A;  3KXO A;  2ES7 A;  3CRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...