2KOQA

Nmr solution structures of 3-hydroxyoctanoyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
molecule keywords Acyl carrier protein
total genus 24
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2koqA00
2KORA 2M5RA 1X3OA 2KGCA 2KW2A 1T8KA 2FACA 2KWLA 1NQ4A 2PNGA 4DG9A 3EJDA 2DNWA 4CA3A 4HKGA 2MVUA 2LPKA 2K94A 3GZLA 2K0YA 2LIUA 2KG8A 2N98A 4BPHA 2FQ0A 3EJBA 5HVCA 2XZ1C 4PXHB 2KOOA 4R0MA 3CE7A 2KG6A 2MVVA 1KLPA 2LTEA 2L0QA 2FVAA 2LKIA 2N50A 4NEOA 2JU1A 2N6YA 2CQ8A 2N5HA 1DNYA 3LMOA 2KR5A 2JQ4A 2KOSA 1L0HA 2FVFA 5KP8B 4H2YC 2JGPA 2X2BA 1L0IA 2MR8A 1HQBA 4H2WC 5KP6B 2KOQA 3GZMA 2LIWA 1F80D 1ACPA 1DV5A 1HY8A 2KGEA 4PWVB 2L9FA 4BPGA 4MRTC 2MR7A 2AFEA 2KOPA 2K0XA 2LL8A 2GDXA 2AVAA 2MD9A 2XZ0D 1AF8A 2GDYA 2FVEA 5KP7B 5CZDB 2AF8A 2GDWA 2LMLA 1VKUA 4BPFA 2VSQA 2ROQA 2KGAA 2JU2A 2AFDA 2FAEA 2QNWA 3EJEA 2FQ2A 2K93A 5EJDA 2K2QA 2CNRA 2L4BA 2KGDA 1OR5A 2LOLA 2FHSC 4IZ6A 2CG5B 2L22A 4H2XC 5HV8A 3NY7B 2KG9A 2EHTA 2FADA 2EHSA 2FQ1A 2MF4A 2MY5A 2N6ZA 2N5IA 3RG2A 2CGQA 2K92A
chains in the Genus database with same CATH superfamily
1VQLP 5F2NA 7CEIA 1M6EX 2NO8A 2KW2A 1T8KA 3GJNA 1NQ4A 5HGMA 1YJNP 3DPHA 4XFZA 3GZLA 4F37A 2LIUA 2M8NA 3EJBA 1FR2A 4R0MA 1Q82Q 2K5XA 2LTEA 5HGNA 1KLPA 2L0QA 1MZ8A 2ONTA 4XROA 3VRLC 4NEOA 1YJWP 2PEMA 3LMOA 3B4QA 5HGLA 1NJIQ 1M6NA 1L0HA 2FVFA 2JGPA 1VQ9P 2Z46A 4H2WC 3B5IA 2JBGA 3CCEP 1ACPA 1DV5A 2KGEA 2VLNA 3G26A 4BPGA 4MRTC 1VQNP 2GZJA 2OARA 4COCA 2GDYA 2LMLA 2ROQA 3RG6C 2KGAA 2L6EA 2XXMA 1N8RQ 5EJDA 2VLPA 1K8AQ 1BAJA 2PEQA 2PY8A 2CG5B 1VQPP 3HYBA 2BUOA 3OW2O 1KC8Q 1UNKA 2BHVA 3G29A 2CGQA 2K92A 1K30A 2KORA 2ERHA 2GYKA 1VQKP 2KGCA 5F2KA 2FACA 2GZFA 1AUMA 3EJDA 2DNWA 3G6EP 4XFYA 4HKGA 4U0FA 4GR6A 1GXHA 2KG8A 2N98A 1QVGO 3CCSP 3CC7P 3CC2P 1IUQA 5HVCA 3G0VA 5DCKA 5EW5E 1Q86Q 2K0DX 3G1GA 2N50A 2JYGA 1KD1Q 3H47A 1VQOP 1E6JP 2KR5A 1YI2P 1RNIA 2KOSA 1M74A 5KP8B 1JJ2O 4U0CA 3MGEA 1HQBA 1F80D 3HZQA 1QRJA 4QNBA 1HY8A 2L9FA 3M1MA 2P9XA 1K73Q 1UJZA 3CCUP 1EIAA 2VLQA 2AVAA 2XZ0D 2FVEA 2AF8A 1A43A 4COPA 2VSQA 3H0DA 4U0EA 2AFDA 2VLOA 5JPAA 2K93A 3CMAP 2OTLP 2EG5A 2K2QA 2CNRA 2EIAA 1OR5A 2LOLA 3WBHA 2Z44A 3G4SP 3CD6P 2PEJA 1GXGA 4H2XC 1A8OA 5HV8A 3CPWO 2KG9A 2FADA 1YIJP 3P05A 3RG2A 3DS0A 1X3OA 2QEXP 2KWLA 3I56P 1ZNVA 4XFXA 4DG9A 3H4EA 1ZMBA 1IMQA 1RO0A 2LPKA 1RO2A 2K94A 1BXIA 4U0DA 2WPTA 1IMPA 4BPHA 2FQ0A 4U0AA 2JB0A 1EOQA 1AYIA 3I55P 2KG6A 4U0BA 2JYLA 2FVAA 2LKIA 3G21A 2M8PA 2JU1A 2N6YA 4PH0A 2N5HA 3DTJA 1CEIA 1Q7YQ 3CCRP 1D1DA 5BS1A 1L0IA 2OTJP 2GZIA 2KOQA 3GZMA 4PWVB 3G28A 4WYMA 1E0HA 4QKOA 2KOPA 2QA4P 1VHNA 2GDXA 2GZGA 1YJ9P 1AF8A 3U43A 5CZDB 3CCVP 4UHPB 4BPFA 3DS1A 5F2OA 2JU2A 4M0IA 3CCLP 2KODA 5I4TG 5BS2A 1W2BO 1S72P 2Z45A 3NTEA 2EHTA 4IPYA 3CCQP 1Z6MA 2MY5A 1VQ4P 2DGYA 3DS5A 2M5RA 3G1IA 2GZEA 1Q81Q 2PNGA 3CXCO 2JO0A 4CA3A 1M1KQ 2MVUA 1VQ7P 3CCMP 2K0YA 2PEIA 2E1MA 3DS4A 2PEOA 1K9MQ 2EFJA 2XZ1C 4PXHB 2KOOA 3CE7A 2MVVA 4XRQA 3E2DA 3G71P 2PENA 2CQ8A 1DNYA 3Q20A 2JQ4A 4H2YC 2M8LA 2X2BA 2PEKA 2MR8A 3CC4P 1VQ8P 5KP6B 2LIWA 1VQMP 2CWOA 2MR7A 3GKLC 2AFEA 2K0XA 2LL8A 2MD9A 2LF4A 5KP7B 2GDWA 1VKUA 1VQ5P 1KQSO 3DS3A 1GPJA 2FAEA 1YHQP 1QVFO 2QNWA 3EJEA 2FQ2A 1M90Q 2L4BA 2KGDA 2FHSC 2JAZA 4IZ6A 3CCJP 2L22A 1VQ6P 1YITP 3LRYA 5HGOA 4GR2A 3NY7B 2XT1A 2EHSA 4PH1A 3CMEP 2FQ1A 2MF4A 2N6ZA 2N5IA 2XV6A 3DS2A 1EMVA
chains in the Genus database with same CATH topology
2KORA 2M5RA 1X3OA 2KGCA 2KW2A 1T8KA 2FACA 2KWLA 1NQ4A 2PNGA 4DG9A 3EJDA 2DNWA 4CA3A 4HKGA 2MVUA 2LPKA 2K94A 3GZLA 2K0YA 2LIUA 2KG8A 2N98A 4BPHA 2FQ0A 3EJBA 5HVCA 2XZ1C 4PXHB 2KOOA 4R0MA 3CE7A 2KG6A 2MVVA 1KLPA 2LTEA 2L0QA 2FVAA 2LKIA 2N50A 4NEOA 2JU1A 2N6YA 2CQ8A 2N5HA 1DNYA 3LMOA 2KR5A 2JQ4A 2KOSA 1L0HA 2FVFA 5KP8B 4H2YC 2JGPA 2X2BA 1L0IA 2MR8A 1HQBA 4H2WC 5KP6B 2KOQA 3GZMA 2LIWA 1F80D 1ACPA 1DV5A 1HY8A 2KGEA 4PWVB 2L9FA 4BPGA 4MRTC 2MR7A 2AFEA 2KOPA 2K0XA 2LL8A 2GDXA 2AVAA 2MD9A 2XZ0D 1AF8A 2GDYA 2FVEA 5KP7B 5CZDB 2AF8A 2GDWA 2LMLA 1VKUA 4BPFA 2VSQA 2ROQA 2KGAA 2JU2A 2AFDA 2FAEA 2QNWA 3EJEA 2FQ2A 2K93A 5EJDA 2K2QA 2CNRA 2L4BA 2KGDA 1OR5A 2LOLA 2FHSC 4IZ6A 2CG5B 2L22A 4H2XC 5HV8A 3NY7B 2KG9A 2EHTA 2FADA 2EHSA 2FQ1A 2MF4A 2MY5A 2N6ZA 2N5IA 3RG2A 2CGQA 2K92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOR A;  2M5R A;  1X3O A;  2KGC A;  2KW2 A;  1T8K A;  2FAC A;  2KWL A;  1NQ4 A;  2PNG A;  4DG9 A;  3EJD A;  2DNW A;  4CA3 A;  4HKG A;  2MVU A;  2LPK A;  2K94 A;  3GZL A;  2K0Y A;  2LIU A;  2KG8 A;  2N98 A;  4BPH A;  2FQ0 A;  3EJB A;  5HVC A;  2XZ1 C;  4PXH B;  2KOO A;  4R0M A;  3CE7 A;  2KG6 A;  2MVV A;  1KLP A;  2LTE A;  2L0Q A;  2FVA A;  2LKI A;  2N50 A;  4NEO A;  2JU1 A;  2N6Y A;  2CQ8 A;  2N5H A;  1DNY A;  3LMO A;  2KR5 A;  2JQ4 A;  2KOS A;  1L0H A;  2FVF A;  5KP8 B;  4H2Y C;  2JGP A;  2X2B A;  1L0I A;  2MR8 A;  1HQB A;  4H2W C;  5KP6 B;  2KOQ A;  3GZM A;  2LIW A;  1F80 D;  1ACP A;  1DV5 A;  1HY8 A;  2KGE A;  4PWV B;  2L9F A;  4BPG A;  4MRT C;  2MR7 A;  2AFE A;  2KOP A;  2K0X A;  2LL8 A;  2GDX A;  2AVA A;  2MD9 A;  2XZ0 D;  1AF8 A;  2GDY A;  2FVE A;  5KP7 B;  5CZD B;  2AF8 A;  2GDW A;  2LML A;  1VKU A;  4BPF A;  2VSQ A;  2ROQ A;  2KGA A;  2JU2 A;  2AFD A;  2FAE A;  2QNW A;  3EJE A;  2FQ2 A;  2K93 A;  5EJD A;  2K2Q A;  2CNR A;  2L4B A;  2KGD A;  1OR5 A;  2LOL A;  2FHS C;  4IZ6 A;  2CG5 B;  2L22 A;  4H2X C;  5HV8 A;  3NY7 B;  2KG9 A;  2EHT A;  2FAD A;  2EHS A;  2FQ1 A;  2MF4 A;  2MY5 A;  2N6Z A;  2N5I A;  3RG2 A;  2CGQ A;  2K92 A; 
#chains in the Genus database with same CATH topology
 1VQL P;  5F2N A;  7CEI A;  1M6E X;  2NO8 A;  2KW2 A;  1T8K A;  3GJN A;  1NQ4 A;  5HGM A;  1YJN P;  3DPH A;  4XFZ A;  3GZL A;  4F37 A;  2LIU A;  2M8N A;  3EJB A;  1FR2 A;  4R0M A;  1Q82 Q;  2K5X A;  2LTE A;  5HGN A;  1KLP A;  2L0Q A;  1MZ8 A;  2ONT A;  4XRO A;  3VRL C;  4NEO A;  1YJW P;  2PEM A;  3LMO A;  3B4Q A;  5HGL A;  1NJI Q;  1M6N A;  1L0H A;  2FVF A;  2JGP A;  1VQ9 P;  2Z46 A;  4H2W C;  3B5I A;  2JBG A;  3CCE P;  1ACP A;  1DV5 A;  2KGE A;  2VLN A;  3G26 A;  4BPG A;  4MRT C;  1VQN P;  2GZJ A;  2OAR A;  4COC A;  2GDY A;  2LML A;  2ROQ A;  3RG6 C;  2KGA A;  2L6E A;  2XXM A;  1N8R Q;  5EJD A;  2VLP A;  1K8A Q;  1BAJ A;  2PEQ A;  2PY8 A;  2CG5 B;  1VQP P;  3HYB A;  2BUO A;  3OW2 O;  1KC8 Q;  1UNK A;  2BHV A;  3G29 A;  2CGQ A;  2K92 A;  1K30 A;  2KOR A;  2ERH A;  2GYK A;  1VQK P;  2KGC A;  5F2K A;  2FAC A;  2GZF A;  1AUM A;  3EJD A;  2DNW A;  3G6E P;  4XFY A;  4HKG A;  4U0F A;  4GR6 A;  1GXH A;  2KG8 A;  2N98 A;  1QVG O;  3CCS P;  3CC7 P;  3CC2 P;  1IUQ A;  5HVC A;  3G0V A;  5DCK A;  5EW5 E;  1Q86 Q;  2K0D X;  3G1G A;  2N50 A;  2JYG A;  1KD1 Q;  3H47 A;  1VQO P;  1E6J P;  2KR5 A;  1YI2 P;  1RNI A;  2KOS A;  1M74 A;  5KP8 B;  1JJ2 O;  4U0C A;  3MGE A;  1HQB A;  1F80 D;  3HZQ A;  1QRJ A;  4QNB A;  1HY8 A;  2L9F A;  3M1M A;  2P9X A;  1K73 Q;  1UJZ A;  3CCU P;  1EIA A;  2VLQ A;  2AVA A;  2XZ0 D;  2FVE A;  2AF8 A;  1A43 A;  4COP A;  2VSQ A;  3H0D A;  4U0E A;  2AFD A;  2VLO A;  5JPA A;  2K93 A;  3CMA P;  2OTL P;  2EG5 A;  2K2Q A;  2CNR A;  2EIA A;  1OR5 A;  2LOL A;  3WBH A;  2Z44 A;  3G4S P;  3CD6 P;  2PEJ A;  1GXG A;  4H2X C;  1A8O A;  5HV8 A;  3CPW O;  2KG9 A;  2FAD A;  1YIJ P;  3P05 A;  3RG2 A;  3DS0 A;  1X3O A;  2QEX P;  2KWL A;  3I56 P;  1ZNV A;  4XFX A;  4DG9 A;  3H4E A;  1ZMB A;  1IMQ A;  1RO0 A;  2LPK A;  1RO2 A;  2K94 A;  1BXI A;  4U0D A;  2WPT A;  1IMP A;  4BPH A;  2FQ0 A;  4U0A A;  2JB0 A;  1EOQ A;  1AYI A;  3I55 P;  2KG6 A;  4U0B A;  2JYL A;  2FVA A;  2LKI A;  3G21 A;  2M8P A;  2JU1 A;  2N6Y A;  4PH0 A;  2N5H A;  3DTJ A;  1CEI A;  1Q7Y Q;  3CCR P;  1D1D A;  5BS1 A;  1L0I A;  2OTJ P;  2GZI A;  2KOQ A;  3GZM A;  4PWV B;  3G28 A;  4WYM A;  1E0H A;  4QKO A;  2KOP A;  2QA4 P;  1VHN A;  2GDX A;  2GZG A;  1YJ9 P;  1AF8 A;  3U43 A;  5CZD B;  3CCV P;  4UHP B;  4BPF A;  3DS1 A;  5F2O A;  2JU2 A;  4M0I A;  3CCL P;  2KOD A;  5I4T G;  5BS2 A;  1W2B O;  1S72 P;  2Z45 A;  3NTE A;  2EHT A;  4IPY A;  3CCQ P;  1Z6M A;  2MY5 A;  1VQ4 P;  2DGY A;  3DS5 A;  2M5R A;  3G1I A;  2GZE A;  1Q81 Q;  2PNG A;  3CXC O;  2JO0 A;  4CA3 A;  1M1K Q;  2MVU A;  1VQ7 P;  3CCM P;  2K0Y A;  2PEI A;  2E1M A;  3DS4 A;  2PEO A;  1K9M Q;  2EFJ A;  2XZ1 C;  4PXH B;  2KOO A;  3CE7 A;  2MVV A;  4XRQ A;  3E2D A;  3G71 P;  2PEN A;  2CQ8 A;  1DNY A;  3Q20 A;  2JQ4 A;  4H2Y C;  2M8L A;  2X2B A;  2PEK A;  2MR8 A;  3CC4 P;  1VQ8 P;  5KP6 B;  2LIW A;  1VQM P;  2CWO A;  2MR7 A;  3GKL C;  2AFE A;  2K0X A;  2LL8 A;  2MD9 A;  2LF4 A;  5KP7 B;  2GDW A;  1VKU A;  1VQ5 P;  1KQS O;  3DS3 A;  1GPJ A;  2FAE A;  1YHQ P;  1QVF O;  2QNW A;  3EJE A;  2FQ2 A;  1M90 Q;  2L4B A;  2KGD A;  2FHS C;  2JAZ A;  4IZ6 A;  3CCJ P;  2L22 A;  1VQ6 P;  1YIT P;  3LRY A;  5HGO A;  4GR2 A;  3NY7 B;  2XT1 A;  2EHS A;  4PH1 A;  3CME P;  2FQ1 A;  2MF4 A;  2N6Z A;  2N5I A;  2XV6 A;  3DS2 A;  1EMV A; 
#chains in the Genus database with same CATH homology
 2KOR A;  2M5R A;  1X3O A;  2KGC A;  2KW2 A;  1T8K A;  2FAC A;  2KWL A;  1NQ4 A;  2PNG A;  4DG9 A;  3EJD A;  2DNW A;  4CA3 A;  4HKG A;  2MVU A;  2LPK A;  2K94 A;  3GZL A;  2K0Y A;  2LIU A;  2KG8 A;  2N98 A;  4BPH A;  2FQ0 A;  3EJB A;  5HVC A;  2XZ1 C;  4PXH B;  2KOO A;  4R0M A;  3CE7 A;  2KG6 A;  2MVV A;  1KLP A;  2LTE A;  2L0Q A;  2FVA A;  2LKI A;  2N50 A;  4NEO A;  2JU1 A;  2N6Y A;  2CQ8 A;  2N5H A;  1DNY A;  3LMO A;  2KR5 A;  2JQ4 A;  2KOS A;  1L0H A;  2FVF A;  5KP8 B;  4H2Y C;  2JGP A;  2X2B A;  1L0I A;  2MR8 A;  1HQB A;  4H2W C;  5KP6 B;  2KOQ A;  3GZM A;  2LIW A;  1F80 D;  1ACP A;  1DV5 A;  1HY8 A;  2KGE A;  4PWV B;  2L9F A;  4BPG A;  4MRT C;  2MR7 A;  2AFE A;  2KOP A;  2K0X A;  2LL8 A;  2GDX A;  2AVA A;  2MD9 A;  2XZ0 D;  1AF8 A;  2GDY A;  2FVE A;  5KP7 B;  5CZD B;  2AF8 A;  2GDW A;  2LML A;  1VKU A;  4BPF A;  2VSQ A;  2ROQ A;  2KGA A;  2JU2 A;  2AFD A;  2FAE A;  2QNW A;  3EJE A;  2FQ2 A;  2K93 A;  5EJD A;  2K2Q A;  2CNR A;  2L4B A;  2KGD A;  1OR5 A;  2LOL A;  2FHS C;  4IZ6 A;  2CG5 B;  2L22 A;  4H2X C;  5HV8 A;  3NY7 B;  2KG9 A;  2EHT A;  2FAD A;  2EHS A;  2FQ1 A;  2MF4 A;  2MY5 A;  2N6Z A;  2N5I A;  3RG2 A;  2CGQ A;  2K92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...