2KOQA

Nmr solution structures of 3-hydroxyoctanoyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
total genus 24
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2koqA00
1DNYA 1L0HA 5EJDA 2XZ0D 2GDWA 2MR7A 5KP8B 4IZ6A 2MVUA 2LKIA 5HV8A 2K0YA 5HVCA 2CNRA 2KGCA 2KG8A 1X3OA 2K94A 2ROQA 3EJEA 2JGPA 2LL8A 2AF8A 5CZDB 2N50A 2KOOA 2L4BA 2N5HA 3EJBA 2QNWA 2AVAA 2DNWA 2N5IA 1L0IA 2K0XA 2N6ZA 4NEOA 3EJDA 4MRTC 2L22A 2K93A 4BPGA 1NQ4A 2FADA 1KLPA 2FHSC 4DG9A 2CQ8A 2KOQA 4PXHB 5KP7B 2AFEA 2L9FA 2KR5A 2EHTA 1VKUA 2KWLA 1DV5A 2N98A 5KP6B 2LMLA 4CA3A 2CGQA 2M5RA 2KW2A 4H2YC 4HKGA 1T8KA 1ACPA 2X2BA 3LMOA 2XZ1C 2KORA 2AFDA 2EHSA 1F80D 4R0MA 2FVAA 1AF8A 2K92A 4BPFA 2FVEA 2L0QA 4H2XC 2PNGA 2LPKA 2MR8A 2MY5A 2FACA 3GZMA 4PWVB 2KOSA 2GDXA 2JU2A 2LIWA 2GDYA 2JU1A 2KG9A 3RG2A 2JQ4A 2KGAA 2KG6A 2MD9A 2VSQA 2FQ2A 3CE7A 2N6YA 2KOPA 3GZLA 2CG5B 1HY8A 3NY7B 2KGDA 2FAEA 2FVFA 4H2WC 2LOLA 1OR5A 2LTEA 2MF4A 4BPHA 2LIUA 2K2QA 2MVVA 1HQBA 2FQ0A 2FQ1A 2KGEA
chains in the Genus database with same CATH superfamily
3B5IA 2GDWA 2MVUA 2XXMA 3CC2P 1RNIA 3I55P 3G29A 1VQ4P 1IMQA 2K0YA 2KGCA 2KG8A 1UJZA 3CCSP 1Q81Q 1YITP 2LF4A 4XFZA 4WYMA 5CZDB 2PEJA 2N5HA 2ERHA 1EOQA 3DTJA 4U0CA 2QNWA 1BXIA 1VHNA 3EJDA 1NQ4A 1RO0A 1EIAA 2GZJA 3CCEP 2ONTA 3Q20A 3H0DA 3CCLP 2M5RA 1K9MQ 3LMOA 2AFDA 4BPFA 1VQOP 2L0QA 1YJWP 1IMPA 3GZMA 2KOSA 2JU2A 2LIWA 2GDYA 2JU1A 3CXCO 5F2OA 2KG6A 1CEIA 2MD9A 4U0AA 3VRLC 1W2BO 3CCRP 2VLQA 3CE7A 4COPA 3G0VA 2CWOA 2KOPA 2VLPA 2PEQA 3NTEA 1VQNP 1BAJA 3WBHA 2LOLA 1K73Q 1M6NA 1VQPP 3HZQA 3DS0A 2KGEA 2OTJP 1E0HA 1Q82Q 2MR7A 1VQ9P 4UHPB 4IZ6A 2OARA 5HV8A 1A43A 1Z6MA 2Z44A 3CCVP 1Q7YQ 1M6EX 2PEIA 2PENA 5HVCA 1X3OA 2K94A 1S72P 3EJEA 2JGPA 4XFYA 5HGOA 1VQ5P 2BHVA 1E6JP 1YIJP 2N6ZA 2JAZA 2GZGA 1M90Q 2JO0A 2FHSC 4DG9A 2CQ8A 2KOQA 3DPHA 1QVFO 5KP7B 2AFEA 2L9FA 1VKUA 4GR2A 1DV5A 3B4QA 4CA3A 2KW2A 4HKGA 4XFXA 1T8KA 1ACPA 3DS5A 2P9XA 3CMEP 2KORA 2FVAA 3M1MA 1VQ7P 2GDXA 2XT1A 5HGLA 3H47A 1ZMBA 2KG9A 3RG2A 2KGAA 2PEKA 3G1IA 2EG5A 2OTLP 1K30A 1D1DA 1GXHA 1K8AQ 1VQMP 1NJIQ 2GZIA 4U0EA 1AYIA 2CG5B 1HY8A 1QVGO 2KGDA 3G26A 2PEOA 3CD6P 2JBGA 4H2WC 2MF4A 2LIUA 2MVVA 3DS3A 1HQBA 2FQ0A 4U0BA 1L0HA 2M8NA 5EJDA 5BS1A 1GPJA 2VLNA 1ZNVA 2LKIA 1EMVA 1FR2A 1YHQP 1A8OA 2CNRA 1VQ8P 3G4SP 2ROQA 2AF8A 2K0DX 4PH0A 2N50A 2KOOA 1YJ9P 3EJBA 4M0IA 2AVAA 2DNWA 3G21A 4XRQA 1L0IA 2K0XA 3CMAP 4NEOA 3HYBA 2L22A 3I56P 2KODA 1KLPA 3RG6C 4PH1A 2EHTA 2KR5A 3H4EA 3CCMP 4GR6A 3CPWO 2N98A 1IUQA 5KP6B 2LMLA 2X2BA 5HGMA 7CEIA 2PY8A 2K5XA 2XZ1C 3E2DA 2EHSA 1F80D 3DS1A 4R0MA 1AF8A 2FVEA 3CC4P 1RO2A 4XROA 5F2NA 4H2XC 2PNGA 2LPKA 2MR8A 1JJ2O 1QRJA 4PWVB 2VSQA 2DGYA 3GJNA 2M8PA 2N6YA 3CCUP 2Z46A 2BUOA 3LRYA 2M8LA 1KQSO 1OR5A 1KD1Q 4BPHA 1VQLP 1DNYA 2GZEA 2EIAA 2PEMA 2XZ0D 2JYGA 5HGNA 5EW5E 5KP8B 2GYKA 1KC8Q 2WPTA 2QEXP 3CCQP 1YJNP 4QNBA 1M74A 3G71P 2LL8A 2L4BA 1VQKP 1UNKA 2EFJA 3G6EP 2N5IA 2GZFA 4U0FA 5DCKA 3G1GA 4MRTC 2K93A 2JB0A 4BPGA 1M1KQ 2FADA 2VLOA 4PXHB 1Q86Q 1N8RQ 1MZ8A 1VQ6P 4IPYA 3DS2A 2QA4P 2KWLA 3DS4A 2Z45A 4COCA 2CGQA 4H2YC 1GXGA 4QKOA 2K92A 3CCJP 3OW2O 3P05A 2MY5A 2FACA 5JPAA 2JQ4A 2E1MA 2XV6A 3MGEA 4U0DA 2FQ2A 4F37A 3CC7P 1YI2P 2JYLA 5I4TG 3GZLA 3G28A 5BS2A 3NY7B 2L6EA 5F2KA 2FAEA 2FVFA 1AUMA 2LTEA 3GKLC 2K2QA 2NO8A 3U43A 2FQ1A
chains in the Genus database with same CATH topology
1DNYA 1L0HA 5EJDA 2XZ0D 2GDWA 2MR7A 5KP8B 4IZ6A 2MVUA 2LKIA 5HV8A 2K0YA 5HVCA 2CNRA 2KGCA 2KG8A 1X3OA 2K94A 2ROQA 3EJEA 2JGPA 2LL8A 2AF8A 5CZDB 2N50A 2KOOA 2L4BA 2N5HA 3EJBA 2QNWA 2AVAA 2DNWA 2N5IA 1L0IA 2K0XA 2N6ZA 4NEOA 3EJDA 4MRTC 2L22A 2K93A 4BPGA 1NQ4A 2FADA 1KLPA 2FHSC 4DG9A 2CQ8A 2KOQA 4PXHB 5KP7B 2AFEA 2L9FA 2KR5A 2EHTA 1VKUA 2KWLA 1DV5A 2N98A 5KP6B 2LMLA 4CA3A 2CGQA 2M5RA 2KW2A 4H2YC 4HKGA 1T8KA 1ACPA 2X2BA 3LMOA 2XZ1C 2KORA 2AFDA 2EHSA 1F80D 4R0MA 2FVAA 1AF8A 2K92A 4BPFA 2FVEA 2L0QA 4H2XC 2PNGA 2LPKA 2MR8A 2MY5A 2FACA 3GZMA 4PWVB 2KOSA 2GDXA 2JU2A 2LIWA 2GDYA 2JU1A 2KG9A 3RG2A 2JQ4A 2KGAA 2KG6A 2MD9A 2VSQA 2FQ2A 3CE7A 2N6YA 2KOPA 3GZLA 2CG5B 1HY8A 3NY7B 2KGDA 2FAEA 2FVFA 4H2WC 2LOLA 1OR5A 2LTEA 2MF4A 4BPHA 2LIUA 2K2QA 2MVVA 1HQBA 2FQ0A 2FQ1A 2KGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DNY A;  1L0H A;  5EJD A;  2XZ0 D;  2GDW A;  2MR7 A;  5KP8 B;  4IZ6 A;  2MVU A;  2LKI A;  5HV8 A;  2K0Y A;  5HVC A;  2CNR A;  2KGC A;  2KG8 A;  1X3O A;  2K94 A;  2ROQ A;  3EJE A;  2JGP A;  2LL8 A;  2AF8 A;  5CZD B;  2N50 A;  2KOO A;  2L4B A;  2N5H A;  3EJB A;  2QNW A;  2AVA A;  2DNW A;  2N5I A;  1L0I A;  2K0X A;  2N6Z A;  4NEO A;  3EJD A;  4MRT C;  2L22 A;  2K93 A;  4BPG A;  1NQ4 A;  2FAD A;  1KLP A;  2FHS C;  4DG9 A;  2CQ8 A;  2KOQ A;  4PXH B;  5KP7 B;  2AFE A;  2L9F A;  2KR5 A;  2EHT A;  1VKU A;  2KWL A;  1DV5 A;  2N98 A;  5KP6 B;  2LML A;  4CA3 A;  2CGQ A;  2M5R A;  2KW2 A;  4H2Y C;  4HKG A;  1T8K A;  1ACP A;  2X2B A;  3LMO A;  2XZ1 C;  2KOR A;  2AFD A;  2EHS A;  1F80 D;  4R0M A;  2FVA A;  1AF8 A;  2K92 A;  4BPF A;  2FVE A;  2L0Q A;  4H2X C;  2PNG A;  2LPK A;  2MR8 A;  2MY5 A;  2FAC A;  3GZM A;  4PWV B;  2KOS A;  2GDX A;  2JU2 A;  2LIW A;  2GDY A;  2JU1 A;  2KG9 A;  3RG2 A;  2JQ4 A;  2KGA A;  2KG6 A;  2MD9 A;  2VSQ A;  2FQ2 A;  3CE7 A;  2N6Y A;  2KOP A;  3GZL A;  2CG5 B;  1HY8 A;  3NY7 B;  2KGD A;  2FAE A;  2FVF A;  4H2W C;  2LOL A;  1OR5 A;  2LTE A;  2MF4 A;  4BPH A;  2LIU A;  2K2Q A;  2MVV A;  1HQB A;  2FQ0 A;  2FQ1 A;  2KGE A; 
#chains in the Genus database with same CATH topology
 3B5I A;  2GDW A;  2MVU A;  2XXM A;  3CC2 P;  1RNI A;  3I55 P;  3G29 A;  1VQ4 P;  1IMQ A;  2K0Y A;  2KGC A;  2KG8 A;  1UJZ A;  3CCS P;  1Q81 Q;  1YIT P;  2LF4 A;  4XFZ A;  4WYM A;  5CZD B;  2PEJ A;  2N5H A;  2ERH A;  1EOQ A;  3DTJ A;  4U0C A;  2QNW A;  1BXI A;  1VHN A;  3EJD A;  1NQ4 A;  1RO0 A;  1EIA A;  2GZJ A;  3CCE P;  2ONT A;  3Q20 A;  3H0D A;  3CCL P;  2M5R A;  1K9M Q;  3LMO A;  2AFD A;  4BPF A;  1VQO P;  2L0Q A;  1YJW P;  1IMP A;  3GZM A;  2KOS A;  2JU2 A;  2LIW A;  2GDY A;  2JU1 A;  3CXC O;  5F2O A;  2KG6 A;  1CEI A;  2MD9 A;  4U0A A;  3VRL C;  1W2B O;  3CCR P;  2VLQ A;  3CE7 A;  4COP A;  3G0V A;  2CWO A;  2KOP A;  2VLP A;  2PEQ A;  3NTE A;  1VQN P;  1BAJ A;  3WBH A;  2LOL A;  1K73 Q;  1M6N A;  1VQP P;  3HZQ A;  3DS0 A;  2KGE A;  2OTJ P;  1E0H A;  1Q82 Q;  2MR7 A;  1VQ9 P;  4UHP B;  4IZ6 A;  2OAR A;  5HV8 A;  1A43 A;  1Z6M A;  2Z44 A;  3CCV P;  1Q7Y Q;  1M6E X;  2PEI A;  2PEN A;  5HVC A;  1X3O A;  2K94 A;  1S72 P;  3EJE A;  2JGP A;  4XFY A;  5HGO A;  1VQ5 P;  2BHV A;  1E6J P;  1YIJ P;  2N6Z A;  2JAZ A;  2GZG A;  1M90 Q;  2JO0 A;  2FHS C;  4DG9 A;  2CQ8 A;  2KOQ A;  3DPH A;  1QVF O;  5KP7 B;  2AFE A;  2L9F A;  1VKU A;  4GR2 A;  1DV5 A;  3B4Q A;  4CA3 A;  2KW2 A;  4HKG A;  4XFX A;  1T8K A;  1ACP A;  3DS5 A;  2P9X A;  3CME P;  2KOR A;  2FVA A;  3M1M A;  1VQ7 P;  2GDX A;  2XT1 A;  5HGL A;  3H47 A;  1ZMB A;  2KG9 A;  3RG2 A;  2KGA A;  2PEK A;  3G1I A;  2EG5 A;  2OTL P;  1K30 A;  1D1D A;  1GXH A;  1K8A Q;  1VQM P;  1NJI Q;  2GZI A;  4U0E A;  1AYI A;  2CG5 B;  1HY8 A;  1QVG O;  2KGD A;  3G26 A;  2PEO A;  3CD6 P;  2JBG A;  4H2W C;  2MF4 A;  2LIU A;  2MVV A;  3DS3 A;  1HQB A;  2FQ0 A;  4U0B A;  1L0H A;  2M8N A;  5EJD A;  5BS1 A;  1GPJ A;  2VLN A;  1ZNV A;  2LKI A;  1EMV A;  1FR2 A;  1YHQ P;  1A8O A;  2CNR A;  1VQ8 P;  3G4S P;  2ROQ A;  2AF8 A;  2K0D X;  4PH0 A;  2N50 A;  2KOO A;  1YJ9 P;  3EJB A;  4M0I A;  2AVA A;  2DNW A;  3G21 A;  4XRQ A;  1L0I A;  2K0X A;  3CMA P;  4NEO A;  3HYB A;  2L22 A;  3I56 P;  2KOD A;  1KLP A;  3RG6 C;  4PH1 A;  2EHT A;  2KR5 A;  3H4E A;  3CCM P;  4GR6 A;  3CPW O;  2N98 A;  1IUQ A;  5KP6 B;  2LML A;  2X2B A;  5HGM A;  7CEI A;  2PY8 A;  2K5X A;  2XZ1 C;  3E2D A;  2EHS A;  1F80 D;  3DS1 A;  4R0M A;  1AF8 A;  2FVE A;  3CC4 P;  1RO2 A;  4XRO A;  5F2N A;  4H2X C;  2PNG A;  2LPK A;  2MR8 A;  1JJ2 O;  1QRJ A;  4PWV B;  2VSQ A;  2DGY A;  3GJN A;  2M8P A;  2N6Y A;  3CCU P;  2Z46 A;  2BUO A;  3LRY A;  2M8L A;  1KQS O;  1OR5 A;  1KD1 Q;  4BPH A;  1VQL P;  1DNY A;  2GZE A;  2EIA A;  2PEM A;  2XZ0 D;  2JYG A;  5HGN A;  5EW5 E;  5KP8 B;  2GYK A;  1KC8 Q;  2WPT A;  2QEX P;  3CCQ P;  1YJN P;  4QNB A;  1M74 A;  3G71 P;  2LL8 A;  2L4B A;  1VQK P;  1UNK A;  2EFJ A;  3G6E P;  2N5I A;  2GZF A;  4U0F A;  5DCK A;  3G1G A;  4MRT C;  2K93 A;  2JB0 A;  4BPG A;  1M1K Q;  2FAD A;  2VLO A;  4PXH B;  1Q86 Q;  1N8R Q;  1MZ8 A;  1VQ6 P;  4IPY A;  3DS2 A;  2QA4 P;  2KWL A;  3DS4 A;  2Z45 A;  4COC A;  2CGQ A;  4H2Y C;  1GXG A;  4QKO A;  2K92 A;  3CCJ P;  3OW2 O;  3P05 A;  2MY5 A;  2FAC A;  5JPA A;  2JQ4 A;  2E1M A;  2XV6 A;  3MGE A;  4U0D A;  2FQ2 A;  4F37 A;  3CC7 P;  1YI2 P;  2JYL A;  5I4T G;  3GZL A;  3G28 A;  5BS2 A;  3NY7 B;  2L6E A;  5F2K A;  2FAE A;  2FVF A;  1AUM A;  2LTE A;  3GKL C;  2K2Q A;  2NO8 A;  3U43 A;  2FQ1 A; 
#chains in the Genus database with same CATH homology
 1DNY A;  1L0H A;  5EJD A;  2XZ0 D;  2GDW A;  2MR7 A;  5KP8 B;  4IZ6 A;  2MVU A;  2LKI A;  5HV8 A;  2K0Y A;  5HVC A;  2CNR A;  2KGC A;  2KG8 A;  1X3O A;  2K94 A;  2ROQ A;  3EJE A;  2JGP A;  2LL8 A;  2AF8 A;  5CZD B;  2N50 A;  2KOO A;  2L4B A;  2N5H A;  3EJB A;  2QNW A;  2AVA A;  2DNW A;  2N5I A;  1L0I A;  2K0X A;  2N6Z A;  4NEO A;  3EJD A;  4MRT C;  2L22 A;  2K93 A;  4BPG A;  1NQ4 A;  2FAD A;  1KLP A;  2FHS C;  4DG9 A;  2CQ8 A;  2KOQ A;  4PXH B;  5KP7 B;  2AFE A;  2L9F A;  2KR5 A;  2EHT A;  1VKU A;  2KWL A;  1DV5 A;  2N98 A;  5KP6 B;  2LML A;  4CA3 A;  2CGQ A;  2M5R A;  2KW2 A;  4H2Y C;  4HKG A;  1T8K A;  1ACP A;  2X2B A;  3LMO A;  2XZ1 C;  2KOR A;  2AFD A;  2EHS A;  1F80 D;  4R0M A;  2FVA A;  1AF8 A;  2K92 A;  4BPF A;  2FVE A;  2L0Q A;  4H2X C;  2PNG A;  2LPK A;  2MR8 A;  2MY5 A;  2FAC A;  3GZM A;  4PWV B;  2KOS A;  2GDX A;  2JU2 A;  2LIW A;  2GDY A;  2JU1 A;  2KG9 A;  3RG2 A;  2JQ4 A;  2KGA A;  2KG6 A;  2MD9 A;  2VSQ A;  2FQ2 A;  3CE7 A;  2N6Y A;  2KOP A;  3GZL A;  2CG5 B;  1HY8 A;  3NY7 B;  2KGD A;  2FAE A;  2FVF A;  4H2W C;  2LOL A;  1OR5 A;  2LTE A;  2MF4 A;  4BPH A;  2LIU A;  2K2Q A;  2MVV A;  1HQB A;  2FQ0 A;  2FQ1 A;  2KGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...