2KOQA

Nmr solution structures of 3-hydroxyoctanoyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
molecule keywords Acyl carrier protein
total genus 24
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2koqA00
2KORA 2LMLA 2KG8A 2KOPA 3GZLA 2MR7A 1T8KA 2N5HA 1F80D 2CQ8A 2FQ2A 2KR5A 2LIUA 5CZDB 2LKIA 2LTEA 1HY8A 2AFDA 2JU2A 1L0HA 5KP8B 2KWLA 2KG6A 2M5RA 4H2YC 2CGQA 2N5IA 1KLPA 4PXHB 2FAEA 4MRTC 3RG2A 2FVAA 2AFEA 5HVCA 2PNGA 2FACA 2DNWA 2KW2A 3NY7B 1AF8A 1HQBA 4R0MA 2FVEA 2KGAA 4PWVB 2L0QA 2MR8A 2KOSA 2ROQA 3EJBA 3GZMA 5EJDA 2MVVA 2L4BA 1DV5A 2N98A 5KP6B 2LL8A 2FHSC 1X3OA 2KOOA 3CE7A 2MY5A 2MF4A 2JGPA 2KGDA 2LOLA 2GDWA 2KOQA 4HKGA 4CA3A 1NQ4A 2QNWA 2CG5B 2K92A 4H2WC 1DNYA 4H2XC 5KP7B 2JQ4A 2JU1A 1VKUA 2CNRA 2GDYA 3EJDA 3LMOA 2L22A 2LIWA 2K0XA 2XZ1C 3EJEA 2LPKA 2GDXA 2K2QA 2KGEA 2FQ1A 2EHTA 2L9FA 4BPGA 2N50A 1OR5A 2MD9A 2FADA 5HV8A 2X2BA 4BPHA 4IZ6A 4DG9A 4NEOA 2K94A 2N6YA 2VSQA 2K93A 4BPFA 2N6ZA 2FVFA 2FQ0A 1ACPA 2KGCA 2AVAA 2MVUA 2AF8A 2EHSA 1L0IA 2K0YA 2KG9A 2XZ0D
chains in the Genus database with same CATH superfamily
2KORA 2LMLA 2KG8A 2KOPA 1Q81Q 2MR7A 2FQ2A 5F2NA 1QVFO 2KR5A 3CD6P 2LKIA 2KODA 1Q86Q 1NJIQ 1M6NA 1VQ8P 3G29A 2M5RA 1K73Q 3DS1A 2CGQA 5F2OA 4MRTC 1VQPP 2FVAA 5HVCA 2Z46A 1VHNA 3CCRP 7CEIA 2M8NA 2KGAA 5BS2A 4PWVB 5HGMA 3H4EA 1M90Q 3DS5A 3CCVP 3G4SP 3CMEP 2L4BA 1KQSO 4M0IA 2FHSC 3CCMP 3G0VA 1X3OA 2GZFA 3CE7A 1FR2A 4QKOA 2GYKA 4XROA 3M1MA 2QNWA 1UNKA 1Q7YQ 3G28A 2XXMA 2EFJA 4U0BA 2K5XA 3EJEA 3H0DA 2CWOA 1YHQP 2FQ1A 4F37A 1BXIA 1AUMA 3DS4A 4IPYA 2X2BA 2EG5A 2K0DX 1RNIA 2K93A 4BPFA 1GXHA 4XRQA 2FQ0A 3P05A 3CCUP 1JJ2O 2JO0A 2EHSA 1L0IA 3CCQP 4GR2A 2N5HA 1T8KA 2CQ8A 2PEKA 3WBHA 1YIJP 2LTEA 2NO8A 2AFDA 1VQ5P 1UJZA 2JU2A 2QEXP 2KWLA 2JAZA 3CPWO 2VLNA 5DCKA 1D1DA 1M1KQ 2PEJA 1E6JP 2JBGA 4U0CA 3NY7B 4R0MA 2FVEA 1VQ9P 3GKLC 1VQKP 2MR8A 2KOSA 3HYBA 1IMPA 3GZMA 3B5IA 1E0HA 1YI2P 2JYGA 2PEQA 2MF4A 1KC8Q 2LOLA 4COPA 2JYLA 2GZGA 2CG5B 2M8LA 4QNBA 4H2XC 4XFXA 2DGYA 5KP7B 2JQ4A 2XT1A 3Q20A 2GDYA 2VLQA 2P9XA 3LMOA 1YJWP 2XZ1C 4U0AA 2VLOA 2KGEA 2N50A 2ERHA 2MD9A 1K9MQ 2FADA 5JPAA 5HV8A 4U0FA 4GR6A 4DG9A 4NEOA 2VSQA 2N6ZA 3CC2P 2Z44A 1VQOP 1YJNP 3CCJP 1K8AQ 2MVUA 2AF8A 2K0YA 1BAJA 1EOQA 4XFZA 1F80D 5CZDB 3VRLC 3DS3A 2ONTA 2KG6A 2N5IA 2GZIA 4PXHB 2FAEA 2E1MA 5EW5E 3RG2A 1EIAA 2AFEA 1VQMP 2FACA 1VQ6P 2DNWA 2KW2A 4U0DA 2OTLP 1AF8A 1HQBA 3CCLP 2L0QA 2PY8A 1VQ7P 2BHVA 2VLPA 2MVVA 1DV5A 2LL8A 1CEIA 3CC7P 1IMQA 1M6EX 3G1GA 2KOOA 1A8OA 2KGDA 2GDWA 4CA3A 4PH1A 3DPHA 2K92A 2JU1A 1MZ8A 1VKUA 2CNRA 3G26A 3NTEA 3EJDA 1S72P 3G1IA 2PEOA 2LIWA 2K0XA 3MGEA 2LPKA 1EMVA 2K2QA 3DTJA 2XV6A 2EHTA 3G71P 2EIAA 1N8RQ 4BPHA 4IZ6A 5F2KA 1VQLP 3G21A 2FVFA 1ACPA 3I55P 2KGCA 2OTJP 1ZMBA 3CMAP 1KD1Q 2Z45A 2KG9A 3GZLA 1VQNP 3RG6C 5HGNA 1A43A 1Q82Q 2PENA 5BS1A 3CCSP 2LIUA 3CC4P 3H47A 1HY8A 1L0HA 5KP8B 4H2YC 2QA4P 2BUOA 4COCA 1QVGO 1KLPA 3HZQA 3E2DA 2L6EA 2PNGA 3CCEP 1W2BO 1K30A 2WPTA 1YITP 5HGLA 3B4QA 2ROQA 4UHPB 1VQ4P 3EJBA 1IUQA 3LRYA 5EJDA 3U43A 2N98A 5KP6B 2OARA 2M8PA 1ZNVA 2PEIA 1GPJA 2MY5A 2JGPA 2GZJA 2KOQA 3DS0A 4HKGA 3DS2A 1NQ4A 1RO2A 4H2WC 1DNYA 3OW2O 5I4TG 1QRJA 2L22A 1M74A 1GXGA 2GDXA 2GZEA 4WYMA 2L9FA 4U0EA 4XFYA 4BPGA 1OR5A 1AYIA 3I56P 2LF4A 1RO0A 1YJ9P 3G6EP 2JB0A 2K94A 2N6YA 3CXCO 1Z6MA 3GJNA 5HGOA 2AVAA 4PH0A 2PEMA 2XZ0D
chains in the Genus database with same CATH topology
2KORA 2LMLA 2KG8A 2KOPA 3GZLA 2MR7A 1T8KA 2N5HA 1F80D 2CQ8A 2FQ2A 2KR5A 2LIUA 5CZDB 2LKIA 2LTEA 1HY8A 2AFDA 2JU2A 1L0HA 5KP8B 2KWLA 2KG6A 2M5RA 4H2YC 2CGQA 2N5IA 1KLPA 4PXHB 2FAEA 4MRTC 3RG2A 2FVAA 2AFEA 5HVCA 2PNGA 2FACA 2DNWA 2KW2A 3NY7B 1AF8A 1HQBA 4R0MA 2FVEA 2KGAA 4PWVB 2L0QA 2MR8A 2KOSA 2ROQA 3EJBA 3GZMA 5EJDA 2MVVA 2L4BA 1DV5A 2N98A 5KP6B 2LL8A 2FHSC 1X3OA 2KOOA 3CE7A 2MY5A 2MF4A 2JGPA 2KGDA 2LOLA 2GDWA 2KOQA 4HKGA 4CA3A 1NQ4A 2QNWA 2CG5B 2K92A 4H2WC 1DNYA 4H2XC 5KP7B 2JQ4A 2JU1A 1VKUA 2CNRA 2GDYA 3EJDA 3LMOA 2L22A 2LIWA 2K0XA 2XZ1C 3EJEA 2LPKA 2GDXA 2K2QA 2KGEA 2FQ1A 2EHTA 2L9FA 4BPGA 2N50A 1OR5A 2MD9A 2FADA 5HV8A 2X2BA 4BPHA 4IZ6A 4DG9A 4NEOA 2K94A 2N6YA 2VSQA 2K93A 4BPFA 2N6ZA 2FVFA 2FQ0A 1ACPA 2KGCA 2AVAA 2MVUA 2AF8A 2EHSA 1L0IA 2K0YA 2KG9A 2XZ0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOR A;  2LML A;  2KG8 A;  2KOP A;  3GZL A;  2MR7 A;  1T8K A;  2N5H A;  1F80 D;  2CQ8 A;  2FQ2 A;  2KR5 A;  2LIU A;  5CZD B;  2LKI A;  2LTE A;  1HY8 A;  2AFD A;  2JU2 A;  1L0H A;  5KP8 B;  2KWL A;  2KG6 A;  2M5R A;  4H2Y C;  2CGQ A;  2N5I A;  1KLP A;  4PXH B;  2FAE A;  4MRT C;  3RG2 A;  2FVA A;  2AFE A;  5HVC A;  2PNG A;  2FAC A;  2DNW A;  2KW2 A;  3NY7 B;  1AF8 A;  1HQB A;  4R0M A;  2FVE A;  2KGA A;  4PWV B;  2L0Q A;  2MR8 A;  2KOS A;  2ROQ A;  3EJB A;  3GZM A;  5EJD A;  2MVV A;  2L4B A;  1DV5 A;  2N98 A;  5KP6 B;  2LL8 A;  2FHS C;  1X3O A;  2KOO A;  3CE7 A;  2MY5 A;  2MF4 A;  2JGP A;  2KGD A;  2LOL A;  2GDW A;  2KOQ A;  4HKG A;  4CA3 A;  1NQ4 A;  2QNW A;  2CG5 B;  2K92 A;  4H2W C;  1DNY A;  4H2X C;  5KP7 B;  2JQ4 A;  2JU1 A;  1VKU A;  2CNR A;  2GDY A;  3EJD A;  3LMO A;  2L22 A;  2LIW A;  2K0X A;  2XZ1 C;  3EJE A;  2LPK A;  2GDX A;  2K2Q A;  2KGE A;  2FQ1 A;  2EHT A;  2L9F A;  4BPG A;  2N50 A;  1OR5 A;  2MD9 A;  2FAD A;  5HV8 A;  2X2B A;  4BPH A;  4IZ6 A;  4DG9 A;  4NEO A;  2K94 A;  2N6Y A;  2VSQ A;  2K93 A;  4BPF A;  2N6Z A;  2FVF A;  2FQ0 A;  1ACP A;  2KGC A;  2AVA A;  2MVU A;  2AF8 A;  2EHS A;  1L0I A;  2K0Y A;  2KG9 A;  2XZ0 D; 
#chains in the Genus database with same CATH topology
 2KOR A;  2LML A;  2KG8 A;  2KOP A;  1Q81 Q;  2MR7 A;  2FQ2 A;  5F2N A;  1QVF O;  2KR5 A;  3CD6 P;  2LKI A;  2KOD A;  1Q86 Q;  1NJI Q;  1M6N A;  1VQ8 P;  3G29 A;  2M5R A;  1K73 Q;  3DS1 A;  2CGQ A;  5F2O A;  4MRT C;  1VQP P;  2FVA A;  5HVC A;  2Z46 A;  1VHN A;  3CCR P;  7CEI A;  2M8N A;  2KGA A;  5BS2 A;  4PWV B;  5HGM A;  3H4E A;  1M90 Q;  3DS5 A;  3CCV P;  3G4S P;  3CME P;  2L4B A;  1KQS O;  4M0I A;  2FHS C;  3CCM P;  3G0V A;  1X3O A;  2GZF A;  3CE7 A;  1FR2 A;  4QKO A;  2GYK A;  4XRO A;  3M1M A;  2QNW A;  1UNK A;  1Q7Y Q;  3G28 A;  2XXM A;  2EFJ A;  4U0B A;  2K5X A;  3EJE A;  3H0D A;  2CWO A;  1YHQ P;  2FQ1 A;  4F37 A;  1BXI A;  1AUM A;  3DS4 A;  4IPY A;  2X2B A;  2EG5 A;  2K0D X;  1RNI A;  2K93 A;  4BPF A;  1GXH A;  4XRQ A;  2FQ0 A;  3P05 A;  3CCU P;  1JJ2 O;  2JO0 A;  2EHS A;  1L0I A;  3CCQ P;  4GR2 A;  2N5H A;  1T8K A;  2CQ8 A;  2PEK A;  3WBH A;  1YIJ P;  2LTE A;  2NO8 A;  2AFD A;  1VQ5 P;  1UJZ A;  2JU2 A;  2QEX P;  2KWL A;  2JAZ A;  3CPW O;  2VLN A;  5DCK A;  1D1D A;  1M1K Q;  2PEJ A;  1E6J P;  2JBG A;  4U0C A;  3NY7 B;  4R0M A;  2FVE A;  1VQ9 P;  3GKL C;  1VQK P;  2MR8 A;  2KOS A;  3HYB A;  1IMP A;  3GZM A;  3B5I A;  1E0H A;  1YI2 P;  2JYG A;  2PEQ A;  2MF4 A;  1KC8 Q;  2LOL A;  4COP A;  2JYL A;  2GZG A;  2CG5 B;  2M8L A;  4QNB A;  4H2X C;  4XFX A;  2DGY A;  5KP7 B;  2JQ4 A;  2XT1 A;  3Q20 A;  2GDY A;  2VLQ A;  2P9X A;  3LMO A;  1YJW P;  2XZ1 C;  4U0A A;  2VLO A;  2KGE A;  2N50 A;  2ERH A;  2MD9 A;  1K9M Q;  2FAD A;  5JPA A;  5HV8 A;  4U0F A;  4GR6 A;  4DG9 A;  4NEO A;  2VSQ A;  2N6Z A;  3CC2 P;  2Z44 A;  1VQO P;  1YJN P;  3CCJ P;  1K8A Q;  2MVU A;  2AF8 A;  2K0Y A;  1BAJ A;  1EOQ A;  4XFZ A;  1F80 D;  5CZD B;  3VRL C;  3DS3 A;  2ONT A;  2KG6 A;  2N5I A;  2GZI A;  4PXH B;  2FAE A;  2E1M A;  5EW5 E;  3RG2 A;  1EIA A;  2AFE A;  1VQM P;  2FAC A;  1VQ6 P;  2DNW A;  2KW2 A;  4U0D A;  2OTL P;  1AF8 A;  1HQB A;  3CCL P;  2L0Q A;  2PY8 A;  1VQ7 P;  2BHV A;  2VLP A;  2MVV A;  1DV5 A;  2LL8 A;  1CEI A;  3CC7 P;  1IMQ A;  1M6E X;  3G1G A;  2KOO A;  1A8O A;  2KGD A;  2GDW A;  4CA3 A;  4PH1 A;  3DPH A;  2K92 A;  2JU1 A;  1MZ8 A;  1VKU A;  2CNR A;  3G26 A;  3NTE A;  3EJD A;  1S72 P;  3G1I A;  2PEO A;  2LIW A;  2K0X A;  3MGE A;  2LPK A;  1EMV A;  2K2Q A;  3DTJ A;  2XV6 A;  2EHT A;  3G71 P;  2EIA A;  1N8R Q;  4BPH A;  4IZ6 A;  5F2K A;  1VQL P;  3G21 A;  2FVF A;  1ACP A;  3I55 P;  2KGC A;  2OTJ P;  1ZMB A;  3CMA P;  1KD1 Q;  2Z45 A;  2KG9 A;  3GZL A;  1VQN P;  3RG6 C;  5HGN A;  1A43 A;  1Q82 Q;  2PEN A;  5BS1 A;  3CCS P;  2LIU A;  3CC4 P;  3H47 A;  1HY8 A;  1L0H A;  5KP8 B;  4H2Y C;  2QA4 P;  2BUO A;  4COC A;  1QVG O;  1KLP A;  3HZQ A;  3E2D A;  2L6E A;  2PNG A;  3CCE P;  1W2B O;  1K30 A;  2WPT A;  1YIT P;  5HGL A;  3B4Q A;  2ROQ A;  4UHP B;  1VQ4 P;  3EJB A;  1IUQ A;  3LRY A;  5EJD A;  3U43 A;  2N98 A;  5KP6 B;  2OAR A;  2M8P A;  1ZNV A;  2PEI A;  1GPJ A;  2MY5 A;  2JGP A;  2GZJ A;  2KOQ A;  3DS0 A;  4HKG A;  3DS2 A;  1NQ4 A;  1RO2 A;  4H2W C;  1DNY A;  3OW2 O;  5I4T G;  1QRJ A;  2L22 A;  1M74 A;  1GXG A;  2GDX A;  2GZE A;  4WYM A;  2L9F A;  4U0E A;  4XFY A;  4BPG A;  1OR5 A;  1AYI A;  3I56 P;  2LF4 A;  1RO0 A;  1YJ9 P;  3G6E P;  2JB0 A;  2K94 A;  2N6Y A;  3CXC O;  1Z6M A;  3GJN A;  5HGO A;  2AVA A;  4PH0 A;  2PEM A;  2XZ0 D; 
#chains in the Genus database with same CATH homology
 2KOR A;  2LML A;  2KG8 A;  2KOP A;  3GZL A;  2MR7 A;  1T8K A;  2N5H A;  1F80 D;  2CQ8 A;  2FQ2 A;  2KR5 A;  2LIU A;  5CZD B;  2LKI A;  2LTE A;  1HY8 A;  2AFD A;  2JU2 A;  1L0H A;  5KP8 B;  2KWL A;  2KG6 A;  2M5R A;  4H2Y C;  2CGQ A;  2N5I A;  1KLP A;  4PXH B;  2FAE A;  4MRT C;  3RG2 A;  2FVA A;  2AFE A;  5HVC A;  2PNG A;  2FAC A;  2DNW A;  2KW2 A;  3NY7 B;  1AF8 A;  1HQB A;  4R0M A;  2FVE A;  2KGA A;  4PWV B;  2L0Q A;  2MR8 A;  2KOS A;  2ROQ A;  3EJB A;  3GZM A;  5EJD A;  2MVV A;  2L4B A;  1DV5 A;  2N98 A;  5KP6 B;  2LL8 A;  2FHS C;  1X3O A;  2KOO A;  3CE7 A;  2MY5 A;  2MF4 A;  2JGP A;  2KGD A;  2LOL A;  2GDW A;  2KOQ A;  4HKG A;  4CA3 A;  1NQ4 A;  2QNW A;  2CG5 B;  2K92 A;  4H2W C;  1DNY A;  4H2X C;  5KP7 B;  2JQ4 A;  2JU1 A;  1VKU A;  2CNR A;  2GDY A;  3EJD A;  3LMO A;  2L22 A;  2LIW A;  2K0X A;  2XZ1 C;  3EJE A;  2LPK A;  2GDX A;  2K2Q A;  2KGE A;  2FQ1 A;  2EHT A;  2L9F A;  4BPG A;  2N50 A;  1OR5 A;  2MD9 A;  2FAD A;  5HV8 A;  2X2B A;  4BPH A;  4IZ6 A;  4DG9 A;  4NEO A;  2K94 A;  2N6Y A;  2VSQ A;  2K93 A;  4BPF A;  2N6Z A;  2FVF A;  2FQ0 A;  1ACP A;  2KGC A;  2AVA A;  2MVU A;  2AF8 A;  2EHS A;  1L0I A;  2K0Y A;  2KG9 A;  2XZ0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...