2KOQA

Nmr solution structures of 3-hydroxyoctanoyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
molecule keywords Acyl carrier protein
total genus 24
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2koqA00
2FHSC 1DNYA 3CE7A 2L4BA 2L0QA 2FQ2A 2XZ1C 2CNRA 2KOPA 3EJBA 2KOSA 2X2BA 1HY8A 2KR5A 5HV8A 4IZ6A 1ACPA 2FVAA 2KOQA 2MVVA 2AFEA 4CA3A 2FVFA 2K0XA 2LKIA 5EJDA 2AF8A 2N6ZA 2N98A 5KP7B 2N5IA 2CQ8A 2GDXA 2FACA 2FAEA 4MRTC 4BPFA 2L9FA 2LOLA 1OR5A 4R0MA 2JU1A 2KORA 2LTEA 2MF4A 1L0IA 1F80D 2JU2A 2K93A 2MY5A 2N50A 2LIUA 2KGAA 2AVAA 4H2XC 4H2YC 3NY7B 1L0HA 5CZDB 4PWVB 1KLPA 1T8KA 1NQ4A 2KG9A 5KP8B 2FADA 2GDWA 2JGPA 2KWLA 2N5HA 2K94A 2L22A 3GZMA 2K0YA 2MR8A 2GDYA 2KG8A 2PNGA 3RG2A 1X3OA 2MR7A 4DG9A 2CGQA 2K92A 2KG6A 3GZLA 4H2WC 4NEOA 2CG5B 1HQBA 4BPGA 2FQ0A 2M5RA 1DV5A 1VKUA 5HVCA 2FQ1A 2KGCA 2KGDA 2LIWA 2XZ0D 3EJDA 2KW2A 4HKGA 2MVUA 2LPKA 4PXHB 2EHSA 5KP6B 2DNWA 1AF8A 2AFDA 2LL8A 2MD9A 2JQ4A 2N6YA 2EHTA 2KGEA 2KOOA 4BPHA 2QNWA 2FVEA 2VSQA 2K2QA 2LMLA 2ROQA 3LMOA 3EJEA
chains in the Genus database with same CATH superfamily
1YJWP 2L4BA 3M1MA 1EOQA 2JO0A 1EMVA 2PEJA 1EIAA 2X2BA 1JJ2O 2GZFA 3DS3A 4IZ6A 1YIJP 1M74A 3DS5A 1VHNA 2GYKA 1YJ9P 1VQ4P 5I4TG 1BAJA 3GKLC 2QA4P 1M1KQ 2OTLP 2FAEA 4MRTC 1VQKP 4XROA 4R0MA 2KORA 2Z45A 3CCMP 2JU2A 2ERHA 1VQ8P 2K93A 2MY5A 2N50A 3CC2P 3B4QA 2AVAA 2K0DX 3H0DA 4H2YC 3DTJA 3H47A 4QNBA 4PWVB 4U0AA 1NQ4A 3CD6P 3CC7P 2N5HA 1VQOP 1VQ6P 1FR2A 1X3OA 3G29A 4XFXA 4DG9A 2CGQA 3GZLA 1M90Q 4NEOA 1YI2P 2CG5B 2EIAA 1RO2A 4WYMA 4BPGA 5HVCA 2KGCA 2OTJP 2MVUA 4XFYA 3CCQP 1AF8A 4M0IA 1Q7YQ 2LL8A 2PENA 1KQSO 1W2BO 4U0EA 2LMLA 2DGYA 3CMAP 1GXHA 1DNYA 3CE7A 1KD1Q 1NJIQ 2CNRA 2KOSA 3CCLP 3CMEP 1HY8A 2KR5A 1ACPA 2KOQA 1IMPA 2AFEA 4CA3A 4UHPB 1Q82Q 2LKIA 2VLOA 2AF8A 2N6ZA 1AUMA 2N5IA 2CQ8A 3G71P 1VQPP 2GDXA 2GZJA 3G1IA 3I55P 2L9FA 1OR5A 1GPJA 3E2DA 2JU1A 3CCRP 2MF4A 1QVFO 3CXCO 4IPYA 1RO0A 3NY7B 2JYGA 3OW2O 1KLPA 1T8KA 4COCA 5KP8B 2GDWA 2OARA 2L22A 3GZMA 4GR6A 3G1GA 3NTEA 2KG8A 2MR8A 3CCSP 2MR7A 4H2WC 1K9MQ 1VQMP 2VLNA 1VQ5P 1VKUA 2KODA 5HGMA 2BUOA 3HYBA 2VLQA 2PEKA 3DPHA 2L6EA 3DS4A 2EHTA 1ZMBA 2XXMA 2WPTA 1BXIA 3VRLC 4PH1A 1E0HA 2EFJA 4U0FA 2FHSC 3MGEA 4XRQA 2XZ1C 3EJBA 3GJNA 2GZEA 1S72P 2MVVA 1Q81Q 2QEXP 2K0XA 3CCJP 3G21A 5JPAA 2XV6A 3WBHA 3CCVP 3DS0A 2Z44A 2M8NA 2FACA 5EW5E 1VQLP 2ONTA 4BPFA 1ZNVA 1AYIA 1F80D 1UJZA 1YITP 1KC8Q 2GZIA 2LIUA 4GR2A 2PEQA 1N8RQ 2KG9A 2E1MA 4F37A 2M8PA 3CCEP 3I56P 2K0YA 3G6EP 1VQNP 3RG2A 2CWOA 2PEIA 2PEOA 2JB0A 3G28A 1YHQP 2PY8A 2FQ0A 2M5RA 1VQ7P 2FQ1A 2KGDA 3B5IA 2LIWA 2XZ0D 3EJDA 2KW2A 4PXHB 2EHSA 5KP6B 2EG5A 2DNWA 2K5XA 2MD9A 2BHVA 4U0CA 5HGLA 1IUQA 2N6YA 1A8OA 2KGEA 2NO8A 2KOOA 2FVEA 2VSQA 2ROQA 5DCKA 3DS1A 4PH0A 2M8LA 3G4SP 3CCUP 3LRYA 5F2OA 4QKOA 1GXGA 2L0QA 2LF4A 2P9XA 2FQ2A 2KOPA 2XT1A 1CEIA 3CPWO 4U0DA 5HV8A 2FVAA 2JAZA 1K8AQ 2FVFA 5HGNA 5EJDA 3DS2A 2N98A 5KP7B 4U0BA 1Z6MA 2VLPA 1IMQA 5BS1A 2LOLA 2LTEA 1L0IA 4COPA 3G0VA 7CEIA 2KGAA 1UNKA 2GZGA 3H4EA 4H2XC 3CC4P 1K73Q 1L0HA 5CZDB 2FADA 2JGPA 2KWLA 2K94A 2JYLA 2GDYA 2PNGA 1Q86Q 1A43A 3RG6C 1QRJA 5BS2A 1K30A 2K92A 2KG6A 1VQ9P 1RNIA 2JBGA 5F2NA 1M6NA 3G26A 5HGOA 1HQBA 1MZ8A 5F2KA 1DV5A 1M6EX 4HKGA 2LPKA 3Q20A 1E6JP 3U43A 2AFDA 2JQ4A 4XFZA 1YJNP 1QVGO 3HZQA 4BPHA 2QNWA 3P05A 2K2QA 2Z46A 1D1DA 3LMOA 2PEMA 3EJEA
chains in the Genus database with same CATH topology
2FHSC 1DNYA 3CE7A 2L4BA 2L0QA 2FQ2A 2XZ1C 2CNRA 2KOPA 3EJBA 2KOSA 2X2BA 1HY8A 2KR5A 5HV8A 4IZ6A 1ACPA 2FVAA 2KOQA 2MVVA 2AFEA 4CA3A 2FVFA 2K0XA 2LKIA 5EJDA 2AF8A 2N6ZA 2N98A 5KP7B 2N5IA 2CQ8A 2GDXA 2FACA 2FAEA 4MRTC 4BPFA 2L9FA 2LOLA 1OR5A 4R0MA 2JU1A 2KORA 2LTEA 2MF4A 1L0IA 1F80D 2JU2A 2K93A 2MY5A 2N50A 2LIUA 2KGAA 2AVAA 4H2XC 4H2YC 3NY7B 1L0HA 5CZDB 4PWVB 1KLPA 1T8KA 1NQ4A 2KG9A 5KP8B 2FADA 2GDWA 2JGPA 2KWLA 2N5HA 2K94A 2L22A 3GZMA 2K0YA 2MR8A 2GDYA 2KG8A 2PNGA 3RG2A 1X3OA 2MR7A 4DG9A 2CGQA 2K92A 2KG6A 3GZLA 4H2WC 4NEOA 2CG5B 1HQBA 4BPGA 2FQ0A 2M5RA 1DV5A 1VKUA 5HVCA 2FQ1A 2KGCA 2KGDA 2LIWA 2XZ0D 3EJDA 2KW2A 4HKGA 2MVUA 2LPKA 4PXHB 2EHSA 5KP6B 2DNWA 1AF8A 2AFDA 2LL8A 2MD9A 2JQ4A 2N6YA 2EHTA 2KGEA 2KOOA 4BPHA 2QNWA 2FVEA 2VSQA 2K2QA 2LMLA 2ROQA 3LMOA 3EJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHS C;  1DNY A;  3CE7 A;  2L4B A;  2L0Q A;  2FQ2 A;  2XZ1 C;  2CNR A;  2KOP A;  3EJB A;  2KOS A;  2X2B A;  1HY8 A;  2KR5 A;  5HV8 A;  4IZ6 A;  1ACP A;  2FVA A;  2KOQ A;  2MVV A;  2AFE A;  4CA3 A;  2FVF A;  2K0X A;  2LKI A;  5EJD A;  2AF8 A;  2N6Z A;  2N98 A;  5KP7 B;  2N5I A;  2CQ8 A;  2GDX A;  2FAC A;  2FAE A;  4MRT C;  4BPF A;  2L9F A;  2LOL A;  1OR5 A;  4R0M A;  2JU1 A;  2KOR A;  2LTE A;  2MF4 A;  1L0I A;  1F80 D;  2JU2 A;  2K93 A;  2MY5 A;  2N50 A;  2LIU A;  2KGA A;  2AVA A;  4H2X C;  4H2Y C;  3NY7 B;  1L0H A;  5CZD B;  4PWV B;  1KLP A;  1T8K A;  1NQ4 A;  2KG9 A;  5KP8 B;  2FAD A;  2GDW A;  2JGP A;  2KWL A;  2N5H A;  2K94 A;  2L22 A;  3GZM A;  2K0Y A;  2MR8 A;  2GDY A;  2KG8 A;  2PNG A;  3RG2 A;  1X3O A;  2MR7 A;  4DG9 A;  2CGQ A;  2K92 A;  2KG6 A;  3GZL A;  4H2W C;  4NEO A;  2CG5 B;  1HQB A;  4BPG A;  2FQ0 A;  2M5R A;  1DV5 A;  1VKU A;  5HVC A;  2FQ1 A;  2KGC A;  2KGD A;  2LIW A;  2XZ0 D;  3EJD A;  2KW2 A;  4HKG A;  2MVU A;  2LPK A;  4PXH B;  2EHS A;  5KP6 B;  2DNW A;  1AF8 A;  2AFD A;  2LL8 A;  2MD9 A;  2JQ4 A;  2N6Y A;  2EHT A;  2KGE A;  2KOO A;  4BPH A;  2QNW A;  2FVE A;  2VSQ A;  2K2Q A;  2LML A;  2ROQ A;  3LMO A;  3EJE A; 
#chains in the Genus database with same CATH topology
 1YJW P;  2L4B A;  3M1M A;  1EOQ A;  2JO0 A;  1EMV A;  2PEJ A;  1EIA A;  2X2B A;  1JJ2 O;  2GZF A;  3DS3 A;  4IZ6 A;  1YIJ P;  1M74 A;  3DS5 A;  1VHN A;  2GYK A;  1YJ9 P;  1VQ4 P;  5I4T G;  1BAJ A;  3GKL C;  2QA4 P;  1M1K Q;  2OTL P;  2FAE A;  4MRT C;  1VQK P;  4XRO A;  4R0M A;  2KOR A;  2Z45 A;  3CCM P;  2JU2 A;  2ERH A;  1VQ8 P;  2K93 A;  2MY5 A;  2N50 A;  3CC2 P;  3B4Q A;  2AVA A;  2K0D X;  3H0D A;  4H2Y C;  3DTJ A;  3H47 A;  4QNB A;  4PWV B;  4U0A A;  1NQ4 A;  3CD6 P;  3CC7 P;  2N5H A;  1VQO P;  1VQ6 P;  1FR2 A;  1X3O A;  3G29 A;  4XFX A;  4DG9 A;  2CGQ A;  3GZL A;  1M90 Q;  4NEO A;  1YI2 P;  2CG5 B;  2EIA A;  1RO2 A;  4WYM A;  4BPG A;  5HVC A;  2KGC A;  2OTJ P;  2MVU A;  4XFY A;  3CCQ P;  1AF8 A;  4M0I A;  1Q7Y Q;  2LL8 A;  2PEN A;  1KQS O;  1W2B O;  4U0E A;  2LML A;  2DGY A;  3CMA P;  1GXH A;  1DNY A;  3CE7 A;  1KD1 Q;  1NJI Q;  2CNR A;  2KOS A;  3CCL P;  3CME P;  1HY8 A;  2KR5 A;  1ACP A;  2KOQ A;  1IMP A;  2AFE A;  4CA3 A;  4UHP B;  1Q82 Q;  2LKI A;  2VLO A;  2AF8 A;  2N6Z A;  1AUM A;  2N5I A;  2CQ8 A;  3G71 P;  1VQP P;  2GDX A;  2GZJ A;  3G1I A;  3I55 P;  2L9F A;  1OR5 A;  1GPJ A;  3E2D A;  2JU1 A;  3CCR P;  2MF4 A;  1QVF O;  3CXC O;  4IPY A;  1RO0 A;  3NY7 B;  2JYG A;  3OW2 O;  1KLP A;  1T8K A;  4COC A;  5KP8 B;  2GDW A;  2OAR A;  2L22 A;  3GZM A;  4GR6 A;  3G1G A;  3NTE A;  2KG8 A;  2MR8 A;  3CCS P;  2MR7 A;  4H2W C;  1K9M Q;  1VQM P;  2VLN A;  1VQ5 P;  1VKU A;  2KOD A;  5HGM A;  2BUO A;  3HYB A;  2VLQ A;  2PEK A;  3DPH A;  2L6E A;  3DS4 A;  2EHT A;  1ZMB A;  2XXM A;  2WPT A;  1BXI A;  3VRL C;  4PH1 A;  1E0H A;  2EFJ A;  4U0F A;  2FHS C;  3MGE A;  4XRQ A;  2XZ1 C;  3EJB A;  3GJN A;  2GZE A;  1S72 P;  2MVV A;  1Q81 Q;  2QEX P;  2K0X A;  3CCJ P;  3G21 A;  5JPA A;  2XV6 A;  3WBH A;  3CCV P;  3DS0 A;  2Z44 A;  2M8N A;  2FAC A;  5EW5 E;  1VQL P;  2ONT A;  4BPF A;  1ZNV A;  1AYI A;  1F80 D;  1UJZ A;  1YIT P;  1KC8 Q;  2GZI A;  2LIU A;  4GR2 A;  2PEQ A;  1N8R Q;  2KG9 A;  2E1M A;  4F37 A;  2M8P A;  3CCE P;  3I56 P;  2K0Y A;  3G6E P;  1VQN P;  3RG2 A;  2CWO A;  2PEI A;  2PEO A;  2JB0 A;  3G28 A;  1YHQ P;  2PY8 A;  2FQ0 A;  2M5R A;  1VQ7 P;  2FQ1 A;  2KGD A;  3B5I A;  2LIW A;  2XZ0 D;  3EJD A;  2KW2 A;  4PXH B;  2EHS A;  5KP6 B;  2EG5 A;  2DNW A;  2K5X A;  2MD9 A;  2BHV A;  4U0C A;  5HGL A;  1IUQ A;  2N6Y A;  1A8O A;  2KGE A;  2NO8 A;  2KOO A;  2FVE A;  2VSQ A;  2ROQ A;  5DCK A;  3DS1 A;  4PH0 A;  2M8L A;  3G4S P;  3CCU P;  3LRY A;  5F2O A;  4QKO A;  1GXG A;  2L0Q A;  2LF4 A;  2P9X A;  2FQ2 A;  2KOP A;  2XT1 A;  1CEI A;  3CPW O;  4U0D A;  5HV8 A;  2FVA A;  2JAZ A;  1K8A Q;  2FVF A;  5HGN A;  5EJD A;  3DS2 A;  2N98 A;  5KP7 B;  4U0B A;  1Z6M A;  2VLP A;  1IMQ A;  5BS1 A;  2LOL A;  2LTE A;  1L0I A;  4COP A;  3G0V A;  7CEI A;  2KGA A;  1UNK A;  2GZG A;  3H4E A;  4H2X C;  3CC4 P;  1K73 Q;  1L0H A;  5CZD B;  2FAD A;  2JGP A;  2KWL A;  2K94 A;  2JYL A;  2GDY A;  2PNG A;  1Q86 Q;  1A43 A;  3RG6 C;  1QRJ A;  5BS2 A;  1K30 A;  2K92 A;  2KG6 A;  1VQ9 P;  1RNI A;  2JBG A;  5F2N A;  1M6N A;  3G26 A;  5HGO A;  1HQB A;  1MZ8 A;  5F2K A;  1DV5 A;  1M6E X;  4HKG A;  2LPK A;  3Q20 A;  1E6J P;  3U43 A;  2AFD A;  2JQ4 A;  4XFZ A;  1YJN P;  1QVG O;  3HZQ A;  4BPH A;  2QNW A;  3P05 A;  2K2Q A;  2Z46 A;  1D1D A;  3LMO A;  2PEM A;  3EJE A; 
#chains in the Genus database with same CATH homology
 2FHS C;  1DNY A;  3CE7 A;  2L4B A;  2L0Q A;  2FQ2 A;  2XZ1 C;  2CNR A;  2KOP A;  3EJB A;  2KOS A;  2X2B A;  1HY8 A;  2KR5 A;  5HV8 A;  4IZ6 A;  1ACP A;  2FVA A;  2KOQ A;  2MVV A;  2AFE A;  4CA3 A;  2FVF A;  2K0X A;  2LKI A;  5EJD A;  2AF8 A;  2N6Z A;  2N98 A;  5KP7 B;  2N5I A;  2CQ8 A;  2GDX A;  2FAC A;  2FAE A;  4MRT C;  4BPF A;  2L9F A;  2LOL A;  1OR5 A;  4R0M A;  2JU1 A;  2KOR A;  2LTE A;  2MF4 A;  1L0I A;  1F80 D;  2JU2 A;  2K93 A;  2MY5 A;  2N50 A;  2LIU A;  2KGA A;  2AVA A;  4H2X C;  4H2Y C;  3NY7 B;  1L0H A;  5CZD B;  4PWV B;  1KLP A;  1T8K A;  1NQ4 A;  2KG9 A;  5KP8 B;  2FAD A;  2GDW A;  2JGP A;  2KWL A;  2N5H A;  2K94 A;  2L22 A;  3GZM A;  2K0Y A;  2MR8 A;  2GDY A;  2KG8 A;  2PNG A;  3RG2 A;  1X3O A;  2MR7 A;  4DG9 A;  2CGQ A;  2K92 A;  2KG6 A;  3GZL A;  4H2W C;  4NEO A;  2CG5 B;  1HQB A;  4BPG A;  2FQ0 A;  2M5R A;  1DV5 A;  1VKU A;  5HVC A;  2FQ1 A;  2KGC A;  2KGD A;  2LIW A;  2XZ0 D;  3EJD A;  2KW2 A;  4HKG A;  2MVU A;  2LPK A;  4PXH B;  2EHS A;  5KP6 B;  2DNW A;  1AF8 A;  2AFD A;  2LL8 A;  2MD9 A;  2JQ4 A;  2N6Y A;  2EHT A;  2KGE A;  2KOO A;  4BPH A;  2QNW A;  2FVE A;  2VSQ A;  2K2Q A;  2LML A;  2ROQ A;  3LMO A;  3EJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...