2KOQA

Nmr solution structures of 3-hydroxyoctanoyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
b'AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
total genus 24
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2koqA00
4CA3A 4PWVB 2FQ0A 2CG5B 2LKIA 3EJDA 2EHSA 5CZDB 2KR5A 2L9FA 2N6ZA 2KWLA 5KP7B 2CQ8A 2AVAA 4MRTC 1VKUA 2XZ0D 2KOSA 2LL8A 2FACA 2M5RA 2FQ2A 2KG9A 2JU2A 2AFDA 2LIWA 2N6YA 3NY7B 2KG8A 2N50A 1F80D 3GZLA 4PXHB 2L22A 1L0HA 1HQBA 5EJDA 2MF4A 5KP8B 4DG9A 2MVVA 1OR5A 2JGPA 2K92A 2K2QA 2L0QA 5HVCA 2GDYA 4IZ6A 4HKGA 1T8KA 2N5HA 2FVFA 2AF8A 2FVEA 1AF8A 2LMLA 2XZ1C 3LMOA 2LPKA 1X3OA 1L0IA 2DNWA 2KW2A 3EJEA 2MY5A 2GDXA 2AFEA 4R0MA 2KGEA 2MD9A 2JU1A 1DV5A 2CNRA 4H2YC 4H2WC 4H2XC 4NEOA 2L4BA 2LIUA 2N98A 1KLPA 1ACPA 2FADA 2PNGA 2K94A 2KOPA 2MR8A 5KP6B 2MVUA 2K0XA 2KGDA 2ROQA 2KGCA 2K93A 2EHTA 2KGAA 2FHSC 1NQ4A 5HV8A 2CGQA 3EJBA 3RG2A 4BPFA 2QNWA 2VSQA 2FAEA 4BPHA 2LOLA 3GZMA 2GDWA 1HY8A 1DNYA 2FVAA 2MR7A 4BPGA 2X2BA 2KORA 2K0YA 2KOOA 2FQ1A 2KG6A 2JQ4A 2N5IA 2LTEA 2KOQA 3CE7A
chains in the Genus database with same CATH superfamily
4CA3A 4PWVB 1EOQA 3H47A 2JAZA 2EHSA 5CZDB 1CEIA 2GZEA 2JYGA 2CQ8A 3G4SP 4MRTC 1QRJA 1AUMA 2N50A 3GZLA 1E0HA 1Q7YQ 1N8RQ 3WBHA 1RNIA 2JO0A 2VLPA 2M8LA 3CCVP 3CMAP 2PEKA 1K9MQ 2FVEA 2LMLA 2JYLA 2Z46A 2PEOA 1L0IA 4COPA 1Q82Q 2MY5A 2AFEA 3G0VA 1VQKP 4XROA 2M8PA 3DS1A 1DV5A 4XFYA 1W2BO 1Q86Q 1Z6MA 1KD1Q 1KLPA 2WPTA 1VQLP 3G1GA 2FADA 2PNGA 3CC7P 3B5IA 2K94A 2MR8A 5KP6B 2PENA 1VHNA 1AYIA 2ROQA 1A43A 5HV8A 3EJBA 3I55P 2PEQA 2LOLA 2PY8A 2GDWA 1M6EX 1VQ7P 2FVAA 2QA4P 1GXGA 1ZMBA 4BPGA 2X2BA 2KOOA 2LF4A 1VQNP 1S72P 3DS5A 2JQ4A 3M1MA 5DCKA 2KOQA 1M74A 4U0EA 3DS0A 2BHVA 2GZFA 1M1KQ 1UNKA 3G71P 1A8OA 2E1MA 1QVGO 2M8NA 2VLNA 3CCQP 4COCA 2GZGA 1RO2A 3CC4P 1M90Q 2AFDA 3NY7B 2OARA 1YI2P 2CWOA 2KG8A 1YJNP 2L22A 1L0HA 5EJDA 3E2DA 2MF4A 2KODA 4DG9A 1OR5A 2JGPA 2K2QA 2L0QA 4HKGA 1T8KA 2N5HA 3G1IA 4XFXA 2JBGA 1AF8A 3LMOA 1KC8Q 2LPKA 3G28A 2DNWA 2GDXA 4R0MA 2MD9A 3CCSP 4QKOA 4U0BA 1BXIA 1GXHA 3DS4A 1RO0A 1VQ5P 1VQPP 2MVUA 2XXMA 2K0XA 4IPYA 2K93A 2EHTA 2KGAA 3LRYA 2L6EA 3RG6C 3Q20A 3DPHA 3RG2A 2VSQA 7CEIA 1IUQA 3GZMA 2GZIA 4U0AA 4M0IA 3G26A 2XV6A 2MR7A 1JJ2O 1IMPA 1NJIQ 2XT1A 2K0YA 3GJNA 2FQ1A 2N5IA 2P9XA 1K73Q 2GZJA 2FQ0A 5HGOA 1GPJA 4U0FA 1MZ8A 5KP7B 1VQ8P 2AVAA 1YJWP 5I4TG 1VKUA 2KOSA 1VQ9P 2M5RA 2DGYA 2FQ2A 1FR2A 2KG9A 5BS1A 2JU2A 1QVFO 4PXHB 1K8AQ 1HQBA 3DS2A 3H4EA 2GDYA 2EG5A 2EFJA 4IZ6A 4UHPB 2Z44A 2K0DX 2AF8A 1D1DA 3G21A 1X3OA 1BAJA 2KW2A 1VQOP 2KGEA 1ZNVA 2CNRA 5EW5E 2PEIA 1K30A 1M6NA 2ONTA 4F37A 3CCMP 3CCRP 3CCJP 1VQ4P 2K5XA 1YHQP 4GR6A 1IMQA 2FHSC 1NQ4A 1UJZA 5HGNA 2CGQA 3P05A 3NTEA 4BPFA 3HZQA 2FAEA 2NO8A 2OTJP 5F2KA 1HY8A 2QEXP 1DNYA 2ERHA 3CCEP 5JPAA 2VLOA 1YIJP 2KORA 4WYMA 2JB0A 3GKLC 2KG6A 5HGMA 2LTEA 1EMVA 1VQMP 3CE7A 5HGLA 3CMEP 5F2NA 2CG5B 2LKIA 3EJDA 3B4QA 4XFZA 2BUOA 2KR5A 2L9FA 2N6ZA 2KWLA 3CC2P 2XZ0D 2LL8A 2FACA 2GYKA 5F2OA 2LIWA 2N6YA 3U43A 1F80D 3DTJA 5KP8B 3CPWO 2MVVA 4XRQA 2K92A 5HVCA 1YJ9P 3CXCO 2FVFA 4PH0A 3OW2O 2XZ1C 3CD6P 3CCLP 4GR2A 3EJEA 3G29A 2JU1A 4H2YC 4H2WC 4H2XC 4NEOA 2L4BA 2LIUA 2OTLP 4U0CA 2N98A 1ACPA 4PH1A 1YITP 2KOPA 2EIAA 3CCUP 3VRLC 2KGDA 2KGCA 3H0DA 1E6JP 1KQSO 1VQ6P 2Z45A 2VLQA 3I56P 2QNWA 4U0DA 4BPHA 2PEMA 1EIAA 3MGEA 3DS3A 4QNBA 3HYBA 1Q81Q 5BS2A 3G6EP 2PEJA
chains in the Genus database with same CATH topology
4CA3A 4PWVB 2FQ0A 2CG5B 2LKIA 3EJDA 2EHSA 5CZDB 2KR5A 2L9FA 2N6ZA 2KWLA 5KP7B 2CQ8A 2AVAA 4MRTC 1VKUA 2XZ0D 2KOSA 2LL8A 2FACA 2M5RA 2FQ2A 2KG9A 2JU2A 2AFDA 2LIWA 2N6YA 3NY7B 2KG8A 2N50A 1F80D 3GZLA 4PXHB 2L22A 1L0HA 1HQBA 5EJDA 2MF4A 5KP8B 4DG9A 2MVVA 1OR5A 2JGPA 2K92A 2K2QA 2L0QA 5HVCA 2GDYA 4IZ6A 4HKGA 1T8KA 2N5HA 2FVFA 2AF8A 2FVEA 1AF8A 2LMLA 2XZ1C 3LMOA 2LPKA 1X3OA 1L0IA 2DNWA 2KW2A 3EJEA 2MY5A 2GDXA 2AFEA 4R0MA 2KGEA 2MD9A 2JU1A 1DV5A 2CNRA 4H2YC 4H2WC 4H2XC 4NEOA 2L4BA 2LIUA 2N98A 1KLPA 1ACPA 2FADA 2PNGA 2K94A 2KOPA 2MR8A 5KP6B 2MVUA 2K0XA 2KGDA 2ROQA 2KGCA 2K93A 2EHTA 2KGAA 2FHSC 1NQ4A 5HV8A 2CGQA 3EJBA 3RG2A 4BPFA 2QNWA 2VSQA 2FAEA 4BPHA 2LOLA 3GZMA 2GDWA 1HY8A 1DNYA 2FVAA 2MR7A 4BPGA 2X2BA 2KORA 2K0YA 2KOOA 2FQ1A 2KG6A 2JQ4A 2N5IA 2LTEA 2KOQA 3CE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CA3 A;  4PWV B;  2FQ0 A;  2CG5 B;  2LKI A;  3EJD A;  2EHS A;  5CZD B;  2KR5 A;  2L9F A;  2N6Z A;  2KWL A;  5KP7 B;  2CQ8 A;  2AVA A;  4MRT C;  1VKU A;  2XZ0 D;  2KOS A;  2LL8 A;  2FAC A;  2M5R A;  2FQ2 A;  2KG9 A;  2JU2 A;  2AFD A;  2LIW A;  2N6Y A;  3NY7 B;  2KG8 A;  2N50 A;  1F80 D;  3GZL A;  4PXH B;  2L22 A;  1L0H A;  1HQB A;  5EJD A;  2MF4 A;  5KP8 B;  4DG9 A;  2MVV A;  1OR5 A;  2JGP A;  2K92 A;  2K2Q A;  2L0Q A;  5HVC A;  2GDY A;  4IZ6 A;  4HKG A;  1T8K A;  2N5H A;  2FVF A;  2AF8 A;  2FVE A;  1AF8 A;  2LML A;  2XZ1 C;  3LMO A;  2LPK A;  1X3O A;  1L0I A;  2DNW A;  2KW2 A;  3EJE A;  2MY5 A;  2GDX A;  2AFE A;  4R0M A;  2KGE A;  2MD9 A;  2JU1 A;  1DV5 A;  2CNR A;  4H2Y C;  4H2W C;  4H2X C;  4NEO A;  2L4B A;  2LIU A;  2N98 A;  1KLP A;  1ACP A;  2FAD A;  2PNG A;  2K94 A;  2KOP A;  2MR8 A;  5KP6 B;  2MVU A;  2K0X A;  2KGD A;  2ROQ A;  2KGC A;  2K93 A;  2EHT A;  2KGA A;  2FHS C;  1NQ4 A;  5HV8 A;  2CGQ A;  3EJB A;  3RG2 A;  4BPF A;  2QNW A;  2VSQ A;  2FAE A;  4BPH A;  2LOL A;  3GZM A;  2GDW A;  1HY8 A;  1DNY A;  2FVA A;  2MR7 A;  4BPG A;  2X2B A;  2KOR A;  2K0Y A;  2KOO A;  2FQ1 A;  2KG6 A;  2JQ4 A;  2N5I A;  2LTE A;  2KOQ A;  3CE7 A; 
#chains in the Genus database with same CATH topology
 4CA3 A;  4PWV B;  1EOQ A;  3H47 A;  2JAZ A;  2EHS A;  5CZD B;  1CEI A;  2GZE A;  2JYG A;  2CQ8 A;  3G4S P;  4MRT C;  1QRJ A;  1AUM A;  2N50 A;  3GZL A;  1E0H A;  1Q7Y Q;  1N8R Q;  3WBH A;  1RNI A;  2JO0 A;  2VLP A;  2M8L A;  3CCV P;  3CMA P;  2PEK A;  1K9M Q;  2FVE A;  2LML A;  2JYL A;  2Z46 A;  2PEO A;  1L0I A;  4COP A;  1Q82 Q;  2MY5 A;  2AFE A;  3G0V A;  1VQK P;  4XRO A;  2M8P A;  3DS1 A;  1DV5 A;  4XFY A;  1W2B O;  1Q86 Q;  1Z6M A;  1KD1 Q;  1KLP A;  2WPT A;  1VQL P;  3G1G A;  2FAD A;  2PNG A;  3CC7 P;  3B5I A;  2K94 A;  2MR8 A;  5KP6 B;  2PEN A;  1VHN A;  1AYI A;  2ROQ A;  1A43 A;  5HV8 A;  3EJB A;  3I55 P;  2PEQ A;  2LOL A;  2PY8 A;  2GDW A;  1M6E X;  1VQ7 P;  2FVA A;  2QA4 P;  1GXG A;  1ZMB A;  4BPG A;  2X2B A;  2KOO A;  2LF4 A;  1VQN P;  1S72 P;  3DS5 A;  2JQ4 A;  3M1M A;  5DCK A;  2KOQ A;  1M74 A;  4U0E A;  3DS0 A;  2BHV A;  2GZF A;  1M1K Q;  1UNK A;  3G71 P;  1A8O A;  2E1M A;  1QVG O;  2M8N A;  2VLN A;  3CCQ P;  4COC A;  2GZG A;  1RO2 A;  3CC4 P;  1M90 Q;  2AFD A;  3NY7 B;  2OAR A;  1YI2 P;  2CWO A;  2KG8 A;  1YJN P;  2L22 A;  1L0H A;  5EJD A;  3E2D A;  2MF4 A;  2KOD A;  4DG9 A;  1OR5 A;  2JGP A;  2K2Q A;  2L0Q A;  4HKG A;  1T8K A;  2N5H A;  3G1I A;  4XFX A;  2JBG A;  1AF8 A;  3LMO A;  1KC8 Q;  2LPK A;  3G28 A;  2DNW A;  2GDX A;  4R0M A;  2MD9 A;  3CCS P;  4QKO A;  4U0B A;  1BXI A;  1GXH A;  3DS4 A;  1RO0 A;  1VQ5 P;  1VQP P;  2MVU A;  2XXM A;  2K0X A;  4IPY A;  2K93 A;  2EHT A;  2KGA A;  3LRY A;  2L6E A;  3RG6 C;  3Q20 A;  3DPH A;  3RG2 A;  2VSQ A;  7CEI A;  1IUQ A;  3GZM A;  2GZI A;  4U0A A;  4M0I A;  3G26 A;  2XV6 A;  2MR7 A;  1JJ2 O;  1IMP A;  1NJI Q;  2XT1 A;  2K0Y A;  3GJN A;  2FQ1 A;  2N5I A;  2P9X A;  1K73 Q;  2GZJ A;  2FQ0 A;  5HGO A;  1GPJ A;  4U0F A;  1MZ8 A;  5KP7 B;  1VQ8 P;  2AVA A;  1YJW P;  5I4T G;  1VKU A;  2KOS A;  1VQ9 P;  2M5R A;  2DGY A;  2FQ2 A;  1FR2 A;  2KG9 A;  5BS1 A;  2JU2 A;  1QVF O;  4PXH B;  1K8A Q;  1HQB A;  3DS2 A;  3H4E A;  2GDY A;  2EG5 A;  2EFJ A;  4IZ6 A;  4UHP B;  2Z44 A;  2K0D X;  2AF8 A;  1D1D A;  3G21 A;  1X3O A;  1BAJ A;  2KW2 A;  1VQO P;  2KGE A;  1ZNV A;  2CNR A;  5EW5 E;  2PEI A;  1K30 A;  1M6N A;  2ONT A;  4F37 A;  3CCM P;  3CCR P;  3CCJ P;  1VQ4 P;  2K5X A;  1YHQ P;  4GR6 A;  1IMQ A;  2FHS C;  1NQ4 A;  1UJZ A;  5HGN A;  2CGQ A;  3P05 A;  3NTE A;  4BPF A;  3HZQ A;  2FAE A;  2NO8 A;  2OTJ P;  5F2K A;  1HY8 A;  2QEX P;  1DNY A;  2ERH A;  3CCE P;  5JPA A;  2VLO A;  1YIJ P;  2KOR A;  4WYM A;  2JB0 A;  3GKL C;  2KG6 A;  5HGM A;  2LTE A;  1EMV A;  1VQM P;  3CE7 A;  5HGL A;  3CME P;  5F2N A;  2CG5 B;  2LKI A;  3EJD A;  3B4Q A;  4XFZ A;  2BUO A;  2KR5 A;  2L9F A;  2N6Z A;  2KWL A;  3CC2 P;  2XZ0 D;  2LL8 A;  2FAC A;  2GYK A;  5F2O A;  2LIW A;  2N6Y A;  3U43 A;  1F80 D;  3DTJ A;  5KP8 B;  3CPW O;  2MVV A;  4XRQ A;  2K92 A;  5HVC A;  1YJ9 P;  3CXC O;  2FVF A;  4PH0 A;  3OW2 O;  2XZ1 C;  3CD6 P;  3CCL P;  4GR2 A;  3EJE A;  3G29 A;  2JU1 A;  4H2Y C;  4H2W C;  4H2X C;  4NEO A;  2L4B A;  2LIU A;  2OTL P;  4U0C A;  2N98 A;  1ACP A;  4PH1 A;  1YIT P;  2KOP A;  2EIA A;  3CCU P;  3VRL C;  2KGD A;  2KGC A;  3H0D A;  1E6J P;  1KQS O;  1VQ6 P;  2Z45 A;  2VLQ A;  3I56 P;  2QNW A;  4U0D A;  4BPH A;  2PEM A;  1EIA A;  3MGE A;  3DS3 A;  4QNB A;  3HYB A;  1Q81 Q;  5BS2 A;  3G6E P;  2PEJ A; 
#chains in the Genus database with same CATH homology
 4CA3 A;  4PWV B;  2FQ0 A;  2CG5 B;  2LKI A;  3EJD A;  2EHS A;  5CZD B;  2KR5 A;  2L9F A;  2N6Z A;  2KWL A;  5KP7 B;  2CQ8 A;  2AVA A;  4MRT C;  1VKU A;  2XZ0 D;  2KOS A;  2LL8 A;  2FAC A;  2M5R A;  2FQ2 A;  2KG9 A;  2JU2 A;  2AFD A;  2LIW A;  2N6Y A;  3NY7 B;  2KG8 A;  2N50 A;  1F80 D;  3GZL A;  4PXH B;  2L22 A;  1L0H A;  1HQB A;  5EJD A;  2MF4 A;  5KP8 B;  4DG9 A;  2MVV A;  1OR5 A;  2JGP A;  2K92 A;  2K2Q A;  2L0Q A;  5HVC A;  2GDY A;  4IZ6 A;  4HKG A;  1T8K A;  2N5H A;  2FVF A;  2AF8 A;  2FVE A;  1AF8 A;  2LML A;  2XZ1 C;  3LMO A;  2LPK A;  1X3O A;  1L0I A;  2DNW A;  2KW2 A;  3EJE A;  2MY5 A;  2GDX A;  2AFE A;  4R0M A;  2KGE A;  2MD9 A;  2JU1 A;  1DV5 A;  2CNR A;  4H2Y C;  4H2W C;  4H2X C;  4NEO A;  2L4B A;  2LIU A;  2N98 A;  1KLP A;  1ACP A;  2FAD A;  2PNG A;  2K94 A;  2KOP A;  2MR8 A;  5KP6 B;  2MVU A;  2K0X A;  2KGD A;  2ROQ A;  2KGC A;  2K93 A;  2EHT A;  2KGA A;  2FHS C;  1NQ4 A;  5HV8 A;  2CGQ A;  3EJB A;  3RG2 A;  4BPF A;  2QNW A;  2VSQ A;  2FAE A;  4BPH A;  2LOL A;  3GZM A;  2GDW A;  1HY8 A;  1DNY A;  2FVA A;  2MR7 A;  4BPG A;  2X2B A;  2KOR A;  2K0Y A;  2KOO A;  2FQ1 A;  2KG6 A;  2JQ4 A;  2N5I A;  2LTE A;  2KOQ A;  3CE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...