2KOUA

Dicer like protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
102
Chain Sequence
ISGGSSISMMYKYCSRLPHDEFFQPKPEFQFKPVDEFGGTICRITLPANAPISEIESSLLPSTEAAKKDACLKAVHELHNLGVLNDFLLPDSKDEIEDELSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dicer-like protein 4
publication title Structure of the Arabidopsis thaliana DCL4 DUF283 domain reveals a noncanonical double-stranded RNA-binding fold for protein-protein interaction
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 14
structure length 102
sequence length 102
ec nomenclature ec 3.1.26.-:
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03368 Dicer_dimer Dicer dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.380 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2kouA00
2KOUA
chains in the Genus database with same CATH superfamily
2EQ3A 2ENAA 4RH8A 2EMKA 2M1SA 4LFCE 1T4LB 3BF2A 2L6MA 4BBYA 2EE8A 2MDGA 2M4IA 1WHNA 1PJTA 2B9DA 4R2PA 3LLHA 2RSIA 3HQ1A 3KZYA 5A6KA 3VYXA 1PJSA 3UK3C 1JK2A 4M30A 5KL7A 5A6BA 4O43A 4DR1E 2GLIA 5F3WA 1A1GA 4B3RE 2EOSA 2I13A 1GTKA 5CFFE 1MEYC 5A6AA 1SR9A 4AQYE 4GKJE 4BHBA 4FK5C 2I9IA 2YT4A 4IS1C 2YU5A 3THNA 1ZAAC 2DGCA 1RMDA 1N32E 1LLMC 3VYYA 2K7IA 4DV0E 1NEIA 4DV7E 2DLKA 1YYWA 3L00A 2EMBA 2L3JA 2EOYA 3AUZA 2RS7A 1QU6A 3M99B 4RHBB 5TSEA 3JU0A 5T6JA 2LT7A 3ADIA 2EMZA 4DV5E 2EN3A 1N36E 4R2EA 4B3TE 4R8OA 4F9BB 1XMOE 2LVHA 2EOXA 3F6GA 5KL4A 2EOFA 5AE1A 3C4BA 2WBUA 2V88A 1F2IG 3MHSC 1X6HA 3ADGA 4O5GA 2L8TA 4MLVA 1IMUA 2YTOA 4DR6E 1X6EA 2E72A 1JK1A 2L3CA 4LF4E 2Q8UA 4WYQB 3J7Yp 3EPJA 1L4SA 2JVAA 4B3SE 4JI0E 4X8WA 1N34E 2DMIA 1A1HA 1ZBTA 4X9JA 1O0WA 2MKNA 2EPKX 2YU8A 2ZM6E 3C6MA 1A1IA 2F4VE 3HXLA 2CPNA 2V87A 1QNTA 3ECRA 2BBGA 1FKAE 3ADLA 4DV2E 4ZYEA 2V89A 4KHPE 3J81C 2JY9A 3EQ1A 2EM7A 2CT1A 2EMFA 2LO3A 4DUYE 5ADZA 4JI4E 2K4VA 5AE3A 2JOBA 2EL6A 2LJUA 2GPIA 2A25A 4NZVA 2YTGA 1G2DC 1STUA 4F6NA 4F54A 2MC6A 1RC7A 3T1YE 1KYQA 2EMGA 3H09A 3JTZA 3T1HE 2B7VA 2UXCE 4DV4E 4ZYDA 2DB2A 4DR7E 3C4TA 1PDAA 4WFTA 2B7TA 2N8XA 3EPKA 1YYOA 2EPXA 4OX9E 2EOIA 4KWYA 5IXMB 2RQLA 4WPYA 1A1LA 4P78A 4ZYHA 2FV4B 1WHQA 4TUIA 4DR2E 2NUFA 2R76A 3J80C 1J26A 2EOOA 4R2QA 1XNRE 2B3TB 2ENHA 2JYAA 2BB8A 2EOHA 2ELZA 3TQMA 2UU9E 2JOXA 1BBGA 3FIGA 3IWDA 3EPHA 4R2CA 1RQ0A 3QG5C 2KONA 4JI5E 4B3ME 2YRHA 4LFBE 1YSAC 1KJKA 5LLQA 2D9HA 4BC7A 2CTDA 2F8BA 4DR3E 1UN6B 4WX9A 2FTXB 2JWOA 2MKDA 2NUGA 1T38A 1EH7A 1UILA 1HNZE 1IBKE 5IV8B 2M7QA 2KHXA 3K6QA 2YTDA 3J7AG 2EOEA 1IQOA 3BBGA 2VE7C 2ENCA 1XNQE 1IBLE 4DMIA 2YSPA 4HTGA 1N3GA 4K0KE 2YTEA 4WXCA 2UXBE 3MHHC 2EOJA 2HJJA 1WJPA 1P47A 4R03A 2UUCE 3OMLA 1HR0E 1A1FA 4LF9E 2L2MA 4R2DA 2VQFE 2NUEA 2RTXA 4X66E 2V8QB 1WXRA 1FJGE 2L92A 3EPLA 2ELYA 1I94E 4JI6E 2WCC3 2YWQA 3HTXA 2DMYA 2WZOA 1PJQA 2EM4A 4L5NC 3P1XA 2YPNA 4DV1E 5AASA 1YUIA 2EPLX 2YRKA 1YYKA 1UBDC 2DSYA 4IJDA 2ODRD 4NXNE 1EH8A 2DIXA 3JAMC 1YPNA 1N33E 4LF8E 3KZZA 4WXDA 2LTSA 1YFHA 4X62E 2HHHE 4JI7E 2EMXA 3AV0A 3THOB 4ZYGA 5DNYA 3IWBA 2EOQA 3ZOQB 4R2RA 2EM2A 2J7JA 2UUAE 2EJ4A 1B69A 1AAYA 4OOGC 2EWLA 2EPOA 2R1FA 2EQ0A 3VK6A 4BCAA 1GZ6A 2EORA 4JI3E 3MSWA 4DKKA 1IQSA 1SFEA 2KOUA 2EOMA 5KL3A 4GZNC 2EN6A 2EPZA 2EL5A 4M0VA 1X3CA 3DF6A 2EMYA 2YZTA 5KL5A 4F2JC 4DR5E 1T4OA 4F9AB 2YTNA 1YZ9A 1BB8A 2EPAA 2G7HA 2IHR1 1AH5A 4R2SA 2EOZA 2WBSA 1NCSA 2L33A 4P7DA 1XMQE 4F6MA 2EMWA 4NHRA 2EMIA 3F6HA 2EZ6A 4JYAE 1T4NA 2YSOA 2UXDE 2JXPA 2ODRC 4WSPA 1A1KA 2EPNA 2L2NA 2EPUA 2WBTA 4BMJA 2N3HA 2PRTA 4LF7E 3BGHA 2EP3A 4LU9A 4JV5E 2EN2A 2NABA 5AE2A 1DQ3A 2EL4A 4GKKE 2NA2A 5KL6A 1GQEA 1X6FA 5AC5A 2VRDA 2LJHA 5LL6R 1DI2A 1MGTA 4J8ZA 3C6KA 4LF6E 4BS9A 1TF3A 2EM0A 2N3GA 1EKZA 4JI8E 2V85A 1ZR9A 2UUBE 4LFAE 1X49A 2EMCA 1Z1BA 4KZSA 2EMHA 2DRPA 1ZU1A 2LMZA 2LUPB 5IWAE 1A1JA 4JI2E 4O4KA 2HC5A 4YY3E 4WSGA 2YTJA 3KWRA 1X48A 4DUZE 2E5LE 2GHFA 2RS6A 4X65E 2E1MA 2DLQA 5A6JA 5KL2A 2EPPA 3LMLA 4DV3E 2EN1A 4HEIA 2EPCA 4GEQB 5BR8E 4Q35B 4N4RB 2EMLA 5FLXC 2YTPA 2EM8A 3DJWA 4Q28A 1WRJA 2FGGA 2CSHA 2LCEA 2M9AA 3RMPA 2YTQA 1T39A 2EQ1A 2YTIA 2EN4A 4DV6E 1EH6A 5LMUE 2HGHA 4DR4E 1PKPA 4L8NA 1TN9A 1TF6A 2JR1A 3BIDA 3OTOE 2YRMA 1YUJA 2LTRA 2V83A 4JI1E 2MC5A 4BC9A 1X47A 2EPRA 4O24A 1UHZA 3IWCA 1ZBQA 2EN8A 2EM9A 2VQEE 2YTFA 2LV2A 2ADRA 4M2ZA 2L2KB 1G2FC 4I8OA 1X5WA 1HNXE 2EMAA 5AC4A 1DGCA 2MDRA 4LTYA 4NXME 2H36X 2EM6A 3ADJA 2JP9A 3HPSA 4F9CB 4M9VC 1HNWE 5IT9C 4BHCA 4R2AA 1J5EE 4YHHE 3HPZA 2JPAA 4TUGA 5A69A 3VHTB 4X64E 2EM5A 2LBSB 5LMNE 1IBME 2LUQA 2EPMX 1BBOA 2EM3A 2V86A 2EN7A 5A6BD 2LE2A 2VF1A 4MLQA 2RPCA 2RSMA 4LF5E 2LRSA 5A2QC
chains in the Genus database with same CATH topology
2RTXA 4X66E 2V8QB 1WXRA 3J81C 1FJGE 2L92A 4KHPE 2JY9A 2N3GA 2M1SA 1EKZA 4JI8E 2V85A 4LFCE 1I94E 1T4LB 2L6MA 4JI6E 2UUBE 4LFAE 1X49A 3HTXA 2DMYA 4BBYA 2WZOA 4DV1E 2M4IA 1WHNA 3P1XA 4L5NC 4KZSA 5AASA 5ADZA 4DUYE 4JI4E 2B9DA 3LLHA 2LMZA 3HQ1A 2LUPB 2K4VA 1YYKA 3VYXA 5AE3A 2DSYA 2JOBA 5IWAE 4JI2E 2ODRD 4NXNE 2DIXA 4M30A 3JAMC 4YY3E 1N33E 4DR1E 4LF8E 3KWRA 1X48A 2LTSA 5F3WA 4X62E 4DUZE 2E5LE 1STUA 2HHHE 2RS6A 3AV0A 4JI7E 4F54A 4X65E 2E1MA 4B3RE 2VQFE 5DNYA 3IWBA 2MC6A 5CFFE 3ZOQB 3LMLA 1RC7A 3T1YE 1SR9A 4AQYE 4GKJE 4DV3E 3H09A 2UUAE 3JTZA 4GEQB 5BR8E 3T1HE 2YT4A 4OOGC 5FLXC 2B7VA 2EWLA 2UXCE 3DJWA 3VK6A 4Q28A 2FGGA 4DV4E 2DB2A 4BCAA 4DR7E 3C4TA 1GZ6A 4WFTA 2B7TA 3RMPA 1N32E 1YYOA 4JI3E 3VYYA 4OX9E 4DV0E 4DV7E 4DV6E 3MSWA 4WPYA 4P78A 1YYWA 4DKKA 2FV4B 5LMUE 1WHQA 4TUIA 4DV2E 4DR2E 2L3JA 2KOUA 3J80C 2NUFA 4DR4E 1PKPA 1J26A 4L8NA 3AUZA 4M0VA 2RS7A 2JR1A 1XNRE 1QU6A 3DF6A 2B3TB 3JU0A 5T6JA 3OTOE 3ADIA 2YZTA 2LTRA 4DV5E 1N36E 4DR5E 2UU9E 2V83A 1T4OA 2JOXA 4F9AB 4B3TE 3FIGA 3IWDA 4R8OA 4F9BB 4JI1E 1YZ9A 2MC5A 1XMOE 1RQ0A 4BS9A 2KONA 3F6GA 1X47A 4BC9A 4B3ME 4JI5E 4LFBE 2G7HA 2IHR1 4BC7A 5AE1A 2F8BA 4DR3E 1UHZA 3C4BA 2V88A 3IWCA 1ZBQA 2L33A 4P7DA 1XMQE 2VQEE 2FTXB 2JWOA 3F6HA 3ADGA 2NUGA 4M2ZA 2L2KB 4I8OA 2EZ6A 1UILA 2L8TA 4JYAE 1T4NA 1HNZE 1IBKE 1HNXE 2UXDE 2MDRA 4LTYA 2M7QA 4NXME 4DR6E 2H36X 2ODRC 2KHXA 3K6QA 2L3CA 4LF4E 4WSPA 4WYQB 3J7Yp 3J7AG 2L2NA 3ADJA 2JVAA 2N3HA 4BMJA 4B3SE 2VE7C 3HPSA 4F9CB 4JI0E 4LF7E 4X8WA 1N34E 1HNWE 1XNQE 1ZBTA 1O0WA 5IT9C 1IBLE 1J5EE 4LU9A 4DMIA 4YHHE 3HPZA 4JV5E 4TUGA 2ZM6E 4X64E 2LBSB 5LMNE 1IBME 2LUQA 2F4VE 4K0KE 5AE2A 3HXLA 1DQ3A 2UXBE 4GKKE 2CPNA 2V86A 2V87A 4R03A 2NA2A 2UUCE 3OMLA 1GQEA 2LE2A 2VF1A 1HR0E 2LJHA 2RSMA 5LL6R 4LF5E 4LF9E 1DI2A 2L2MA 1FKAE 2LRSA 4J8ZA 5A2QC 4LF6E 3ADLA 2NUEA 2V89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOU A; 
#chains in the Genus database with same CATH topology
 2EQ3 A;  2ENA A;  4RH8 A;  2EMK A;  2M1S A;  4LFC E;  1T4L B;  3BF2 A;  2L6M A;  4BBY A;  2EE8 A;  2MDG A;  2M4I A;  1WHN A;  1PJT A;  2B9D A;  4R2P A;  3LLH A;  2RSI A;  3HQ1 A;  3KZY A;  5A6K A;  3VYX A;  1PJS A;  3UK3 C;  1JK2 A;  4M30 A;  5KL7 A;  5A6B A;  4O43 A;  4DR1 E;  2GLI A;  5F3W A;  1A1G A;  4B3R E;  2EOS A;  2I13 A;  1GTK A;  5CFF E;  1MEY C;  5A6A A;  1SR9 A;  4AQY E;  4GKJ E;  4BHB A;  4FK5 C;  2I9I A;  2YT4 A;  4IS1 C;  2YU5 A;  3THN A;  1ZAA C;  2DGC A;  1RMD A;  1N32 E;  1LLM C;  3VYY A;  2K7I A;  4DV0 E;  1NEI A;  4DV7 E;  2DLK A;  1YYW A;  3L00 A;  2EMB A;  2L3J A;  2EOY A;  3AUZ A;  2RS7 A;  1QU6 A;  3M99 B;  4RHB B;  5TSE A;  3JU0 A;  5T6J A;  2LT7 A;  3ADI A;  2EMZ A;  4DV5 E;  2EN3 A;  1N36 E;  4R2E A;  4B3T E;  4R8O A;  4F9B B;  1XMO E;  2LVH A;  2EOX A;  3F6G A;  5KL4 A;  2EOF A;  5AE1 A;  3C4B A;  2WBU A;  2V88 A;  1F2I G;  3MHS C;  1X6H A;  3ADG A;  4O5G A;  2L8T A;  4MLV A;  1IMU A;  2YTO A;  4DR6 E;  1X6E A;  2E72 A;  1JK1 A;  2L3C A;  4LF4 E;  2Q8U A;  4WYQ B;  3J7Y p;  3EPJ A;  1L4S A;  2JVA A;  4B3S E;  4JI0 E;  4X8W A;  1N34 E;  2DMI A;  1A1H A;  1ZBT A;  4X9J A;  1O0W A;  2MKN A;  2EPK X;  2YU8 A;  2ZM6 E;  3C6M A;  1A1I A;  2F4V E;  3HXL A;  2CPN A;  2V87 A;  1QNT A;  3ECR A;  2BBG A;  1FKA E;  3ADL A;  4DV2 E;  4ZYE A;  2V89 A;  4KHP E;  3J81 C;  2JY9 A;  3EQ1 A;  2EM7 A;  2CT1 A;  2EMF A;  2LO3 A;  4DUY E;  5ADZ A;  4JI4 E;  2K4V A;  5AE3 A;  2JOB A;  2EL6 A;  2LJU A;  2GPI A;  2A25 A;  4NZV A;  2YTG A;  1G2D C;  1STU A;  4F6N A;  4F54 A;  2MC6 A;  1RC7 A;  3T1Y E;  1KYQ A;  2EMG A;  3H09 A;  3JTZ A;  3T1H E;  2B7V A;  2UXC E;  4DV4 E;  4ZYD A;  2DB2 A;  4DR7 E;  3C4T A;  1PDA A;  4WFT A;  2B7T A;  2N8X A;  3EPK A;  1YYO A;  2EPX A;  4OX9 E;  2EOI A;  4KWY A;  5IXM B;  2RQL A;  4WPY A;  1A1L A;  4P78 A;  4ZYH A;  2FV4 B;  1WHQ A;  4TUI A;  4DR2 E;  2NUF A;  2R76 A;  3J80 C;  1J26 A;  2EOO A;  4R2Q A;  1XNR E;  2B3T B;  2ENH A;  2JYA A;  2BB8 A;  2EOH A;  2ELZ A;  3TQM A;  2UU9 E;  2JOX A;  1BBG A;  3FIG A;  3IWD A;  3EPH A;  4R2C A;  1RQ0 A;  3QG5 C;  2KON A;  4JI5 E;  4B3M E;  2YRH A;  4LFB E;  1YSA C;  1KJK A;  5LLQ A;  2D9H A;  4BC7 A;  2CTD A;  2F8B A;  4DR3 E;  1UN6 B;  4WX9 A;  2FTX B;  2JWO A;  2MKD A;  2NUG A;  1T38 A;  1EH7 A;  1UIL A;  1HNZ E;  1IBK E;  5IV8 B;  2M7Q A;  2KHX A;  3K6Q A;  2YTD A;  3J7A G;  2EOE A;  1IQO A;  3BBG A;  2VE7 C;  2ENC A;  1XNQ E;  1IBL E;  4DMI A;  2YSP A;  4HTG A;  1N3G A;  4K0K E;  2YTE A;  4WXC A;  2UXB E;  3MHH C;  2EOJ A;  2HJJ A;  1WJP A;  1P47 A;  4R03 A;  2UUC E;  3OML A;  1HR0 E;  1A1F A;  4LF9 E;  2L2M A;  4R2D A;  2VQF E;  2NUE A;  2RTX A;  4X66 E;  2V8Q B;  1WXR A;  1FJG E;  2L92 A;  3EPL A;  2ELY A;  1I94 E;  4JI6 E;  2WCC 3;  2YWQ A;  3HTX A;  2DMY A;  2WZO A;  1PJQ A;  2EM4 A;  4L5N C;  3P1X A;  2YPN A;  4DV1 E;  5AAS A;  1YUI A;  2EPL X;  2YRK A;  1YYK A;  1UBD C;  2DSY A;  4IJD A;  2ODR D;  4NXN E;  1EH8 A;  2DIX A;  3JAM C;  1YPN A;  1N33 E;  4LF8 E;  3KZZ A;  4WXD A;  2LTS A;  1YFH A;  4X62 E;  2HHH E;  4JI7 E;  2EMX A;  3AV0 A;  3THO B;  4ZYG A;  5DNY A;  3IWB A;  2EOQ A;  3ZOQ B;  4R2R A;  2EM2 A;  2J7J A;  2UUA E;  2EJ4 A;  1B69 A;  1AAY A;  4OOG C;  2EWL A;  2EPO A;  2R1F A;  2EQ0 A;  3VK6 A;  4BCA A;  1GZ6 A;  2EOR A;  4JI3 E;  3MSW A;  4DKK A;  1IQS A;  1SFE A;  2KOU A;  2EOM A;  5KL3 A;  4GZN C;  2EN6 A;  2EPZ A;  2EL5 A;  4M0V A;  1X3C A;  3DF6 A;  2EMY A;  2YZT A;  5KL5 A;  4F2J C;  4DR5 E;  1T4O A;  4F9A B;  2YTN A;  1YZ9 A;  1BB8 A;  2EPA A;  2G7H A;  2IHR 1;  1AH5 A;  4R2S A;  2EOZ A;  2WBS A;  1NCS A;  2L33 A;  4P7D A;  1XMQ E;  4F6M A;  2EMW A;  4NHR A;  2EMI A;  3F6H A;  2EZ6 A;  4JYA E;  1T4N A;  2YSO A;  2UXD E;  2JXP A;  2ODR C;  4WSP A;  1A1K A;  2EPN A;  2L2N A;  2EPU A;  2WBT A;  4BMJ A;  2N3H A;  2PRT A;  4LF7 E;  3BGH A;  2EP3 A;  4LU9 A;  4JV5 E;  2EN2 A;  2NAB A;  5AE2 A;  1DQ3 A;  2EL4 A;  4GKK E;  2NA2 A;  5KL6 A;  1GQE A;  1X6F A;  5AC5 A;  2VRD A;  2LJH A;  5LL6 R;  1DI2 A;  1MGT A;  4J8Z A;  3C6K A;  4LF6 E;  4BS9 A;  1TF3 A;  2EM0 A;  2N3G A;  1EKZ A;  4JI8 E;  2V85 A;  1ZR9 A;  2UUB E;  4LFA E;  1X49 A;  2EMC A;  1Z1B A;  4KZS A;  2EMH A;  2DRP A;  1ZU1 A;  2LMZ A;  2LUP B;  5IWA E;  1A1J A;  4JI2 E;  4O4K A;  2HC5 A;  4YY3 E;  4WSG A;  2YTJ A;  3KWR A;  1X48 A;  4DUZ E;  2E5L E;  2GHF A;  2RS6 A;  4X65 E;  2E1M A;  2DLQ A;  5A6J A;  5KL2 A;  2EPP A;  3LML A;  4DV3 E;  2EN1 A;  4HEI A;  2EPC A;  4GEQ B;  5BR8 E;  4Q35 B;  4N4R B;  2EML A;  5FLX C;  2YTP A;  2EM8 A;  3DJW A;  4Q28 A;  1WRJ A;  2FGG A;  2CSH A;  2LCE A;  2M9A A;  3RMP A;  2YTQ A;  1T39 A;  2EQ1 A;  2YTI A;  2EN4 A;  4DV6 E;  1EH6 A;  5LMU E;  2HGH A;  4DR4 E;  1PKP A;  4L8N A;  1TN9 A;  1TF6 A;  2JR1 A;  3BID A;  3OTO E;  2YRM A;  1YUJ A;  2LTR A;  2V83 A;  4JI1 E;  2MC5 A;  4BC9 A;  1X47 A;  2EPR A;  4O24 A;  1UHZ A;  3IWC A;  1ZBQ A;  2EN8 A;  2EM9 A;  2VQE E;  2YTF A;  2LV2 A;  2ADR A;  4M2Z A;  2L2K B;  1G2F C;  4I8O A;  1X5W A;  1HNX E;  2EMA A;  5AC4 A;  1DGC A;  2MDR A;  4LTY A;  4NXM E;  2H36 X;  2EM6 A;  3ADJ A;  2JP9 A;  3HPS A;  4F9C B;  4M9V C;  1HNW E;  5IT9 C;  4BHC A;  4R2A A;  1J5E E;  4YHH E;  3HPZ A;  2JPA A;  4TUG A;  5A69 A;  3VHT B;  4X64 E;  2EM5 A;  2LBS B;  5LMN E;  1IBM E;  2LUQ A;  2EPM X;  1BBO A;  2EM3 A;  2V86 A;  2EN7 A;  5A6B D;  2LE2 A;  2VF1 A;  4MLQ A;  2RPC A;  2RSM A;  4LF5 E;  2LRS A;  5A2Q C; 
#chains in the Genus database with same CATH homology
 2RTX A;  4X66 E;  2V8Q B;  1WXR A;  3J81 C;  1FJG E;  2L92 A;  4KHP E;  2JY9 A;  2N3G A;  2M1S A;  1EKZ A;  4JI8 E;  2V85 A;  4LFC E;  1I94 E;  1T4L B;  2L6M A;  4JI6 E;  2UUB E;  4LFA E;  1X49 A;  3HTX A;  2DMY A;  4BBY A;  2WZO A;  4DV1 E;  2M4I A;  1WHN A;  3P1X A;  4L5N C;  4KZS A;  5AAS A;  5ADZ A;  4DUY E;  4JI4 E;  2B9D A;  3LLH A;  2LMZ A;  3HQ1 A;  2LUP B;  2K4V A;  1YYK A;  3VYX A;  5AE3 A;  2DSY A;  2JOB A;  5IWA E;  4JI2 E;  2ODR D;  4NXN E;  2DIX A;  4M30 A;  3JAM C;  4YY3 E;  1N33 E;  4DR1 E;  4LF8 E;  3KWR A;  1X48 A;  2LTS A;  5F3W A;  4X62 E;  4DUZ E;  2E5L E;  1STU A;  2HHH E;  2RS6 A;  3AV0 A;  4JI7 E;  4F54 A;  4X65 E;  2E1M A;  4B3R E;  2VQF E;  5DNY A;  3IWB A;  2MC6 A;  5CFF E;  3ZOQ B;  3LML A;  1RC7 A;  3T1Y E;  1SR9 A;  4AQY E;  4GKJ E;  4DV3 E;  3H09 A;  2UUA E;  3JTZ A;  4GEQ B;  5BR8 E;  3T1H E;  2YT4 A;  4OOG C;  5FLX C;  2B7V A;  2EWL A;  2UXC E;  3DJW A;  3VK6 A;  4Q28 A;  2FGG A;  4DV4 E;  2DB2 A;  4BCA A;  4DR7 E;  3C4T A;  1GZ6 A;  4WFT A;  2B7T A;  3RMP A;  1N32 E;  1YYO A;  4JI3 E;  3VYY A;  4OX9 E;  4DV0 E;  4DV7 E;  4DV6 E;  3MSW A;  4WPY A;  4P78 A;  1YYW A;  4DKK A;  2FV4 B;  5LMU E;  1WHQ A;  4TUI A;  4DV2 E;  4DR2 E;  2L3J A;  2KOU A;  3J80 C;  2NUF A;  4DR4 E;  1PKP A;  1J26 A;  4L8N A;  3AUZ A;  4M0V A;  2RS7 A;  2JR1 A;  1XNR E;  1QU6 A;  3DF6 A;  2B3T B;  3JU0 A;  5T6J A;  3OTO E;  3ADI A;  2YZT A;  2LTR A;  4DV5 E;  1N36 E;  4DR5 E;  2UU9 E;  2V83 A;  1T4O A;  2JOX A;  4F9A B;  4B3T E;  3FIG A;  3IWD A;  4R8O A;  4F9B B;  4JI1 E;  1YZ9 A;  2MC5 A;  1XMO E;  1RQ0 A;  4BS9 A;  2KON A;  3F6G A;  1X47 A;  4BC9 A;  4B3M E;  4JI5 E;  4LFB E;  2G7H A;  2IHR 1;  4BC7 A;  5AE1 A;  2F8B A;  4DR3 E;  1UHZ A;  3C4B A;  2V88 A;  3IWC A;  1ZBQ A;  2L33 A;  4P7D A;  1XMQ E;  2VQE E;  2FTX B;  2JWO A;  3F6H A;  3ADG A;  2NUG A;  4M2Z A;  2L2K B;  4I8O A;  2EZ6 A;  1UIL A;  2L8T A;  4JYA E;  1T4N A;  1HNZ E;  1IBK E;  1HNX E;  2UXD E;  2MDR A;  4LTY A;  2M7Q A;  4NXM E;  4DR6 E;  2H36 X;  2ODR C;  2KHX A;  3K6Q A;  2L3C A;  4LF4 E;  4WSP A;  4WYQ B;  3J7Y p;  3J7A G;  2L2N A;  3ADJ A;  2JVA A;  2N3H A;  4BMJ A;  4B3S E;  2VE7 C;  3HPS A;  4F9C B;  4JI0 E;  4LF7 E;  4X8W A;  1N34 E;  1HNW E;  1XNQ E;  1ZBT A;  1O0W A;  5IT9 C;  1IBL E;  1J5E E;  4LU9 A;  4DMI A;  4YHH E;  3HPZ A;  4JV5 E;  4TUG A;  2ZM6 E;  4X64 E;  2LBS B;  5LMN E;  1IBM E;  2LUQ A;  2F4V E;  4K0K E;  5AE2 A;  3HXL A;  1DQ3 A;  2UXB E;  4GKK E;  2CPN A;  2V86 A;  2V87 A;  4R03 A;  2NA2 A;  2UUC E;  3OML A;  1GQE A;  2LE2 A;  2VF1 A;  1HR0 E;  2LJH A;  2RSM A;  5LL6 R;  4LF5 E;  4LF9 E;  1DI2 A;  2L2M A;  1FKA E;  2LRS A;  4J8Z A;  5A2Q C;  4LF6 E;  3ADL A;  2NUE A;  2V89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...