2KP1A

Solution structure of the a' domain of thermophilic fungal protein disulfide isomerase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
GPLGSEGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVDATANDVPDEIQGFPTIKLYPAGAKGQPVTYSGSRTVEDLIKFIAENGKYKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein disulfide-isomerase
publication title Redox-Dependent Domain Rearrangement of Protein Disulfide Isomerase Coupled with Exposure of Its Substrate-Binding Hydrophobic Surface
pubmed doi rcsb
source organism Humicola insolens
molecule tags Isomerase
total genus 29
structure length 121
sequence length 121
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2kp1A00
1VRSD 1QXHA 1MDKA 2C1YA 1R5PA 3HJMA 2H01A 20GSA 1Q4JA 2D2ZA 2VOCA 1SK0A 3HZ8A 6GSXA 4X1UA 2HZEB 5HFGA 5ECSA 2LNTA 3O76A 4ECJA 2OADA 2MMZA 1I9DA 1GSDA 1F2EA 1FAAA 3GX8A 4POMA 4V2NA 4WEYA 1QUWA 1TJDA 2C0GA 2R5GA 3EC3A 4TXVA 2NDOA 1IYHA 1A23A 1W89A 4HZ2A 4XRAA 2VLTA 4GTUA 1ILOA 5FWGA 1EV9A 3HYPA 5ECQB 3D22A 5HR2A 4Q5RA 2YPMA 3NZNA 1SKWB 2N5FA 3M9JA 3RPPA 4TR1A 4XIHA 2L6CA 4LMVA 2B5XA 3C7MA 3L9UA 2IMDA 4V2MA 5IMZA 5A4VA 3APSA 2DJ1A 5H5QA 5ID2B 2B5YA 2VLVA 4BVXA 1K0NA 2QC7A 4KDUA 4LL1B 2ES7A 3H79A 5G2ZA 1OE7A 2GQMA 1PN9A 5DBQA 5F07A 3EINA 4K9ZA 1BG5A 4EE0A 1A2JA 2MBTA 1YKCA 4POLA 1DE1A 1SKSB 2FY6A 4IHUA 1GNWA 1YJ6A 4MZCA 2PUKC 5DJLA 2L59A 3ME7A 2F8AA 2ON7A 1A24A 3KCMA 2GSTA 3TRQA 3TOTA 4PX1A 1XBSA 4J56E 3APOA 1Z7RA 3DYRA 2GT6A 4KW6A 4BPYA 3HJPA 4P3YB 3RPNA 1PGTA 3GKMA 2KOKA 4MLYA 1TRSA 2B7KA 4N0ZA 1X5EA 1JZRA 5D9TA 1YZXA 4QL9A 1MD3A 1AQWA 3LEFA 5IO2A 2GLRA 2WS2A 3L78A 3AY8A 1PL2A 4KUNA 5CRHA 4ECBA 5JCUA 2ALBA 3LG6A 5IIZA 2TRXA 5ELGA 1ZGNA 3QAVA 1TRWA 1V40A 2O7KA 4HUAA 3H8QA 4GF0A 1XCCA 3IOSA 2PGTA 4NPBA 5AISA 2K9FA 5IOWA 2RUEA 2CVBA 5H5SA 1SL1B 4FO5A 5J5NA 4WETA 3FRCA 5ECRB 6GSSA 2EIQA 3EURA 3GX0A 2KHPA 5DCGA 3UBLA 3M1GA 2C8UA 4IJIA 4MF7A 2IJYA 2CVKA 1HD2A 3SBCA 3IC4A 2WRTA 4KCAA 4YQUA 4PQHA 3VWVA 2GSRA 2L5LA 6GSVA 2MYGA 4PUAA 1PRXA 2E7PA 2FNOA 4KNDA 2DJ3A 1GNEA 3FZ4A 18GSA 1PA3A 4GQFA 1WRYA 4EDZA 2H1BA 4ZXGA 4GWRA 1MTCA 4GSSA 3DGQA 4NV2A 1I5GA 5DQYA 3I9V2 1TRUA 2K8SA 4IP1A 3P2AA 4MH2A 5L71A 1GUKA 1M7TA 5HQPA 3DIEA 4I97A 2X8GA 1GTUA 3M9KA 2I81A 3IBHA 4TKYA 3HDCA 2ON5A 1WE0A 3FEUA 4ILFA 2MMOA 8GSSA 1KBNA 2LRCA 4X0XA 1QQ2A 4O7HA 4HZ4A 3DKSA 2YV9A 1FB6A 1H75A 3FK8A 3EU3A 3ERWA 3CBUA 3LFLA 2C4JA 4AF2A 2R37A 1MEKA 2A2SA 4L8EA 2IMEA 4EO3A 3GTUA 4EXJA 2FA8A 1YQ1A 5IMCA 4HU9A 4NHZA 4NV5A 5CAXA 4ZIJA 2R6KA 5JWRB 4OFNA 2CX4A 2E2MA 4NWYA 5HR0A 4TXOA 2VL2A 1HNAA 1KTEA 3VWWA 4OCEA 4HOJA 2AUVA 4E8HA 2B3SA 3TKPA 4TRXA 3QPMA 3GTUB 4OFMA 2GGTA 2A4VA 2V32A 1R26A 2GZYA 2O89A 2YWNA 1NHOA 2FWEA 3FR6A 13GSA 3GV1A 2HYXA 2VL9A 4LL4B 5JCWA 4DSSB 2X8CA 2F9SA 4WF4A 2DSAA 1TKDB 5AGYA 1YF1A 3APQA 1O8WA 5GAND 3C1RA 2JADA 1ZCPA 2WCIA 2B7JA 1M0UA 3MAKA 1E6BA 4EKZA 3QOUA 3KXOA 2IMIA 4JZQA 5IMDA 1OC9A 2JACA 4Q5QA 2KP2A 3VI7A 2VCWA 3BJ5A 2VCXA 3TKQA 3ED3A 5G5EA 4OFTA 4BL7A 3EMXA 1WMJA 1ST9A 5FHIA 1PMTA 3CTGA 2FLSA 2HE3A 3VI5A 1U3AA 3ZYWA 2CVDA 4DSRA 2H0GA 1GP1A 3KTLA 2OJLA 1OYJA 1GSUA 2PMTA 3FZ5A 1K0AA 3IRAA 1V98A 4MP4A 3U5RE 4IS0A 1URMA 3W6GA 2L5OA 4AGSA 2V2GA 4CHSA 1SYXA 2H74A 5J9BA 1GUHA 1K0BA 1O6JA 1JFUA 1OKDA 3NOFA 2P0GA 3ZFBA 1YDKA 3KIJA 2HRNA 1R4WA 5COHA 1FB0A 1Z6NA 3E9JB 2M46A 3ERGA 2BTOT 2H66A 4ZBAA 4LMWA 3HHVA 3UARA 3R2QA 2R3XA 3F63A 4IBPA 3VPTA 1PD21 4WBJA 3QFBC 1M9AA 3GL5A 1XWCA 2XBQA 3GSTA 2H6YA 3GYKA 2DMMA 1Z3EA 2WFCA 3C73A 3UOMA 1OC8A 2B6MA 3IR4A 5CRWA 4RI7A 1TOFA 4IKHA 3IAS2 4F0BA 22GSA 4GLTA 3M0FA 2DJ0A 3GSSA 3IAM2 2C0DA 1DBYA 5H5RA 1EEMA 2LRNA 4G2EA 2B5EA 4L0UA 1VF3A 1N8JA 1ABAA 3UIWA 1EGOA 1K0CA 3GURA 3ISOA 4KSOA 2VAFA 4NHWA 3RBTA 1GSQA 4G19A 3ZITA 1QK8A 1SD9A 1XWAA 4MJCA 1M2DA 2V6OA 3IXRA 1SL2B 5ECHB 3C8EA 2H0HA 2H1AA 3GN3A 5INYA 2DJJA 3MNGA 3EWLA 3HXSA 1FHEA 2GQLA 4TVEA 2FHEA 2KUCA 3IPZA 3F8UA 2L4QA 3IA1A 2RUFA 3C71A 3L0HA 2L57A 3ME8A 2HZEA 1HNBA 3DWVA 5D8IA 2ZNMA 3KM6A 1XWKA 1ERVA 4QL7A 3P90A 1N2AA 3LGCA 2FWGA 2L6DA 5B8BA 1GULA 2CZ3A 3DD3A 3GIXA 2V1MA 5EVOA 2PWJA 4PQ1A 3IDVA 1AIUA 3S9FA 3KJYA 5J9CA 4MCUA 2HSHA 2I3YA 3FZAA 4IQ1A 3E0UA 5JWOB 3VPQA 3ZTLA 1FVKA 1A8LA 5DVBA 1BJXA 2J9HA 2C3QA 3ZVJA 4N0VA 3GUSA 1OKTA 4HQSA 1AQXA 1XXUA 2LSTA 3C1SA 5ID2A 5J3RA 1DUGA 5CP1A 3OR5A 2FGXA 2M80A 2H1GA 1SJ6A 3PGTA 1A2LA 3FR9A 5DCHA 3ERFA 4KE3A 1GLQA 1M2AA 1HNCA 1O85A 4CDOA 1RK4A 2IMFA 1CQHA 4KCEA 2OBKA 1R5AA 1KEBA 4K7NA 4TR3A 3DVWA 3F4RA 3DRNA 3BBYA 3KP9A 3BCKA 5A4WA 4TN8A 3FY7A 1M9BA 4L0WA 2G0FA 5AN1A 3CMIA 1XOBA 1GH2A 2YWMA 5IMAA 4JR6A 2P5RA 3TKSA 4MZWA 1TI1A 3F0IA 5EL8A 2K18A 1SD8A 1OE8A 5IQYA 2OE0A 7GSSA 1BQ7A 2CZ2A 2OE1A 3D5JA 5AIXA 3EVIA 4TR4A 4PNGA 1C72A 4GSNA 5LCZA 1O7UA 3D6IA 2O87A 1GSSA 1T4ZA 1YKAA 2YJ7A 3G7IA 2PERA 4MPFA 4O32A 4WR4A 5G31A 6GSTA 5D9XA 1XPVA 1F6MC 2HFDA 4O5RA 1A0RP 4DEJA 4MABA 3BCIA 1CQGA 4I2TA 1TRVA 5J4UA 3QAGA 4JE1A 5DAKA 3TJGA 1B9YC 2VM2A 2XBIA 4D73B 1EP8A 2NBSA 2RM6A 5J41A 2LQQA 1WIKA 2JL4A 3H93A 3EU4A 4RQXA 1BAYA 3TJBA 1SU9A 1GTIA 2H71A 2AYTA 2OACA 5HFIA 5DAKB 4TOPA 3SWLA 2F8FA 1XWBA 4OO4A 5KEJA 2HSYA 4RUVA 4XTSA 1AW9A 1AUCA 1AXDA 2YNXA 5D9VA 2JZTA 3UEMA 4N10A 1F9MA 1SJZA 4FYUA 1SL0B 3GFKA 4ACSA 2REMA 3TJKA 3CSHA 5IPHA 4HS1A 3HVVA 4K7OA 5AIVA 2HLSA 4DVCA 2DMLA 2AJQB 2LUSA 5ABRA 3CSIA 3H4KA 3FZ9A 4PNFA 2EC4A 2DJKA 3EYTA 1ACVA 1TP9A 3GH6A 1VF1A 2PBJA 4MDCA 4JBBA 1TTZA 3KH9A 1GUMA 4V1Ag 2N5BA 5B6NA 2OE3A 1BX9A 4HDEA 3TKRA 1E2YA 3D21A 5EY6A 2LJAA 2EIOA 4GCIA 4IVFA 1XVWA 5CO3A 4OO5A 5A4UA 4KAEA 4IGJA 3TCOA 4ISDA 1S3AA 1XW6A 4MF6A 1OC3A 2VD0A 3I43A 3ZIJA 1MDJA 1A0FA 1AAZA 1EZKA 1Q98A 4OCFA 2QSIA 1B48A 5CRDA 1T7PB 3TDGA 1GLPA 1G6WA 1ON4A 3ZZXA 1T3BA 2AB6A 5ECOB 1HQOA 4DSSA 2VIMA 2IWTA 3N9JA 3GL3A 1SYRA 4OMVA 4X43A 2H73A 4YQMA 3US3A 5JCGA 3W8SA 5ECLB 1BYEA 4PXOA 2E0QA 5LNKe 2M72A 5GSTA 1XZOA 2FCHA 2MBSA 2GVPA 2VCZA 4PQIA 2AAWA 4J2FA 3RHBA 2V6KA 1X9WB 4ZL7A 1ZMAA 1ERUA 2IFQB 3TRPA 3WYWA 3V1WA 3VWXA 1IYIA 5B6MA 1DSBA 3HKRA 3F4TA 9GSSA 3H1NA 2J23A 5GZZB 1T1VA 4AJ6A 1UC7A 4EL1A 5CRGA 4EVMA 3PINA 3LYKA 2IN3A 2HI7A 2FA4A 3F6FA 2FWFA 5IMFA 4ULXA 2YOIA 2YV7A 5G1LA 2QKEA 3TGZA 3HA9A 1XW9A 2LKUA 2WJUA 2VCQA 3Q74A 1JZOA 3VFIA 2R2JA 4K1FA 1TDIA 2AV4A 2IPAA 1B9XC 3HVSA 3Q6OA 5HR3A 5IO0A 5IM9A 2VL3A 1GSYA 1ZYQB 2YN1A 1Z9HA 1UN2A 2LV3A 4GXZA 2GSQA 5F06A 1Z7PA 4F9ZA 1B4QA 12GSA 2I1UA 3QD9A 4FH8A 2DIZA 4I5QA 2ZUPA 5DQSA 1X0RA 3CSJA 5G1KA 2CT6A 2IL3A 3TJFA 3GKKA 4F0CA 1V9WA 3UBKA 2F3MA 5LD0A 3VURA 2OBIA 2H8LA 4MZBA 5F0GA 5DJMA 1K3LA 2PN8A 5B8AA 1MD4A 2LJKA 4E8EA 3GMFA 3KP8A 3RHCA 4MA9A 3FW2A 5CNWA 1T8EB 1SENA 5C00A 2VCVA 4POKA 3WT1A 1F3AA 1BEDA 5ECIB 4HEA2 5G5FA 3G9BA 4H86A 5DALA 2VL2C 1NHYA 3M8NA 5GSSA 1YF0A 2ZCTA 4V1Ap 5HR1A 5FT3A 1Z6MA 4KH7A 1V58A 3GA4A 3LORA 2YANA 4ZL8A 1X5CA 3PR8A 1U87A 4N11A 3ZVJD 5F05A 4EDYA 5IMVA 5DALB 3F3RA 2JSZA 4ML1A 2OKAA 3PH9A 1PX7A 1F37A 2K8VA 1OVNA 2C3NA 3ZFLA 2K6VA 1X9MB 1DE2A 3L4NA 5ENUA 1J08A 1B4PA 4POBA 1TW9A 1SK1A 2CQ9A 1TK0B 2QGVA 1PQNA 4Q5NA 5C04A 2YWOA 1TU8A 1G7EA 4TW5A 3KZQA 2FD3A 2VO4A 1FG4A 2O85A 4EF0A 1F3BA 1PKZA 4CW9A 1GRXA 1Z5YE 4KX4A 3UMAA 4QQ7A 1EWXA 4I6XA 4EC0A 3G7YA 4WF5A 1VF4A 3LYPA 4GRFA 2E2GA 1M2BA 2RIIA 1V2AA 2XHFA 3DMLA 3BD2A 1RW1A 5D93A 1TXXA 1MDIA 4BWQA 3BOAA 4IJ3A 4ECIA 4MF5A 2LEGA 3Q19A 1ERTA 2AHEA 3DVXA 1XIYA 4LA1A 4O92A 2YP6A 1THOA 4FYBA 4MK3A 1M99A 2GDRA 1KNGA 4HJ2A 3QAWA 1FOVA 3FKFA 2JZSA 2CV4A 2H76A 5F8BA 4LLRA 2JZRA 2PPTA 5ELAA 3RAZA 3GKXA 2YWIA 1WOUA 4JU5A 5ECPB 5IPGA 2GQKA 4K6XA 3D4TA 1K0DA 3FYGA 3W8JA 3M3MA 2B1LA 4XS4A 2H6XA 1QMVA 1XVQA 2BMXA 2HXKA 3F9UA 5KN3A 4WKWA 4I2UA 5EPFA 4NXIA 4TR1B 4HI7A 5KN2A 1UA5A 3CYNA 4BWSA 1AQVA 4K2DA 5ECNB 3ZMLA 1S3CA 6GSUA 1U88A 4AJ8A 4K0NA 4XS4B 5E4WA 1G7OA 3GKNA 2VCTA 4I8BA 11GSA 5E59A 3KTBA 2H19A 1ZYEA 1J9BA 2P31A 4MMMA 2GS3A 1H4OA 2KP1A 1EOHA 3G7JA 5D9WA 2MMNA 4YQVA 1TK8B 2EIRA 4XRDA 3TOUA 2C0EA 4D73A 16GSA 2TRCP 4OD7A 4L5LA 4GQCA 1QFNA 4AJ7A 1K0OA 3QFAC 4ZB6A 3CXGA 1Y6EA 4YH2A 1EV4A 3IK7A 4F2IA 4IQAA 4KDXA 3GRXA 4ML6A 4G9HA 1G0TA 4JEDA 1EEJA 1J0FA 2C3TA 2XPEA 4ZBBA 4PUFC 1EP7A 3LQ7A 4HQZA 1A2MA 2G2QA 3ZMKA 1WWJA 1ZZYA 2H1DA 2GZPA 5HFKA 1YEXA 3FHKA 4YAVA 3IV4A 5GAPD 3Q18A 1FW1A 1TU7A 2L4CA 1JZDA 3IHQA 3A2WA 3GNJA 2JSYA 3ZIVA 3F4SA 2NTOA 1HYUA 2PU9C 4ZBDA 3DXBA 4XHMA 1O81A 1XOAA 1QGVA 3DEXA 3TRXA 1W4VA 3QR6A 4EUYA 1U3IA 4KGIA 1AC1A 3NIVA 2DC5A 4NMUA 3GH9A 2GSSA 1EGRA 3KGKA 3TKSE 3F3QA 4MJEA 1G6YA 1XW5A 2LNSA 3MDKA 3UAPA 2HT9A 5D73A 1LBKA 2KLXA 4FYCA 2DLXA 3JCML 4GSTA 1K3OA 3FR3A 2JU5A 10GSA 2GT5A 4WBRD 3KD0A 3MWHA 3QDNA 3CRUA 3ZREA 1THXA 3IK9A 5A5KA 2N5AA 3GHAA 5CREA 1WJKA 1PX6A 2OA7A 2H70A 4MH3A 2VD1A 2F51A 3D0ZA 1V57A 1A8YA 2PVOC 1JLWA 1XFLA 2RLIA 2H75A 3I6AA 1B8XA 2P5QA 3TKSC 1X9SB 2VUPA 1NM3A 4YAPA 1O73A 3K8NA 4KDYA 4WXTA 2WGRA 3HZ4A 3HJOA 1OAZA 3ZLPA 3LWAA 4K7IA 4ZB9A 1SJIA 4F03A 3P8WA 2I4AA 3VK9A 4KSMA 1S3DA 2NPBA 2WULA 1TK5B 3UL3A 3WT2A 1FO5A 4XS6A 1ZL9A 2IIYA 2YZHA 4K8MA 2VM1A 4MJAA 1PKWA 2FUG2 6GSWA 2IFQA 1ZOFA 1SKRB 2RM5A 3UVTA 2R4VA 6GSYA 4IN0A 1T00A 1JZWA 4DSQA 2C80A 1GWCA 2HNLA 4N30A 3J7Yb 4TXOB 3P7XA 4IELA 3EMPA 2YJHA 4HU7A 3A3TA 1ML6A 1TI3A 4WR5A 4HJMA 2X64A 4PURA 4ECCA 2HZFA 3QMXA 3J7Yk 3TJJA 3QCPA 4JRRA 5ECKB 1JHBA 3KH7A 3KMOA 4JR4A 5CYYA 3A2XA 2LJRA 3UVHA 4BA7A 3A5WA 4MJBA 1Y25A 4XCSA 4IW9A 3KMNA 1RQMA 4ZL9A 3UJ1A 1ERWA 1GSFA 3HVXA 2MMAA 3KEBA 4V2LA 2O8VB 2YZUA 4KA0A 1GL8A 5D96A 1LU4A 4G10A 4F82A 1VF2A 2WZ9A 1WP0A 2H72A 4KB3A 3VWUA 3WGXA 2XPDA 1OC9B 2LTKA 1R7HA 2CAQA 1JLVA 1YEPA 2C0FA 3LXZA 2I9HA 2CX3A 1NSWA 3WD6A 5KN0A 4ZILA 1GTAA 4RI6A 3TUEA 3EE2A 2CAIA 1LJRA 3CTFA 4ID0A 1SK2A 1VGLA 1K0MA 2VLUA 4Q5FA 2NVLA 1K3YA 5IOXA 2DJ2A 2DBCA 2LQOA 3I69A 2X8HA 5ECMB 1PSQA 2FWHA 3O3TA 4J57E 2IMKA 2H6ZA 4XS1A 1YY7A 4BVYA 2PVQA 2BJXA 1XWGA 3HD5A 2A2RA 1UVZA 2Z9SA 14GSA 3CRTA 2GTUA 1U6TA 1GTBA 3LSZA 1X5DA 4MPGA 2V41A 2DIYA 2LRTA 3WGDA 3VLNA 2YCDA 3L9VA 3TB2A 4IP6A 2H0IA 2GZZA 2LS5A 1O8XA 2XC2A 1PL1A 3IE3A 2MZCA 4OWYA 1EOGA 2HRFA 1T4YA 2H30A 3HY2A 4TR0A 3HCZA 3F6DA 3ZL5A 4K0GA 4L5OA 5B7CA 3LJRA 5KN1A 2X99A 5JWQB 4RQRA 5DDLA 19GSA 2CA8A 3D4MA 4FIWA 2TIRA 3N5OA 3ZRDA 4NAXA 17GSA 4Z7XA 3LXTA 3L9SA 3MSZA 5G30A 4PGTA 1FVJA 2WB9A 3WGEA 2WDUA 1USBA 2B1KA 3U6VA 3O6TA 3RDWA 1WPIA 1NW2A 4ZB8A 3E3EA 1GSEA 3A2VA
chains in the Genus database with same CATH superfamily
1VRSD 1QXHA 1MDKA 2C1YA 1R5PA 3HJMA 2H01A 20GSA 1Q4JA 2D2ZA 2VOCA 1SK0A 3HZ8A 6GSXA 4X1UA 2HZEB 5HFGA 5ECSA 2LNTA 3O76A 4ECJA 2OADA 2MMZA 1I9DA 4Z2TA 1GSDA 1F2EA 1FAAA 3GX8A 4POMA 4V2NA 4WEYA 1QUWA 1TJDA 2C0GA 2R5GA 3EC3A 4TXVA 2NDOA 1IYHA 1A23A 1W89A 4HZ2A 4XRAA 2VLTA 4GTUA 1ILOA 5FWGA 1EV9A 3HYPA 5ECQB 3D22A 5HR2A 4Q5RA 2YPMA 3NZNA 1SKWB 2N5FA 3M9JA 3RPPA 4TR1A 4XIHA 2L6CA 4LMVA 2B5XA 3C7MA 3L9UA 2IMDA 4V2MA 5IMZA 5A4VA 3APSA 2DJ1A 5H5QA 5ID2B 2B5YA 2VLVA 4BVXA 1K0NA 2QC7A 4KDUA 4LL1B 2ES7A 3H79A 5G2ZA 1OE7A 2GQMA 1PN9A 5DBQA 5F07A 3EINA 4K9ZA 1BG5A 4EE0A 1A2JA 2MBTA 1YKCA 4POLA 1DE1A 1SKSB 2FY6A 4IHUA 1GNWA 1YJ6A 4MZCA 2PUKC 5DJLA 2L59A 3ME7A 2F8AA 2ON7A 1A24A 3KCMA 2GSTA 3TRQA 3TOTA 4PX1A 1XBSA 4J56E 3APOA 1Z7RA 3DYRA 2GT6A 4KW6A 4BPYA 3HJPA 4P3YB 3RPNA 1PGTA 3GKMA 2KOKA 4MLYA 1TRSA 2B7KA 4N0ZA 4CY6A 1X5EA 1JZRA 5D9TA 1YZXA 4QL9A 1MD3A 1AQWA 3LEFA 5IO2A 2GLRA 2WS2A 3L78A 3AY8A 1PL2A 3MYDA 4KUNA 5CRHA 4ECBA 5JCUA 2ALBA 3LG6A 5IIZA 2TRXA 5ELGA 1ZGNA 3QAVA 1TRWA 1V40A 2O7KA 4HUAA 3H8QA 4GF0A 1XCCA 3IOSA 2PGTA 4NPBA 5AISA 2K9FA 5IOWA 2RUEA 2CVBA 5H5SA 1SL1B 4FO5A 5J5NA 4WETA 3FRCA 5ECRB 6GSSA 2EIQA 3EURA 3GX0A 2KHPA 5DCGA 4Z2RA 3UBLA 3M1GA 2C8UA 4IJIA 4MF7A 2IJYA 4HSCX 2CVKA 1HD2A 3SBCA 3MIXA 3IC4A 2WRTA 4KCAA 4YQUA 4PQHA 3VWVA 2GSRA 2L5LA 6GSVA 2MYGA 4PUAA 1PRXA 2E7PA 2FNOA 4KNDA 2DJ3A 1GNEA 3FZ4A 18GSA 1PA3A 4GQFA 1WRYA 4EDZA 2H1BA 4ZXGA 4GWRA 1MTCA 4GSSA 3DGQA 4NV2A 1I5GA 5DQYA 3I9V2 1TRUA 2K8SA 4IP1A 3P2AA 4MH2A 5L71A 1GUKA 1M7TA 5HQPA 3DIEA 4I97A 2X8GA 1GTUA 3M9KA 2I81A 3IBHA 4TKYA 3HDCA 2ON5A 1FOHA 1WE0A 3FEUA 4ILFA 2MMOA 8GSSA 1KBNA 2LRCA 4X0XA 1QQ2A 4O7HA 4HZ4A 3DKSA 2YV9A 1FB6A 1H75A 3FK8A 3EU3A 3ERWA 3CBUA 3LFLA 2C4JA 4AF2A 2R37A 1MEKA 2A2SA 4L8EA 2IMEA 4EO3A 3GTUA 4EXJA 2FA8A 1YQ1A 5IMCA 4HU9A 4NHZA 4NV5A 5CAXA 4ZIJA 2R6KA 5JWRB 4OFNA 2CX4A 2E2MA 4NWYA 5HR0A 4TXOA 2VL2A 1HNAA 1KTEA 3VWWA 4OCEA 4HOJA 2AUVA 4E8HA 2B3SA 3TKPA 4TRXA 3QPMA 3GTUB 4OFMA 2GGTA 2A4VA 2V32A 1R26A 2GZYA 2O89A 2YWNA 1NHOA 2FWEA 3FR6A 13GSA 3GV1A 2HYXA 2VL9A 4LL4B 4YKFA 5JCWA 4DSSB 2X8CA 2F9SA 4WF4A 2DSAA 1TKDB 5AGYA 1YF1A 3APQA 1O8WA 5GAND 3C1RA 2JADA 1ZCPA 2WCIA 2B7JA 1M0UA 3MAKA 1E6BA 4EKZA 3QOUA 3KXOA 2IMIA 4JZQA 5IMDA 1OC9A 2JACA 3LW9A 4Q5QA 2KP2A 3VI7A 2VCWA 5BMUA 3BJ5A 2VCXA 3TKQA 3ED3A 5G5EA 4OFTA 4BL7A 3EMXA 1WMJA 1ST9A 5FHIA 1PMTA 3CTGA 2FLSA 5KOWA 2HE3A 3VI5A 1U3AA 3ZYWA 2CVDA 4DSRA 2H0GA 1GP1A 3KTLA 2OJLA 1OYJA 1GSUA 2PMTA 3FZ5A 1K0AA 3IRAA 1V98A 3PPUA 4MP4A 3U5RE 4IS0A 1URMA 3W6GA 2L5OA 4AGSA 2V2GA 4CHSA 1SYXA 2H74A 5J9BA 1GUHA 1K0BA 1O6JA 1JFUA 1OKDA 3NOFA 2P0GA 3ZFBA 1YDKA 3KIJA 2HRNA 1R4WA 5COHA 1FB0A 1Z6NA 3E9JB 2M46A 3ERGA 2BTOT 2H66A 4ZBAA 4LMWA 3HHVA 3UARA 3R2QA 2R3XA 3F63A 4IBPA 3VPTA 1PD21 3CQFA 4WBJA 3QFBC 1M9AA 3GL5A 1XWCA 2XBQA 3GSTA 2H6YA 3GYKA 2DMMA 1Z3EA 2WFCA 3C73A 4MNNA 3UOMA 1OC8A 2B6MA 3IR4A 5CRWA 4RI7A 1TOFA 4IKHA 3IAS2 4F0BA 4EIQA 22GSA 4GLTA 3M0FA 2DJ0A 3GSSA 3IAM2 2C0DA 4ICYA 1DBYA 5H5RA 1EEMA 2LRNA 4G2EA 2B5EA 4L0UA 1VF3A 1N8JA 3IHGA 1ABAA 3UIWA 1EGOA 1K0CA 3GURA 3ISOA 4KSOA 2VAFA 4NHWA 3RBTA 1GSQA 4G19A 3ZITA 1QK8A 1SD9A 1XWAA 4MJCA 1M2DA 2V6OA 3IXRA 1SL2B 5ECHB 3C8EA 2H0HA 2H1AA 3GN3A 5INYA 2DJJA 3MNGA 3EWLA 3HXSA 1FHEA 2GQLA 4TVEA 2FHEA 2KUCA 3IPZA 3F8UA 2L4QA 3IA1A 2RUFA 3C71A 3L0HA 2L57A 3ME8A 2HZEA 1HNBA 3DWVA 5D8IA 2ZNMA 3KM6A 1XWKA 1ERVA 4QL7A 3P90A 1N2AA 3LGCA 2FWGA 2L6DA 5B8BA 1GULA 2CZ3A 3DD3A 3GIXA 2V1MA 5EVOA 2PWJA 4PQ1A 3IDVA 1AIUA 3S9FA 4K2XA 3KJYA 5J9CA 4MCUA 2HSHA 2I3YA 3FZAA 4IQ1A 3E0UA 5JWOB 3VPQA 3ZTLA 1FVKA 1A8LA 5DVBA 1BJXA 2J9HA 2C3QA 3ZVJA 4N0VA 3GUSA 1OKTA 4HQSA 1AQXA 1XXUA 3A5IA 2HRAA 2LSTA 3C1SA 5ID2A 5J3RA 1DUGA 5CP1A 1S3RA 3OR5A 2FGXA 2M80A 2H1GA 1SJ6A 3PGTA 1A2LA 3FR9A 5DCHA 3ERFA 4KE3A 1GLQA 1M2AA 1HNCA 1O85A 4CDOA 1RK4A 2IMFA 1CQHA 4KCEA 2OBKA 1R5AA 1KEBA 4K7NA 4TR3A 3DVWA 3F4RA 3DRNA 3BBYA 3KP9A 3BCKA 5A4WA 4TN8A 3FY7A 1M9BA 4L0WA 2G0FA 5AN1A 3CMIA 1XOBA 1GH2A 2YWMA 5IMAA 4JR6A 2P5RA 3TKSA 4MZWA 1TI1A 3F0IA 5EL8A 2K18A 4G0LA 1SD8A 1OE8A 5IQYA 2OE0A 7GSSA 1BQ7A 2CZ2A 2OE1A 3D5JA 5AIXA 4TR4A 3EVIA 4PNGA 1C72A 4GSNA 5LCZA 1O7UA 3D6IA 2R0PA 2O87A 1GSSA 1T4ZA 1YKAA 2YJ7A 3G7IA 2PERA 4MPFA 4O32A 4WR4A 5G31A 6GSTA 5D9XA 1XPVA 1F6MC 2HFDA 4O5RA 1A0RP 4DEJA 4X4JA 4MABA 2X4AA 3BCIA 1CQGA 4I2TA 1TRVA 5J4UA 3QAGA 4JE1A 5DAKA 3TJGA 1B9YC 2VM2A 2XBIA 4D73B 1EP8A 2NBSA 2RM6A 5J41A 4G0KA 2LQQA 1WIKA 2JL4A 3H93A 3EU4A 4RQXA 1BAYA 3TJBA 1SU9A 1GTIA 2H71A 2AYTA 2OACA 5HFIA 5DAKB 4TOPA 3SWLA 2F8FA 1XWBA 4OO4A 5KEJA 2HSYA 4RUVA 4XTSA 1AW9A 1AUCA 4G0IA 1AXDA 2YNXA 5D9VA 2JZTA 3UEMA 4N10A 1F9MA 1SJZA 4FYUA 1SL0B 3GFKA 4ACSA 2REMA 3TJKA 3CSHA 5IPHA 4HS1A 3HVVA 4K7OA 5AIVA 2HLSA 4DVCA 2DMLA 2AJQB 2LUSA 5ABRA 3CSIA 3H4KA 3FZ9A 4PNFA 2EC4A 2DJKA 3EYTA 1ACVA 1TP9A 3GH6A 1VF1A 2PBJA 4MDCA 4JBBA 1TTZA 3KH9A 1GUMA 4V1Ag 2N5BA 5B6NA 2OE3A 1BX9A 4HDEA 3TKRA 1E2YA 5KOXA 3D21A 5EY6A 2LJAA 2EIOA 4GCIA 4IVFA 1XVWA 5CO3A 4OO5A 5A4UA 4KAEA 4IGJA 3TCOA 4ISDA 1S3AA 1XW6A 4MF6A 1OC3A 2VD0A 3I43A 3ZIJA 1MDJA 2R0CA 1A0FA 1AAZA 1EZKA 1Q98A 4OCFA 2QSIA 1B48A 5CRDA 1T7PB 3TDGA 1GLPA 1G6WA 4K5RA 1ON4A 3ZZXA 1T3BA 2AB6A 5ECOB 1HQOA 4DSSA 2VIMA 2IWTA 3N9JA 3GL3A 1SYRA 3IC8A 4OMVA 4X43A 3HVNA 2H73A 4YQMA 3US3A 5JCGA 3W8SA 5ECLB 1BYEA 4PXOA 2E0QA 5LNKe 2M72A 5GSTA 1XZOA 2FCHA 2MBSA 2GVPA 2VCZA 4PQIA 2AAWA 4J2FA 3RHBA 2V6KA 1X9WB 4ZL7A 1ZMAA 1PN0A 4BIKA 1ERUA 2IFQB 3TRPA 3WYWA 3V1WA 3VWXA 1IYIA 5B6MA 1DSBA 3HKRA 3F4TA 9GSSA 3H1NA 2J23A 5GZZB 1T1VA 4AJ6A 1PFOA 1UC7A 4EL1A 5CRGA 4EVMA 1ZYNA 3PINA 2A2PA 3LYKA 2IN3A 2HI7A 2HSMA 2FA4A 3F6FA 2FWFA 5IMFA 4ULXA 2YOIA 2YV7A 5G1LA 2QKEA 3TGZA 3HA9A 1XW9A 2LKUA 2WJUA 2VCQA 3Q74A 1JZOA 3VFIA 2R2JA 4K1FA 4Z2UA 1TDIA 2AV4A 2IPAA 1B9XC 3HVSA 3Q6OA 5HR3A 4KF9A 5IO0A 5IM9A 2VL3A 1GSYA 1ZYQB 2YN1A 1Z9HA 1UN2A 2LV3A 4GXZA 2GSQA 5F06A 1Z7PA 4F9ZA 1B4QA 12GSA 2I1UA 3QD9A 4FH8A 2DIZA 4I5QA 2ZUPA 5DQSA 1X0RA 2QA2A 3CSJA 5G1KA 2CT6A 2HRKA 2IL3A 3TJFA 3GKKA 4F0CA 2UZ8A 1V9WA 3UBKA 2F3MA 5LD0A 3VURA 2OBIA 2H8LA 4MZBA 5F0GA 5DJMA 1K3LA 2PN8A 5B8AA 1MD4A 2LJKA 4E8EA 3GMFA 3KP8A 3RHCA 4MA9A 3FW2A 5CNWA 1T8EB 1SENA 5C00A 2VCVA 4POKA 3WT1A 1F3AA 1BEDA 5ECIB 4HEA2 5G5FA 3G9BA 4H86A 5DALA 4BVYB 2VL2C 1NHYA 3M8NA 5GSSA 1YF0A 2ZCTA 4V1Ap 5HR1A 5FT3A 1Z6MA 4KH7A 1V58A 3GA4A 3LORA 2YANA 4ZL8A 1X5CA 3PR8A 1U87A 4N11A 3ZVJD 5F05A 4EDYA 5IMVA 5DALB 3F3RA 2JSZA 4ML1A 2OKAA 3PH9A 1PX7A 1F37A 2K8VA 1OVNA 2C3NA 3ZFLA 2K6VA 1X9MB 1DE2A 3L4NA 5ENUA 1J08A 1B4PA 4POBA 1TW9A 1SK1A 2CQ9A 1TK0B 2QGVA 1PQNA 4Q5NA 5C04A 2YWOA 1TU8A 1G7EA 4TW5A 3KZQA 2FD3A 2VO4A 1FG4A 2O85A 4EF0A 1F3BA 1PKZA 4CW9A 1GRXA 1Z5YE 4KX4A 3UMAA 4QQ7A 1EWXA 4I6XA 4EC0A 3G7YA 4WF5A 1VF4A 3LYPA 1XG8A 4GRFA 2E2GA 1M2BA 2RIIA 1V2AA 2XHFA 3DMLA 3BD2A 1RW1A 5D93A 1TXXA 1MDIA 4BWQA 3BOAA 4EIPA 4IJ3A 4ECIA 4MF5A 2LEGA 3Q19A 1ERTA 2AHEA 3DVXA 1XIYA 4LA1A 4O92A 2YP6A 1THOA 4FYBA 4MK3A 1M99A 2GDRA 1KNGA 4HJ2A 3QAWA 1FOVA 3FKFA 2JZSA 2CV4A 2H76A 5F8BA 4LLRA 2JZRA 2PPTA 5ELAA 3RAZA 3GKXA 2YWIA 1WOUA 4JU5A 5ECPB 5IPGA 2GQKA 4K6XA 3D4TA 1K0DA 3FYGA 3W8JA 3M3MA 2B1LA 4XS4A 2H6XA 1QMVA 1XVQA 2BMXA 2HXKA 3F9UA 4YKGA 4PTSA 5KN3A 4WKWA 4I2UA 5EPFA 4NXIA 4TR1B 4HI7A 5KN2A 1UA5A 3CYNA 4BWSA 1AQVA 4K2DA 5ECNB 3ZMLA 1S3CA 6GSUA 1U88A 4AJ8A 4K0NA 4XS4B 5E4WA 1G7OA 4BVXB 3GKNA 2VCTA 4I8BA 2A4HA 11GSA 5E59A 3KTBA 2H19A 1ZYEA 1J9BA 2P31A 4MMMA 2GS3A 1H4OA 2KP1A 1EOHA 3G7JA 5D9WA 2MMNA 4YQVA 1TK8B 2EIRA 4XRDA 3TOUA 2C0EA 4D73A 16GSA 2TRCP 4OD7A 4L5LA 2R0GA 4GQCA 1QFNA 4AJ7A 1K0OA 3QFAC 4ZB6A 3CXGA 1Y6EA 4O5QA 4YH2A 1EV4A 3IK7A 4F2IA 4IQAA 4CY8A 4KDXA 3GRXA 4ML6A 4G9HA 1G0TA 4JEDA 1EEJA 1J0FA 2C3TA 2XPEA 4ZBBA 4PUFC 1EP7A 3LQ7A 4HQZA 1A2MA 2G2QA 3ZMKA 1WWJA 1ZZYA 2H1DA 2GZPA 5HFKA 1YEXA 4O5UA 3FHKA 4YAVA 3IV4A 5GAPD 3Q18A 1FW1A 1TU7A 2L4CA 1JZDA 3IHQA 3A2WA 3GNJA 2JSYA 2QA1A 3ZIVA 3F4SA 2NTOA 1HYUA 2PU9C 4ZBDA 3DXBA 4XHMA 1O81A 1XOAA 1M3IA 1QGVA 3DEXA 3TRXA 1W4VA 3QR6A 4EUYA 1U3IA 4KGIA 1AC1A 3NIVA 2DC5A 4NMUA 3GH9A 2GSSA 3EPTA 1EGRA 3KGKA 3TKSE 3F3QA 4MJEA 1G6YA 1XW5A 2LNSA 3MDKA 3UAPA 2HT9A 5D73A 1LBKA 2KLXA 4FYCA 2DLXA 2X49A 3JCML 4GSTA 1K3OA 3FR3A 2JU5A 10GSA 2GT5A 4WBRD 3KD0A 3MWHA 3QDNA 3CRUA 3ZREA 1THXA 3IK9A 5A5KA 2N5AA 3GHAA 5CREA 1WJKA 1PX6A 2OA7A 2H70A 4MH3A 2VD1A 2F51A 3D0ZA 5BRTA 1V57A 2DKIA 1A8YA 2PVOC 1JLWA 1XFLA 2RLIA 2H75A 3I6AA 1B8XA 2P5QA 3TKSC 1X9SB 2VUPA 1NM3A 4YAPA 1O73A 3K8NA 4KDYA 4WXTA 2WGRA 3HZ4A 3HJOA 1OAZA 3ZLPA 3LWAA 4K7IA 4ZB9A 1SJIA 4F03A 3P8WA 2I4AA 3VK9A 4KSMA 1S3DA 2NPBA 2WULA 1TK5B 3UL3A 3WT2A 1FO5A 4XS6A 1ZL9A 2IIYA 2YZHA 4K8MA 2VM1A 4MJAA 1PKWA 2FUG2 6GSWA 2IFQA 1ZOFA 1SKRB 2RM5A 3UVTA 2R4VA 6GSYA 4IN0A 1T00A 1JZWA 4DSQA 2C80A 1GWCA 2HNLA 4N30A 3J7Yb 4TXOB 3P7XA 4IELA 3EMPA 2YJHA 4HU7A 3A3TA 1ML6A 1TI3A 4WR5A 4HJMA 2X64A 4PURA 4ECCA 2HZFA 3QMXA 3J7Yk 3TJJA 3QCPA 4JRRA 5ECKB 1JHBA 3KH7A 3KMOA 4JR4A 5CYYA 3A2XA 2LJRA 3UVHA 4BA7A 3A5WA 4MJBA 1Y25A 4XCSA 4IW9A 3KMNA 1RQMA 4ZL9A 3UJ1A 1ERWA 1GSFA 4A5PA 3HVXA 2MMAA 3KEBA 4V2LA 2O8VB 2YZUA 4KA0A 1GL8A 5D96A 1LU4A 4G10A 4F82A 1VF2A 2WZ9A 3FMWA 1WP0A 2H72A 4KB3A 3VWUA 3WGXA 2XPDA 1OC9B 2LTKA 1R7HA 2CAQA 1JLVA 1YEPA 2C0FA 3LXZA 2I9HA 2CX3A 1NSWA 3WD6A 5KN0A 4ZILA 1GTAA 4RI6A 4BL7B 3TUEA 3EE2A 2CAIA 1LJRA 3CTFA 4ID0A 1SK2A 1VGLA 1K0MA 2VLUA 4Q5FA 2NVLA 1K3YA 4K5SA 5IOXA 2DJ2A 2DBCA 2LQOA 4FQUA 3I69A 2X8HA 5ECMB 1PSQA 2FWHA 3O3TA 4J57E 2IMKA 2H6ZA 4XS1A 1YY7A 4BVYA 3R3EA 2PVQA 2BJXA 1XWGA 3HD5A 2A2RA 1UVZA 2Z9SA 14GSA 3CRTA 2GTUA 1U6TA 1GTBA 3LSZA 4USSA 1X5DA 4MPGA 2V41A 2DIYA 2LRTA 3WGDA 2DKHA 3VLNA 2YCDA 3L9VA 3TB2A 4IP6A 2H0IA 2GZZA 2LS5A 1O8XA 2XC2A 1PL1A 1ZYPA 3IE3A 2MZCA 4OWYA 1EOGA 2HRFA 1T4YA 2H30A 3HY2A 4TR0A 3HCZA 3F6DA 3ZL5A 4K0GA 4L5OA 5B7CA 3LJRA 5KN1A 2X99A 5JWQB 4RQRA 5DDLA 19GSA 2CA8A 3D4MA 4FIWA 2TIRA 3N5OA 3ZRDA 4NAXA 17GSA 4Z7XA 3LXTA 3L9SA 3MSZA 5G30A 4PGTA 1M3JA 1FVJA 2WB9A 3WGEA 2WDUA 1USBA 2B1KA 3U6VA 3O6TA 3RDWA 1WPIA 1NW2A 4ZB8A 3E3EA 1GSEA 3A2VA
chains in the Genus database with same CATH topology
1VRSD 1QXHA 1MDKA 2C1YA 1R5PA 3HJMA 2H01A 20GSA 1Q4JA 2D2ZA 2VOCA 1SK0A 3HZ8A 6GSXA 4X1UA 2HZEB 5HFGA 5ECSA 2LNTA 3O76A 4ECJA 2OADA 2MMZA 1I9DA 4Z2TA 1GSDA 1F2EA 1FAAA 3GX8A 4POMA 4V2NA 4WEYA 1QUWA 1TJDA 2C0GA 2R5GA 3EC3A 4TXVA 2NDOA 1IYHA 1A23A 1W89A 4HZ2A 4XRAA 2VLTA 4GTUA 1ILOA 5FWGA 1EV9A 3HYPA 5ECQB 3D22A 5HR2A 4Q5RA 2YPMA 3NZNA 1SKWB 2N5FA 3M9JA 3RPPA 4TR1A 4XIHA 2L6CA 4LMVA 2B5XA 3C7MA 3L9UA 2IMDA 4V2MA 5IMZA 5A4VA 3APSA 2DJ1A 5H5QA 5ID2B 2B5YA 2VLVA 4BVXA 1K0NA 2QC7A 4KDUA 4LL1B 2ES7A 3H79A 5G2ZA 1OE7A 2GQMA 1PN9A 5DBQA 5F07A 3EINA 4K9ZA 1BG5A 4EE0A 1A2JA 2MBTA 1YKCA 4POLA 1DE1A 1SKSB 2FY6A 4IHUA 1GNWA 1YJ6A 4MZCA 2PUKC 5DJLA 2L59A 3ME7A 2F8AA 2ON7A 1A24A 3KCMA 2GSTA 3TRQA 3TOTA 4PX1A 1XBSA 4J56E 3APOA 1Z7RA 3DYRA 2GT6A 4KW6A 4BPYA 3HJPA 4P3YB 3RPNA 1PGTA 3GKMA 2KOKA 4MLYA 1TRSA 2B7KA 4N0ZA 4CY6A 1X5EA 1JZRA 5D9TA 1YZXA 4QL9A 1MD3A 1AQWA 3LEFA 5IO2A 2GLRA 2WS2A 3L78A 3AY8A 1PL2A 3MYDA 4KUNA 5CRHA 4ECBA 5JCUA 2ALBA 3LG6A 5IIZA 2TRXA 5ELGA 1ZGNA 3QAVA 1TRWA 1V40A 2O7KA 4HUAA 3H8QA 4GF0A 1XCCA 3IOSA 2PGTA 4NPBA 5AISA 2K9FA 5IOWA 2RUEA 2CVBA 5H5SA 1SL1B 4FO5A 5J5NA 4WETA 3FRCA 5ECRB 6GSSA 2EIQA 3EURA 3GX0A 2KHPA 5DCGA 4Z2RA 3UBLA 3M1GA 2C8UA 4IJIA 4MF7A 2IJYA 2CVKA 1HD2A 3SBCA 3MIXA 3IC4A 2WRTA 4KCAA 4YQUA 4PQHA 3VWVA 2GSRA 2L5LA 6GSVA 2MYGA 4PUAA 1PRXA 2E7PA 2FNOA 4KNDA 2DJ3A 1GNEA 3FZ4A 18GSA 1PA3A 4GQFA 1WRYA 4EDZA 2H1BA 4ZXGA 4GWRA 1MTCA 4GSSA 3DGQA 4NV2A 1I5GA 5DQYA 3I9V2 1TRUA 2K8SA 4IP1A 3P2AA 4MH2A 5L71A 1GUKA 1M7TA 5HQPA 3DIEA 4I97A 2X8GA 1GTUA 3M9KA 2I81A 3IBHA 4TKYA 3HDCA 2ON5A 1FOHA 1WE0A 3FEUA 4ILFA 2MMOA 8GSSA 1KBNA 2LRCA 4X0XA 1QQ2A 4O7HA 4HZ4A 3DKSA 2YV9A 1FB6A 1H75A 3FK8A 3EU3A 3ERWA 3CBUA 3LFLA 2C4JA 4AF2A 2R37A 1MEKA 2A2SA 4L8EA 2IMEA 4EO3A 3GTUA 4EXJA 2FA8A 1YQ1A 5IMCA 4HU9A 4NHZA 4NV5A 5CAXA 4ZIJA 2R6KA 5JWRB 4OFNA 2CX4A 2E2MA 4NWYA 5HR0A 4TXOA 2VL2A 1HNAA 1KTEA 3VWWA 4OCEA 4HOJA 2AUVA 4E8HA 2B3SA 3TKPA 4TRXA 3QPMA 3GTUB 4OFMA 2GGTA 2A4VA 2V32A 1R26A 2GZYA 2O89A 2YWNA 1NHOA 2FWEA 3FR6A 13GSA 3GV1A 2HYXA 2VL9A 4LL4B 4YKFA 5JCWA 4DSSB 2X8CA 2F9SA 4WF4A 2DSAA 1TKDB 5AGYA 1YF1A 3APQA 1O8WA 5GAND 3C1RA 2JADA 1ZCPA 2WCIA 2B7JA 1M0UA 3MAKA 1E6BA 4EKZA 3QOUA 3KXOA 2IMIA 4JZQA 5IMDA 1OC9A 2JACA 3LW9A 4Q5QA 2KP2A 3VI7A 2VCWA 5BMUA 3BJ5A 2VCXA 3TKQA 3ED3A 5G5EA 4OFTA 4BL7A 3EMXA 1WMJA 1ST9A 5FHIA 1PMTA 3CTGA 2FLSA 5KOWA 2HE3A 3VI5A 1U3AA 3ZYWA 2CVDA 4DSRA 2H0GA 1GP1A 3KTLA 2OJLA 1OYJA 1GSUA 2PMTA 3FZ5A 1K0AA 3IRAA 1V98A 3PPUA 4MP4A 3U5RE 4IS0A 1URMA 3W6GA 2L5OA 4AGSA 2V2GA 4CHSA 1SYXA 2H74A 5J9BA 1GUHA 1K0BA 1O6JA 1JFUA 1OKDA 3NOFA 2P0GA 3ZFBA 1YDKA 3KIJA 2HRNA 1R4WA 5COHA 1FB0A 1Z6NA 3E9JB 2M46A 3ERGA 2BTOT 2H66A 4ZBAA 4LMWA 3HHVA 3UARA 3R2QA 2R3XA 3F63A 4IBPA 3VPTA 1PD21 4WBJA 3QFBC 1M9AA 3GL5A 1XWCA 2XBQA 3GSTA 2H6YA 3GYKA 2DMMA 1Z3EA 2WFCA 3C73A 4MNNA 3UOMA 1OC8A 2B6MA 3IR4A 5CRWA 4RI7A 1TOFA 4IKHA 3IAS2 4F0BA 4EIQA 22GSA 4GLTA 3M0FA 2DJ0A 3GSSA 3IAM2 2C0DA 4ICYA 1DBYA 5H5RA 1EEMA 2LRNA 4G2EA 2B5EA 4L0UA 1VF3A 1N8JA 3IHGA 1ABAA 3UIWA 1EGOA 1K0CA 3GURA 3ISOA 4KSOA 2VAFA 4NHWA 3RBTA 1GSQA 4G19A 3ZITA 1QK8A 1SD9A 1XWAA 4MJCA 1M2DA 2V6OA 3IXRA 1SL2B 5ECHB 3C8EA 2H0HA 2H1AA 3GN3A 5INYA 2DJJA 3MNGA 3EWLA 3HXSA 1FHEA 2GQLA 4TVEA 2FHEA 2KUCA 3IPZA 3F8UA 2L4QA 3IA1A 2RUFA 3C71A 3L0HA 2L57A 3ME8A 2HZEA 1HNBA 3DWVA 5D8IA 2ZNMA 3KM6A 1XWKA 1ERVA 4QL7A 3P90A 1N2AA 3LGCA 2FWGA 2L6DA 5B8BA 1GULA 2CZ3A 3DD3A 3GIXA 2V1MA 5EVOA 2PWJA 4PQ1A 3IDVA 1AIUA 3S9FA 4K2XA 3KJYA 5J9CA 4MCUA 2HSHA 2I3YA 3FZAA 4IQ1A 3E0UA 5JWOB 3VPQA 3ZTLA 1FVKA 1A8LA 5DVBA 1BJXA 2J9HA 2C3QA 3ZVJA 4N0VA 3GUSA 1OKTA 4HQSA 1AQXA 1XXUA 3A5IA 2HRAA 2LSTA 3C1SA 5ID2A 5J3RA 1DUGA 5CP1A 3OR5A 2FGXA 2M80A 2H1GA 1SJ6A 3PGTA 1A2LA 3FR9A 5DCHA 3ERFA 4KE3A 1GLQA 1M2AA 1HNCA 1O85A 4CDOA 1RK4A 2IMFA 1CQHA 4KCEA 2OBKA 1R5AA 1KEBA 4K7NA 4TR3A 3DVWA 3F4RA 3DRNA 3BBYA 3KP9A 3BCKA 5A4WA 4TN8A 3FY7A 1M9BA 4L0WA 2G0FA 5AN1A 3CMIA 1XOBA 1GH2A 2YWMA 5IMAA 4JR6A 2P5RA 3TKSA 4MZWA 1TI1A 3F0IA 5EL8A 2K18A 4G0LA 1SD8A 1OE8A 5IQYA 2OE0A 7GSSA 1BQ7A 2CZ2A 2OE1A 3D5JA 5AIXA 4TR4A 3EVIA 4PNGA 1C72A 4GSNA 5LCZA 1O7UA 3D6IA 2R0PA 2O87A 1GSSA 1T4ZA 1YKAA 2YJ7A 3G7IA 2PERA 4MPFA 4O32A 4WR4A 5G31A 6GSTA 5D9XA 1XPVA 1F6MC 2HFDA 4O5RA 1A0RP 4DEJA 4X4JA 4MABA 2X4AA 3BCIA 1CQGA 4I2TA 1TRVA 5J4UA 3QAGA 4JE1A 5DAKA 3TJGA 1B9YC 2VM2A 2XBIA 4D73B 1EP8A 2NBSA 2RM6A 5J41A 4G0KA 2LQQA 1WIKA 2JL4A 3H93A 3EU4A 4RQXA 1BAYA 3TJBA 1SU9A 1GTIA 2H71A 2AYTA 2OACA 5HFIA 5DAKB 4TOPA 3SWLA 2F8FA 1XWBA 4OO4A 5KEJA 2HSYA 4RUVA 4XTSA 1AW9A 1AUCA 4G0IA 1AXDA 2YNXA 5D9VA 2JZTA 3UEMA 4N10A 1F9MA 1SJZA 4FYUA 1SL0B 3GFKA 4ACSA 2REMA 3TJKA 3CSHA 5IPHA 4HS1A 3HVVA 4K7OA 5AIVA 2HLSA 4DVCA 2DMLA 2AJQB 2LUSA 5ABRA 3CSIA 3H4KA 3FZ9A 4PNFA 2EC4A 2DJKA 3EYTA 1ACVA 1TP9A 3GH6A 1VF1A 2PBJA 4MDCA 4JBBA 1TTZA 3KH9A 1GUMA 4V1Ag 2N5BA 5B6NA 2OE3A 1BX9A 4HDEA 3TKRA 1E2YA 5KOXA 3D21A 5EY6A 2LJAA 2EIOA 4GCIA 4IVFA 1XVWA 5CO3A 4OO5A 5A4UA 4KAEA 4IGJA 3TCOA 4ISDA 1S3AA 1XW6A 4MF6A 1OC3A 2VD0A 3I43A 3ZIJA 1MDJA 2R0CA 1A0FA 1AAZA 1EZKA 1Q98A 4OCFA 2QSIA 1B48A 5CRDA 1T7PB 3TDGA 1GLPA 1G6WA 4K5RA 1ON4A 3ZZXA 1T3BA 2AB6A 5ECOB 1HQOA 4DSSA 2VIMA 2IWTA 3N9JA 3GL3A 1SYRA 3IC8A 4OMVA 4X43A 2H73A 4YQMA 3US3A 5JCGA 3W8SA 5ECLB 1BYEA 4PXOA 2E0QA 5LNKe 2M72A 5GSTA 1XZOA 2FCHA 2MBSA 2GVPA 2VCZA 4PQIA 2AAWA 4J2FA 3RHBA 2V6KA 1X9WB 4ZL7A 1ZMAA 1PN0A 1ERUA 2IFQB 3TRPA 3WYWA 3V1WA 3VWXA 1IYIA 5B6MA 1DSBA 3HKRA 3F4TA 9GSSA 3H1NA 2J23A 5GZZB 1T1VA 4AJ6A 1UC7A 4EL1A 5CRGA 4EVMA 1ZYNA 3PINA 2A2PA 3LYKA 2IN3A 2HI7A 2HSMA 2FA4A 3F6FA 2FWFA 5IMFA 4ULXA 2YOIA 2YV7A 5G1LA 2QKEA 3TGZA 3HA9A 1XW9A 2LKUA 2WJUA 2VCQA 3Q74A 1JZOA 3VFIA 2R2JA 4K1FA 4Z2UA 1TDIA 2AV4A 2IPAA 1B9XC 3HVSA 3Q6OA 5HR3A 4KF9A 5IO0A 5IM9A 2VL3A 1GSYA 1ZYQB 2YN1A 1Z9HA 1UN2A 2LV3A 4GXZA 2GSQA 5F06A 1Z7PA 4F9ZA 1B4QA 12GSA 2I1UA 3QD9A 4FH8A 2DIZA 4I5QA 2ZUPA 5DQSA 1X0RA 2QA2A 3CSJA 5G1KA 2CT6A 2HRKA 2IL3A 3TJFA 3GKKA 4F0CA 2UZ8A 1V9WA 3UBKA 2F3MA 5LD0A 3VURA 2OBIA 2H8LA 4MZBA 5F0GA 5DJMA 1K3LA 2PN8A 5B8AA 1MD4A 2LJKA 4E8EA 3GMFA 3KP8A 3RHCA 4MA9A 3FW2A 5CNWA 1T8EB 1SENA 5C00A 2VCVA 4POKA 3WT1A 1F3AA 1BEDA 5ECIB 4HEA2 5G5FA 3G9BA 4H86A 5DALA 4BVYB 2VL2C 1NHYA 3M8NA 5GSSA 1YF0A 2ZCTA 4V1Ap 5HR1A 5FT3A 1Z6MA 4KH7A 1V58A 3GA4A 3LORA 2YANA 4ZL8A 1X5CA 3PR8A 1U87A 4N11A 3ZVJD 5F05A 4EDYA 5IMVA 5DALB 3F3RA 2JSZA 4ML1A 2OKAA 3PH9A 1PX7A 1F37A 2K8VA 1OVNA 2C3NA 3ZFLA 2K6VA 1X9MB 1DE2A 3L4NA 5ENUA 1J08A 1B4PA 4POBA 1TW9A 1SK1A 2CQ9A 1TK0B 2QGVA 1PQNA 4Q5NA 5C04A 2YWOA 1TU8A 1G7EA 4TW5A 3KZQA 2FD3A 2VO4A 1FG4A 2O85A 4EF0A 1F3BA 1PKZA 4CW9A 1GRXA 1Z5YE 4KX4A 3UMAA 4QQ7A 1EWXA 4I6XA 4EC0A 3G7YA 4WF5A 1VF4A 3LYPA 4GRFA 2E2GA 1M2BA 2RIIA 1V2AA 2XHFA 3DMLA 3BD2A 1RW1A 5D93A 1TXXA 1MDIA 4BWQA 3BOAA 4EIPA 4IJ3A 4ECIA 4MF5A 2LEGA 3Q19A 1ERTA 2AHEA 3DVXA 1XIYA 4LA1A 4O92A 2YP6A 1THOA 4FYBA 4MK3A 1M99A 2GDRA 1KNGA 4HJ2A 3QAWA 1FOVA 3FKFA 2JZSA 2CV4A 2H76A 5F8BA 4LLRA 2JZRA 2PPTA 5ELAA 3RAZA 3GKXA 2YWIA 1WOUA 4JU5A 5ECPB 5IPGA 2GQKA 4K6XA 3D4TA 1K0DA 3FYGA 3W8JA 3M3MA 2B1LA 4XS4A 2H6XA 1QMVA 1XVQA 2BMXA 2HXKA 3F9UA 4YKGA 4PTSA 5KN3A 4WKWA 4I2UA 5EPFA 4NXIA 4TR1B 4HI7A 5KN2A 1UA5A 3CYNA 4BWSA 1AQVA 4K2DA 5ECNB 3ZMLA 1S3CA 6GSUA 1U88A 4AJ8A 4K0NA 4XS4B 5E4WA 1G7OA 4BVXB 3GKNA 2VCTA 4I8BA 2A4HA 11GSA 5E59A 3KTBA 2H19A 1ZYEA 1J9BA 2P31A 4MMMA 2GS3A 1H4OA 2KP1A 1EOHA 3G7JA 5D9WA 2MMNA 4YQVA 1TK8B 2EIRA 4XRDA 3TOUA 2C0EA 4D73A 16GSA 2TRCP 4OD7A 4L5LA 2R0GA 4GQCA 1QFNA 4AJ7A 1K0OA 3QFAC 4ZB6A 3CXGA 1Y6EA 4O5QA 4YH2A 1EV4A 3IK7A 4F2IA 4IQAA 4CY8A 4KDXA 3GRXA 4ML6A 4G9HA 1G0TA 4JEDA 1EEJA 1J0FA 2C3TA 2XPEA 4ZBBA 4PUFC 1EP7A 3LQ7A 4HQZA 1A2MA 2G2QA 3ZMKA 1WWJA 1ZZYA 2H1DA 2GZPA 5HFKA 1YEXA 4O5UA 3FHKA 4YAVA 3IV4A 5GAPD 3Q18A 1FW1A 1TU7A 2L4CA 1JZDA 3IHQA 3A2WA 3GNJA 2JSYA 2QA1A 3ZIVA 3F4SA 2NTOA 1HYUA 2PU9C 4ZBDA 3DXBA 4XHMA 1O81A 1XOAA 1QGVA 3DEXA 3TRXA 1W4VA 3QR6A 4EUYA 1U3IA 4KGIA 1AC1A 3NIVA 2DC5A 4NMUA 3GH9A 2GSSA 3EPTA 1EGRA 3KGKA 3TKSE 3F3QA 4MJEA 1G6YA 1XW5A 2LNSA 3MDKA 3UAPA 2HT9A 5D73A 1LBKA 2KLXA 4FYCA 2DLXA 2X49A 3JCML 4GSTA 1K3OA 3FR3A 2JU5A 10GSA 2GT5A 4WBRD 3KD0A 3MWHA 3QDNA 3CRUA 3ZREA 1THXA 3IK9A 5A5KA 2N5AA 3GHAA 5CREA 1WJKA 1PX6A 2OA7A 2H70A 4MH3A 2VD1A 2F51A 3D0ZA 5BRTA 1V57A 2DKIA 1A8YA 2PVOC 1JLWA 1XFLA 2RLIA 2H75A 3I6AA 1B8XA 2P5QA 3TKSC 1X9SB 2VUPA 1NM3A 4YAPA 1O73A 3K8NA 4KDYA 4WXTA 2WGRA 3HZ4A 3HJOA 1OAZA 3ZLPA 3LWAA 4K7IA 4ZB9A 1SJIA 4F03A 3P8WA 2I4AA 3VK9A 4KSMA 1S3DA 2NPBA 2WULA 1TK5B 3UL3A 3WT2A 1FO5A 4XS6A 1ZL9A 2IIYA 2YZHA 4K8MA 2VM1A 4MJAA 1PKWA 2FUG2 6GSWA 2IFQA 1ZOFA 1SKRB 2RM5A 3UVTA 2R4VA 6GSYA 4IN0A 1T00A 1JZWA 4DSQA 2C80A 1GWCA 2HNLA 4N30A 3J7Yb 4TXOB 3P7XA 4IELA 3EMPA 2YJHA 4HU7A 3A3TA 1ML6A 1TI3A 4WR5A 4HJMA 2X64A 4PURA 4ECCA 2HZFA 3QMXA 3J7Yk 3TJJA 3QCPA 4JRRA 5ECKB 1JHBA 3KH7A 3KMOA 4JR4A 5CYYA 3A2XA 2LJRA 3UVHA 4BA7A 3A5WA 4MJBA 1Y25A 4XCSA 4IW9A 3KMNA 1RQMA 4ZL9A 3UJ1A 1ERWA 1GSFA 4A5PA 3HVXA 2MMAA 3KEBA 4V2LA 2O8VB 2YZUA 4KA0A 1GL8A 5D96A 1LU4A 4G10A 4F82A 1VF2A 2WZ9A 3FMWA 1WP0A 2H72A 4KB3A 3VWUA 3WGXA 2XPDA 1OC9B 2LTKA 1R7HA 2CAQA 1JLVA 1YEPA 2C0FA 3LXZA 2I9HA 2CX3A 1NSWA 3WD6A 5KN0A 4ZILA 1GTAA 4RI6A 4BL7B 3TUEA 3EE2A 2CAIA 1LJRA 3CTFA 4ID0A 1SK2A 1VGLA 1K0MA 2VLUA 4Q5FA 2NVLA 1K3YA 4K5SA 5IOXA 2DJ2A 2DBCA 2LQOA 4FQUA 3I69A 2X8HA 5ECMB 1PSQA 2FWHA 3O3TA 4J57E 2IMKA 2H6ZA 4XS1A 1YY7A 4BVYA 3R3EA 2PVQA 2BJXA 1XWGA 3HD5A 2A2RA 1UVZA 2Z9SA 14GSA 3CRTA 2GTUA 1U6TA 1GTBA 3LSZA 4USSA 1X5DA 4MPGA 2V41A 2DIYA 2LRTA 3WGDA 2DKHA 3VLNA 2YCDA 3L9VA 3TB2A 4IP6A 2H0IA 2GZZA 2LS5A 1O8XA 2XC2A 1PL1A 1ZYPA 3IE3A 2MZCA 4OWYA 1EOGA 2HRFA 1T4YA 2H30A 3HY2A 4TR0A 3HCZA 3F6DA 3ZL5A 4K0GA 4L5OA 5B7CA 3LJRA 5KN1A 2X99A 5JWQB 4RQRA 5DDLA 19GSA 2CA8A 3D4MA 4FIWA 2TIRA 3N5OA 3ZRDA 4NAXA 17GSA 4Z7XA 3LXTA 3L9SA 3MSZA 5G30A 4PGTA 1FVJA 2WB9A 3WGEA 2WDUA 1USBA 2B1KA 3U6VA 3O6TA 3RDWA 1WPIA 1NW2A 4ZB8A 3E3EA 1GSEA 3A2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRS D;  1QXH A;  1MDK A;  2C1Y A;  1R5P A;  3HJM A;  2H01 A;  20GS A;  1Q4J A;  2D2Z A;  2VOC A;  1SK0 A;  3HZ8 A;  6GSX A;  4X1U A;  2HZE B;  5HFG A;  5ECS A;  2LNT A;  3O76 A;  4ECJ A;  2OAD A;  2MMZ A;  1I9D A;  1GSD A;  1F2E A;  1FAA A;  3GX8 A;  4POM A;  4V2N A;  4WEY A;  1QUW A;  1TJD A;  2C0G A;  2R5G A;  3EC3 A;  4TXV A;  2NDO A;  1IYH A;  1A23 A;  1W89 A;  4HZ2 A;  4XRA A;  2VLT A;  4GTU A;  1ILO A;  5FWG A;  1EV9 A;  3HYP A;  5ECQ B;  3D22 A;  5HR2 A;  4Q5R A;  2YPM A;  3NZN A;  1SKW B;  2N5F A;  3M9J A;  3RPP A;  4TR1 A;  4XIH A;  2L6C A;  4LMV A;  2B5X A;  3C7M A;  3L9U A;  2IMD A;  4V2M A;  5IMZ A;  5A4V A;  3APS A;  2DJ1 A;  5H5Q A;  5ID2 B;  2B5Y A;  2VLV A;  4BVX A;  1K0N A;  2QC7 A;  4KDU A;  4LL1 B;  2ES7 A;  3H79 A;  5G2Z A;  1OE7 A;  2GQM A;  1PN9 A;  5DBQ A;  5F07 A;  3EIN A;  4K9Z A;  1BG5 A;  4EE0 A;  1A2J A;  2MBT A;  1YKC A;  4POL A;  1DE1 A;  1SKS B;  2FY6 A;  4IHU A;  1GNW A;  1YJ6 A;  4MZC A;  2PUK C;  5DJL A;  2L59 A;  3ME7 A;  2F8A A;  2ON7 A;  1A24 A;  3KCM A;  2GST A;  3TRQ A;  3TOT A;  4PX1 A;  1XBS A;  4J56 E;  3APO A;  1Z7R A;  3DYR A;  2GT6 A;  4KW6 A;  4BPY A;  3HJP A;  4P3Y B;  3RPN A;  1PGT A;  3GKM A;  2KOK A;  4MLY A;  1TRS A;  2B7K A;  4N0Z A;  1X5E A;  1JZR A;  5D9T A;  1YZX A;  4QL9 A;  1MD3 A;  1AQW A;  3LEF A;  5IO2 A;  2GLR A;  2WS2 A;  3L78 A;  3AY8 A;  1PL2 A;  4KUN A;  5CRH A;  4ECB A;  5JCU A;  2ALB A;  3LG6 A;  5IIZ A;  2TRX A;  5ELG A;  1ZGN A;  3QAV A;  1TRW A;  1V40 A;  2O7K A;  4HUA A;  3H8Q A;  4GF0 A;  1XCC A;  3IOS A;  2PGT A;  4NPB A;  5AIS A;  2K9F A;  5IOW A;  2RUE A;  2CVB A;  5H5S A;  1SL1 B;  4FO5 A;  5J5N A;  4WET A;  3FRC A;  5ECR B;  6GSS A;  2EIQ A;  3EUR A;  3GX0 A;  2KHP A;  5DCG A;  3UBL A;  3M1G A;  2C8U A;  4IJI A;  4MF7 A;  2IJY A;  2CVK A;  1HD2 A;  3SBC A;  3IC4 A;  2WRT A;  4KCA A;  4YQU A;  4PQH A;  3VWV A;  2GSR A;  2L5L A;  6GSV A;  2MYG A;  4PUA A;  1PRX A;  2E7P A;  2FNO A;  4KND A;  2DJ3 A;  1GNE A;  3FZ4 A;  18GS A;  1PA3 A;  4GQF A;  1WRY A;  4EDZ A;  2H1B A;  4ZXG A;  4GWR A;  1MTC A;  4GSS A;  3DGQ A;  4NV2 A;  1I5G A;  5DQY A;  3I9V 2;  1TRU A;  2K8S A;  4IP1 A;  3P2A A;  4MH2 A;  5L71 A;  1GUK A;  1M7T A;  5HQP A;  3DIE A;  4I97 A;  2X8G A;  1GTU A;  3M9K A;  2I81 A;  3IBH A;  4TKY A;  3HDC A;  2ON5 A;  1WE0 A;  3FEU A;  4ILF A;  2MMO A;  8GSS A;  1KBN A;  2LRC A;  4X0X A;  1QQ2 A;  4O7H A;  4HZ4 A;  3DKS A;  2YV9 A;  1FB6 A;  1H75 A;  3FK8 A;  3EU3 A;  3ERW A;  3CBU A;  3LFL A;  2C4J A;  4AF2 A;  2R37 A;  1MEK A;  2A2S A;  4L8E A;  2IME A;  4EO3 A;  3GTU A;  4EXJ A;  2FA8 A;  1YQ1 A;  5IMC A;  4HU9 A;  4NHZ A;  4NV5 A;  5CAX A;  4ZIJ A;  2R6K A;  5JWR B;  4OFN A;  2CX4 A;  2E2M A;  4NWY A;  5HR0 A;  4TXO A;  2VL2 A;  1HNA A;  1KTE A;  3VWW A;  4OCE A;  4HOJ A;  2AUV A;  4E8H A;  2B3S A;  3TKP A;  4TRX A;  3QPM A;  3GTU B;  4OFM A;  2GGT A;  2A4V A;  2V32 A;  1R26 A;  2GZY A;  2O89 A;  2YWN A;  1NHO A;  2FWE A;  3FR6 A;  13GS A;  3GV1 A;  2HYX A;  2VL9 A;  4LL4 B;  5JCW A;  4DSS B;  2X8C A;  2F9S A;  4WF4 A;  2DSA A;  1TKD B;  5AGY A;  1YF1 A;  3APQ A;  1O8W A;  5GAN D;  3C1R A;  2JAD A;  1ZCP A;  2WCI A;  2B7J A;  1M0U A;  3MAK A;  1E6B A;  4EKZ A;  3QOU A;  3KXO A;  2IMI A;  4JZQ A;  5IMD A;  1OC9 A;  2JAC A;  4Q5Q A;  2KP2 A;  3VI7 A;  2VCW A;  3BJ5 A;  2VCX A;  3TKQ A;  3ED3 A;  5G5E A;  4OFT A;  4BL7 A;  3EMX A;  1WMJ A;  1ST9 A;  5FHI A;  1PMT A;  3CTG A;  2FLS A;  2HE3 A;  3VI5 A;  1U3A A;  3ZYW A;  2CVD A;  4DSR A;  2H0G A;  1GP1 A;  3KTL A;  2OJL A;  1OYJ A;  1GSU A;  2PMT A;  3FZ5 A;  1K0A A;  3IRA A;  1V98 A;  4MP4 A;  3U5R E;  4IS0 A;  1URM A;  3W6G A;  2L5O A;  4AGS A;  2V2G A;  4CHS A;  1SYX A;  2H74 A;  5J9B A;  1GUH A;  1K0B A;  1O6J A;  1JFU A;  1OKD A;  3NOF A;  2P0G A;  3ZFB A;  1YDK A;  3KIJ A;  2HRN A;  1R4W A;  5COH A;  1FB0 A;  1Z6N A;  3E9J B;  2M46 A;  3ERG A;  2BTO T;  2H66 A;  4ZBA A;  4LMW A;  3HHV A;  3UAR A;  3R2Q A;  2R3X A;  3F63 A;  4IBP A;  3VPT A;  1PD2 1;  4WBJ A;  3QFB C;  1M9A A;  3GL5 A;  1XWC A;  2XBQ A;  3GST A;  2H6Y A;  3GYK A;  2DMM A;  1Z3E A;  2WFC A;  3C73 A;  3UOM A;  1OC8 A;  2B6M A;  3IR4 A;  5CRW A;  4RI7 A;  1TOF A;  4IKH A;  3IAS 2;  4F0B A;  22GS A;  4GLT A;  3M0F A;  2DJ0 A;  3GSS A;  3IAM 2;  2C0D A;  1DBY A;  5H5R A;  1EEM A;  2LRN A;  4G2E A;  2B5E A;  4L0U A;  1VF3 A;  1N8J A;  1ABA A;  3UIW A;  1EGO A;  1K0C A;  3GUR A;  3ISO A;  4KSO A;  2VAF A;  4NHW A;  3RBT A;  1GSQ A;  4G19 A;  3ZIT A;  1QK8 A;  1SD9 A;  1XWA A;  4MJC A;  1M2D A;  2V6O A;  3IXR A;  1SL2 B;  5ECH B;  3C8E A;  2H0H A;  2H1A A;  3GN3 A;  5INY A;  2DJJ A;  3MNG A;  3EWL A;  3HXS A;  1FHE A;  2GQL A;  4TVE A;  2FHE A;  2KUC A;  3IPZ A;  3F8U A;  2L4Q A;  3IA1 A;  2RUF A;  3C71 A;  3L0H A;  2L57 A;  3ME8 A;  2HZE A;  1HNB A;  3DWV A;  5D8I A;  2ZNM A;  3KM6 A;  1XWK A;  1ERV A;  4QL7 A;  3P90 A;  1N2A A;  3LGC A;  2FWG A;  2L6D A;  5B8B A;  1GUL A;  2CZ3 A;  3DD3 A;  3GIX A;  2V1M A;  5EVO A;  2PWJ A;  4PQ1 A;  3IDV A;  1AIU A;  3S9F A;  3KJY A;  5J9C A;  4MCU A;  2HSH A;  2I3Y A;  3FZA A;  4IQ1 A;  3E0U A;  5JWO B;  3VPQ A;  3ZTL A;  1FVK A;  1A8L A;  5DVB A;  1BJX A;  2J9H A;  2C3Q A;  3ZVJ A;  4N0V A;  3GUS A;  1OKT A;  4HQS A;  1AQX A;  1XXU A;  2LST A;  3C1S A;  5ID2 A;  5J3R A;  1DUG A;  5CP1 A;  3OR5 A;  2FGX A;  2M80 A;  2H1G A;  1SJ6 A;  3PGT A;  1A2L A;  3FR9 A;  5DCH A;  3ERF A;  4KE3 A;  1GLQ A;  1M2A A;  1HNC A;  1O85 A;  4CDO A;  1RK4 A;  2IMF A;  1CQH A;  4KCE A;  2OBK A;  1R5A A;  1KEB A;  4K7N A;  4TR3 A;  3DVW A;  3F4R A;  3DRN A;  3BBY A;  3KP9 A;  3BCK A;  5A4W A;  4TN8 A;  3FY7 A;  1M9B A;  4L0W A;  2G0F A;  5AN1 A;  3CMI A;  1XOB A;  1GH2 A;  2YWM A;  5IMA A;  4JR6 A;  2P5R A;  3TKS A;  4MZW A;  1TI1 A;  3F0I A;  5EL8 A;  2K18 A;  1SD8 A;  1OE8 A;  5IQY A;  2OE0 A;  7GSS A;  1BQ7 A;  2CZ2 A;  2OE1 A;  3D5J A;  5AIX A;  3EVI A;  4TR4 A;  4PNG A;  1C72 A;  4GSN A;  5LCZ A;  1O7U A;  3D6I A;  2O87 A;  1GSS A;  1T4Z A;  1YKA A;  2YJ7 A;  3G7I A;  2PER A;  4MPF A;  4O32 A;  4WR4 A;  5G31 A;  6GST A;  5D9X A;  1XPV A;  1F6M C;  2HFD A;  4O5R A;  1A0R P;  4DEJ A;  4MAB A;  3BCI A;  1CQG A;  4I2T A;  1TRV A;  5J4U A;  3QAG A;  4JE1 A;  5DAK A;  3TJG A;  1B9Y C;  2VM2 A;  2XBI A;  4D73 B;  1EP8 A;  2NBS A;  2RM6 A;  5J41 A;  2LQQ A;  1WIK A;  2JL4 A;  3H93 A;  3EU4 A;  4RQX A;  1BAY A;  3TJB A;  1SU9 A;  1GTI A;  2H71 A;  2AYT A;  2OAC A;  5HFI A;  5DAK B;  4TOP A;  3SWL A;  2F8F A;  1XWB A;  4OO4 A;  5KEJ A;  2HSY A;  4RUV A;  4XTS A;  1AW9 A;  1AUC A;  1AXD A;  2YNX A;  5D9V A;  2JZT A;  3UEM A;  4N10 A;  1F9M A;  1SJZ A;  4FYU A;  1SL0 B;  3GFK A;  4ACS A;  2REM A;  3TJK A;  3CSH A;  5IPH A;  4HS1 A;  3HVV A;  4K7O A;  5AIV A;  2HLS A;  4DVC A;  2DML A;  2AJQ B;  2LUS A;  5ABR A;  3CSI A;  3H4K A;  3FZ9 A;  4PNF A;  2EC4 A;  2DJK A;  3EYT A;  1ACV A;  1TP9 A;  3GH6 A;  1VF1 A;  2PBJ A;  4MDC A;  4JBB A;  1TTZ A;  3KH9 A;  1GUM A;  4V1A g;  2N5B A;  5B6N A;  2OE3 A;  1BX9 A;  4HDE A;  3TKR A;  1E2Y A;  3D21 A;  5EY6 A;  2LJA A;  2EIO A;  4GCI A;  4IVF A;  1XVW A;  5CO3 A;  4OO5 A;  5A4U A;  4KAE A;  4IGJ A;  3TCO A;  4ISD A;  1S3A A;  1XW6 A;  4MF6 A;  1OC3 A;  2VD0 A;  3I43 A;  3ZIJ A;  1MDJ A;  1A0F A;  1AAZ A;  1EZK A;  1Q98 A;  4OCF A;  2QSI A;  1B48 A;  5CRD A;  1T7P B;  3TDG A;  1GLP A;  1G6W A;  1ON4 A;  3ZZX A;  1T3B A;  2AB6 A;  5ECO B;  1HQO A;  4DSS A;  2VIM A;  2IWT A;  3N9J A;  3GL3 A;  1SYR A;  4OMV A;  4X43 A;  2H73 A;  4YQM A;  3US3 A;  5JCG A;  3W8S A;  5ECL B;  1BYE A;  4PXO A;  2E0Q A;  5LNK e;  2M72 A;  5GST A;  1XZO A;  2FCH A;  2MBS A;  2GVP A;  2VCZ A;  4PQI A;  2AAW A;  4J2F A;  3RHB A;  2V6K A;  1X9W B;  4ZL7 A;  1ZMA A;  1ERU A;  2IFQ B;  3TRP A;  3WYW A;  3V1W A;  3VWX A;  1IYI A;  5B6M A;  1DSB A;  3HKR A;  3F4T A;  9GSS A;  3H1N A;  2J23 A;  5GZZ B;  1T1V A;  4AJ6 A;  1UC7 A;  4EL1 A;  5CRG A;  4EVM A;  3PIN A;  3LYK A;  2IN3 A;  2HI7 A;  2FA4 A;  3F6F A;  2FWF A;  5IMF A;  4ULX A;  2YOI A;  2YV7 A;  5G1L A;  2QKE A;  3TGZ A;  3HA9 A;  1XW9 A;  2LKU A;  2WJU A;  2VCQ A;  3Q74 A;  1JZO A;  3VFI A;  2R2J A;  4K1F A;  1TDI A;  2AV4 A;  2IPA A;  1B9X C;  3HVS A;  3Q6O A;  5HR3 A;  5IO0 A;  5IM9 A;  2VL3 A;  1GSY A;  1ZYQ B;  2YN1 A;  1Z9H A;  1UN2 A;  2LV3 A;  4GXZ A;  2GSQ A;  5F06 A;  1Z7P A;  4F9Z A;  1B4Q A;  12GS A;  2I1U A;  3QD9 A;  4FH8 A;  2DIZ A;  4I5Q A;  2ZUP A;  5DQS A;  1X0R A;  3CSJ A;  5G1K A;  2CT6 A;  2IL3 A;  3TJF A;  3GKK A;  4F0C A;  1V9W A;  3UBK A;  2F3M A;  5LD0 A;  3VUR A;  2OBI A;  2H8L A;  4MZB A;  5F0G A;  5DJM A;  1K3L A;  2PN8 A;  5B8A A;  1MD4 A;  2LJK A;  4E8E A;  3GMF A;  3KP8 A;  3RHC A;  4MA9 A;  3FW2 A;  5CNW A;  1T8E B;  1SEN A;  5C00 A;  2VCV A;  4POK A;  3WT1 A;  1F3A A;  1BED A;  5ECI B;  4HEA 2;  5G5F A;  3G9B A;  4H86 A;  5DAL A;  2VL2 C;  1NHY A;  3M8N A;  5GSS A;  1YF0 A;  2ZCT A;  4V1A p;  5HR1 A;  5FT3 A;  1Z6M A;  4KH7 A;  1V58 A;  3GA4 A;  3LOR A;  2YAN A;  4ZL8 A;  1X5C A;  3PR8 A;  1U87 A;  4N11 A;  3ZVJ D;  5F05 A;  4EDY A;  5IMV A;  5DAL B;  3F3R A;  2JSZ A;  4ML1 A;  2OKA A;  3PH9 A;  1PX7 A;  1F37 A;  2K8V A;  1OVN A;  2C3N A;  3ZFL A;  2K6V A;  1X9M B;  1DE2 A;  3L4N A;  5ENU A;  1J08 A;  1B4P A;  4POB A;  1TW9 A;  1SK1 A;  2CQ9 A;  1TK0 B;  2QGV A;  1PQN A;  4Q5N A;  5C04 A;  2YWO A;  1TU8 A;  1G7E A;  4TW5 A;  3KZQ A;  2FD3 A;  2VO4 A;  1FG4 A;  2O85 A;  4EF0 A;  1F3B A;  1PKZ A;  4CW9 A;  1GRX A;  1Z5Y E;  4KX4 A;  3UMA A;  4QQ7 A;  1EWX A;  4I6X A;  4EC0 A;  3G7Y A;  4WF5 A;  1VF4 A;  3LYP A;  4GRF A;  2E2G A;  1M2B A;  2RII A;  1V2A A;  2XHF A;  3DML A;  3BD2 A;  1RW1 A;  5D93 A;  1TXX A;  1MDI A;  4BWQ A;  3BOA A;  4IJ3 A;  4ECI A;  4MF5 A;  2LEG A;  3Q19 A;  1ERT A;  2AHE A;  3DVX A;  1XIY A;  4LA1 A;  4O92 A;  2YP6 A;  1THO A;  4FYB A;  4MK3 A;  1M99 A;  2GDR A;  1KNG A;  4HJ2 A;  3QAW A;  1FOV A;  3FKF A;  2JZS A;  2CV4 A;  2H76 A;  5F8B A;  4LLR A;  2JZR A;  2PPT A;  5ELA A;  3RAZ A;  3GKX A;  2YWI A;  1WOU A;  4JU5 A;  5ECP B;  5IPG A;  2GQK A;  4K6X A;  3D4T A;  1K0D A;  3FYG A;  3W8J A;  3M3M A;  2B1L A;  4XS4 A;  2H6X A;  1QMV A;  1XVQ A;  2BMX A;  2HXK A;  3F9U A;  5KN3 A;  4WKW A;  4I2U A;  5EPF A;  4NXI A;  4TR1 B;  4HI7 A;  5KN2 A;  1UA5 A;  3CYN A;  4BWS A;  1AQV A;  4K2D A;  5ECN B;  3ZML A;  1S3C A;  6GSU A;  1U88 A;  4AJ8 A;  4K0N A;  4XS4 B;  5E4W A;  1G7O A;  3GKN A;  2VCT A;  4I8B A;  11GS A;  5E59 A;  3KTB A;  2H19 A;  1ZYE A;  1J9B A;  2P31 A;  4MMM A;  2GS3 A;  1H4O A;  2KP1 A;  1EOH A;  3G7J A;  5D9W A;  2MMN A;  4YQV A;  1TK8 B;  2EIR A;  4XRD A;  3TOU A;  2C0E A;  4D73 A;  16GS A;  2TRC P;  4OD7 A;  4L5L A;  4GQC A;  1QFN A;  4AJ7 A;  1K0O A;  3QFA C;  4ZB6 A;  3CXG A;  1Y6E A;  4YH2 A;  1EV4 A;  3IK7 A;  4F2I A;  4IQA A;  4KDX A;  3GRX A;  4ML6 A;  4G9H A;  1G0T A;  4JED A;  1EEJ A;  1J0F A;  2C3T A;  2XPE A;  4ZBB A;  4PUF C;  1EP7 A;  3LQ7 A;  4HQZ A;  1A2M A;  2G2Q A;  3ZMK A;  1WWJ A;  1ZZY A;  2H1D A;  2GZP A;  5HFK A;  1YEX A;  3FHK A;  4YAV A;  3IV4 A;  5GAP D;  3Q18 A;  1FW1 A;  1TU7 A;  2L4C A;  1JZD A;  3IHQ A;  3A2W A;  3GNJ A;  2JSY A;  3ZIV A;  3F4S A;  2NTO A;  1HYU A;  2PU9 C;  4ZBD A;  3DXB A;  4XHM A;  1O81 A;  1XOA A;  1QGV A;  3DEX A;  3TRX A;  1W4V A;  3QR6 A;  4EUY A;  1U3I A;  4KGI A;  1AC1 A;  3NIV A;  2DC5 A;  4NMU A;  3GH9 A;  2GSS A;  1EGR A;  3KGK A;  3TKS E;  3F3Q A;  4MJE A;  1G6Y A;  1XW5 A;  2LNS A;  3MDK A;  3UAP A;  2HT9 A;  5D73 A;  1LBK A;  2KLX A;  4FYC A;  2DLX A;  3JCM L;  4GST A;  1K3O A;  3FR3 A;  2JU5 A;  10GS A;  2GT5 A;  4WBR D;  3KD0 A;  3MWH A;  3QDN A;  3CRU A;  3ZRE A;  1THX A;  3IK9 A;  5A5K A;  2N5A A;  3GHA A;  5CRE A;  1WJK A;  1PX6 A;  2OA7 A;  2H70 A;  4MH3 A;  2VD1 A;  2F51 A;  3D0Z A;  1V57 A;  1A8Y A;  2PVO C;  1JLW A;  1XFL A;  2RLI A;  2H75 A;  3I6A A;  1B8X A;  2P5Q A;  3TKS C;  1X9S B;  2VUP A;  1NM3 A;  4YAP A;  1O73 A;  3K8N A;  4KDY A;  4WXT A;  2WGR A;  3HZ4 A;  3HJO A;  1OAZ A;  3ZLP A;  3LWA A;  4K7I A;  4ZB9 A;  1SJI A;  4F03 A;  3P8W A;  2I4A A;  3VK9 A;  4KSM A;  1S3D A;  2NPB A;  2WUL A;  1TK5 B;  3UL3 A;  3WT2 A;  1FO5 A;  4XS6 A;  1ZL9 A;  2IIY A;  2YZH A;  4K8M A;  2VM1 A;  4MJA A;  1PKW A;  2FUG 2;  6GSW A;  2IFQ A;  1ZOF A;  1SKR B;  2RM5 A;  3UVT A;  2R4V A;  6GSY A;  4IN0 A;  1T00 A;  1JZW A;  4DSQ A;  2C80 A;  1GWC A;  2HNL A;  4N30 A;  3J7Y b;  4TXO B;  3P7X A;  4IEL A;  3EMP A;  2YJH A;  4HU7 A;  3A3T A;  1ML6 A;  1TI3 A;  4WR5 A;  4HJM A;  2X64 A;  4PUR A;  4ECC A;  2HZF A;  3QMX A;  3J7Y k;  3TJJ A;  3QCP A;  4JRR A;  5ECK B;  1JHB A;  3KH7 A;  3KMO A;  4JR4 A;  5CYY A;  3A2X A;  2LJR A;  3UVH A;  4BA7 A;  3A5W A;  4MJB A;  1Y25 A;  4XCS A;  4IW9 A;  3KMN A;  1RQM A;  4ZL9 A;  3UJ1 A;  1ERW A;  1GSF A;  3HVX A;  2MMA A;  3KEB A;  4V2L A;  2O8V B;  2YZU A;  4KA0 A;  1GL8 A;  5D96 A;  1LU4 A;  4G10 A;  4F82 A;  1VF2 A;  2WZ9 A;  1WP0 A;  2H72 A;  4KB3 A;  3VWU A;  3WGX A;  2XPD A;  1OC9 B;  2LTK A;  1R7H A;  2CAQ A;  1JLV A;  1YEP A;  2C0F A;  3LXZ A;  2I9H A;  2CX3 A;  1NSW A;  3WD6 A;  5KN0 A;  4ZIL A;  1GTA A;  4RI6 A;  3TUE A;  3EE2 A;  2CAI A;  1LJR A;  3CTF A;  4ID0 A;  1SK2 A;  1VGL A;  1K0M A;  2VLU A;  4Q5F A;  2NVL A;  1K3Y A;  5IOX A;  2DJ2 A;  2DBC A;  2LQO A;  3I69 A;  2X8H A;  5ECM B;  1PSQ A;  2FWH A;  3O3T A;  4J57 E;  2IMK A;  2H6Z A;  4XS1 A;  1YY7 A;  4BVY A;  2PVQ A;  2BJX A;  1XWG A;  3HD5 A;  2A2R A;  1UVZ A;  2Z9S A;  14GS A;  3CRT A;  2GTU A;  1U6T A;  1GTB A;  3LSZ A;  1X5D A;  4MPG A;  2V41 A;  2DIY A;  2LRT A;  3WGD A;  3VLN A;  2YCD A;  3L9V A;  3TB2 A;  4IP6 A;  2H0I A;  2GZZ A;  2LS5 A;  1O8X A;  2XC2 A;  1PL1 A;  3IE3 A;  2MZC A;  4OWY A;  1EOG A;  2HRF A;  1T4Y A;  2H30 A;  3HY2 A;  4TR0 A;  3HCZ A;  3F6D A;  3ZL5 A;  4K0G A;  4L5O A;  5B7C A;  3LJR A;  5KN1 A;  2X99 A;  5JWQ B;  4RQR A;  5DDL A;  19GS A;  2CA8 A;  3D4M A;  4FIW A;  2TIR A;  3N5O A;  3ZRD A;  4NAX A;  17GS A;  4Z7X A;  3LXT A;  3L9S A;  3MSZ A;  5G30 A;  4PGT A;  1FVJ A;  2WB9 A;  3WGE A;  2WDU A;  1USB A;  2B1K A;  3U6V A;  3O6T A;  3RDW A;  1WPI A;  1NW2 A;  4ZB8 A;  3E3E A;  1GSE A;  3A2V A; 
#chains in the Genus database with same CATH topology
 1VRS D;  1QXH A;  1MDK A;  2C1Y A;  1R5P A;  3HJM A;  2H01 A;  20GS A;  1Q4J A;  2D2Z A;  2VOC A;  1SK0 A;  3HZ8 A;  6GSX A;  4X1U A;  2HZE B;  5HFG A;  5ECS A;  2LNT A;  3O76 A;  4ECJ A;  2OAD A;  2MMZ A;  1I9D A;  4Z2T A;  1GSD A;  1F2E A;  1FAA A;  3GX8 A;  4POM A;  4V2N A;  4WEY A;  1QUW A;  1TJD A;  2C0G A;  2R5G A;  3EC3 A;  4TXV A;  2NDO A;  1IYH A;  1A23 A;  1W89 A;  4HZ2 A;  4XRA A;  2VLT A;  4GTU A;  1ILO A;  5FWG A;  1EV9 A;  3HYP A;  5ECQ B;  3D22 A;  5HR2 A;  4Q5R A;  2YPM A;  3NZN A;  1SKW B;  2N5F A;  3M9J A;  3RPP A;  4TR1 A;  4XIH A;  2L6C A;  4LMV A;  2B5X A;  3C7M A;  3L9U A;  2IMD A;  4V2M A;  5IMZ A;  5A4V A;  3APS A;  2DJ1 A;  5H5Q A;  5ID2 B;  2B5Y A;  2VLV A;  4BVX A;  1K0N A;  2QC7 A;  4KDU A;  4LL1 B;  2ES7 A;  3H79 A;  5G2Z A;  1OE7 A;  2GQM A;  1PN9 A;  5DBQ A;  5F07 A;  3EIN A;  4K9Z A;  1BG5 A;  4EE0 A;  1A2J A;  2MBT A;  1YKC A;  4POL A;  1DE1 A;  1SKS B;  2FY6 A;  4IHU A;  1GNW A;  1YJ6 A;  4MZC A;  2PUK C;  5DJL A;  2L59 A;  3ME7 A;  2F8A A;  2ON7 A;  1A24 A;  3KCM A;  2GST A;  3TRQ A;  3TOT A;  4PX1 A;  1XBS A;  4J56 E;  3APO A;  1Z7R A;  3DYR A;  2GT6 A;  4KW6 A;  4BPY A;  3HJP A;  4P3Y B;  3RPN A;  1PGT A;  3GKM A;  2KOK A;  4MLY A;  1TRS A;  2B7K A;  4N0Z A;  4CY6 A;  1X5E A;  1JZR A;  5D9T A;  1YZX A;  4QL9 A;  1MD3 A;  1AQW A;  3LEF A;  5IO2 A;  2GLR A;  2WS2 A;  3L78 A;  3AY8 A;  1PL2 A;  3MYD A;  4KUN A;  5CRH A;  4ECB A;  5JCU A;  2ALB A;  3LG6 A;  5IIZ A;  2TRX A;  5ELG A;  1ZGN A;  3QAV A;  1TRW A;  1V40 A;  2O7K A;  4HUA A;  3H8Q A;  4GF0 A;  1XCC A;  3IOS A;  2PGT A;  4NPB A;  5AIS A;  2K9F A;  5IOW A;  2RUE A;  2CVB A;  5H5S A;  1SL1 B;  4FO5 A;  5J5N A;  4WET A;  3FRC A;  5ECR B;  6GSS A;  2EIQ A;  3EUR A;  3GX0 A;  2KHP A;  5DCG A;  4Z2R A;  3UBL A;  3M1G A;  2C8U A;  4IJI A;  4MF7 A;  2IJY A;  4HSC X;  2CVK A;  1HD2 A;  3SBC A;  3MIX A;  3IC4 A;  2WRT A;  4KCA A;  4YQU A;  4PQH A;  3VWV A;  2GSR A;  2L5L A;  6GSV A;  2MYG A;  4PUA A;  1PRX A;  2E7P A;  2FNO A;  4KND A;  2DJ3 A;  1GNE A;  3FZ4 A;  18GS A;  1PA3 A;  4GQF A;  1WRY A;  4EDZ A;  2H1B A;  4ZXG A;  4GWR A;  1MTC A;  4GSS A;  3DGQ A;  4NV2 A;  1I5G A;  5DQY A;  3I9V 2;  1TRU A;  2K8S A;  4IP1 A;  3P2A A;  4MH2 A;  5L71 A;  1GUK A;  1M7T A;  5HQP A;  3DIE A;  4I97 A;  2X8G A;  1GTU A;  3M9K A;  2I81 A;  3IBH A;  4TKY A;  3HDC A;  2ON5 A;  1FOH A;  1WE0 A;  3FEU A;  4ILF A;  2MMO A;  8GSS A;  1KBN A;  2LRC A;  4X0X A;  1QQ2 A;  4O7H A;  4HZ4 A;  3DKS A;  2YV9 A;  1FB6 A;  1H75 A;  3FK8 A;  3EU3 A;  3ERW A;  3CBU A;  3LFL A;  2C4J A;  4AF2 A;  2R37 A;  1MEK A;  2A2S A;  4L8E A;  2IME A;  4EO3 A;  3GTU A;  4EXJ A;  2FA8 A;  1YQ1 A;  5IMC A;  4HU9 A;  4NHZ A;  4NV5 A;  5CAX A;  4ZIJ A;  2R6K A;  5JWR B;  4OFN A;  2CX4 A;  2E2M A;  4NWY A;  5HR0 A;  4TXO A;  2VL2 A;  1HNA A;  1KTE A;  3VWW A;  4OCE A;  4HOJ A;  2AUV A;  4E8H A;  2B3S A;  3TKP A;  4TRX A;  3QPM A;  3GTU B;  4OFM A;  2GGT A;  2A4V A;  2V32 A;  1R26 A;  2GZY A;  2O89 A;  2YWN A;  1NHO A;  2FWE A;  3FR6 A;  13GS A;  3GV1 A;  2HYX A;  2VL9 A;  4LL4 B;  4YKF A;  5JCW A;  4DSS B;  2X8C A;  2F9S A;  4WF4 A;  2DSA A;  1TKD B;  5AGY A;  1YF1 A;  3APQ A;  1O8W A;  5GAN D;  3C1R A;  2JAD A;  1ZCP A;  2WCI A;  2B7J A;  1M0U A;  3MAK A;  1E6B A;  4EKZ A;  3QOU A;  3KXO A;  2IMI A;  4JZQ A;  5IMD A;  1OC9 A;  2JAC A;  3LW9 A;  4Q5Q A;  2KP2 A;  3VI7 A;  2VCW A;  5BMU A;  3BJ5 A;  2VCX A;  3TKQ A;  3ED3 A;  5G5E A;  4OFT A;  4BL7 A;  3EMX A;  1WMJ A;  1ST9 A;  5FHI A;  1PMT A;  3CTG A;  2FLS A;  5KOW A;  2HE3 A;  3VI5 A;  1U3A A;  3ZYW A;  2CVD A;  4DSR A;  2H0G A;  1GP1 A;  3KTL A;  2OJL A;  1OYJ A;  1GSU A;  2PMT A;  3FZ5 A;  1K0A A;  3IRA A;  1V98 A;  3PPU A;  4MP4 A;  3U5R E;  4IS0 A;  1URM A;  3W6G A;  2L5O A;  4AGS A;  2V2G A;  4CHS A;  1SYX A;  2H74 A;  5J9B A;  1GUH A;  1K0B A;  1O6J A;  1JFU A;  1OKD A;  3NOF A;  2P0G A;  3ZFB A;  1YDK A;  3KIJ A;  2HRN A;  1R4W A;  5COH A;  1FB0 A;  1Z6N A;  3E9J B;  2M46 A;  3ERG A;  2BTO T;  2H66 A;  4ZBA A;  4LMW A;  3HHV A;  3UAR A;  3R2Q A;  2R3X A;  3F63 A;  4IBP A;  3VPT A;  1PD2 1;  3CQF A;  4WBJ A;  3QFB C;  1M9A A;  3GL5 A;  1XWC A;  2XBQ A;  3GST A;  2H6Y A;  3GYK A;  2DMM A;  1Z3E A;  2WFC A;  3C73 A;  4MNN A;  3UOM A;  1OC8 A;  2B6M A;  3IR4 A;  5CRW A;  4RI7 A;  1TOF A;  4IKH A;  3IAS 2;  4F0B A;  4EIQ A;  22GS A;  4GLT A;  3M0F A;  2DJ0 A;  3GSS A;  3IAM 2;  2C0D A;  4ICY A;  1DBY A;  5H5R A;  1EEM A;  2LRN A;  4G2E A;  2B5E A;  4L0U A;  1VF3 A;  1N8J A;  3IHG A;  1ABA A;  3UIW A;  1EGO A;  1K0C A;  3GUR A;  3ISO A;  4KSO A;  2VAF A;  4NHW A;  3RBT A;  1GSQ A;  4G19 A;  3ZIT A;  1QK8 A;  1SD9 A;  1XWA A;  4MJC A;  1M2D A;  2V6O A;  3IXR A;  1SL2 B;  5ECH B;  3C8E A;  2H0H A;  2H1A A;  3GN3 A;  5INY A;  2DJJ A;  3MNG A;  3EWL A;  3HXS A;  1FHE A;  2GQL A;  4TVE A;  2FHE A;  2KUC A;  3IPZ A;  3F8U A;  2L4Q A;  3IA1 A;  2RUF A;  3C71 A;  3L0H A;  2L57 A;  3ME8 A;  2HZE A;  1HNB A;  3DWV A;  5D8I A;  2ZNM A;  3KM6 A;  1XWK A;  1ERV A;  4QL7 A;  3P90 A;  1N2A A;  3LGC A;  2FWG A;  2L6D A;  5B8B A;  1GUL A;  2CZ3 A;  3DD3 A;  3GIX A;  2V1M A;  5EVO A;  2PWJ A;  4PQ1 A;  3IDV A;  1AIU A;  3S9F A;  4K2X A;  3KJY A;  5J9C A;  4MCU A;  2HSH A;  2I3Y A;  3FZA A;  4IQ1 A;  3E0U A;  5JWO B;  3VPQ A;  3ZTL A;  1FVK A;  1A8L A;  5DVB A;  1BJX A;  2J9H A;  2C3Q A;  3ZVJ A;  4N0V A;  3GUS A;  1OKT A;  4HQS A;  1AQX A;  1XXU A;  3A5I A;  2HRA A;  2LST A;  3C1S A;  5ID2 A;  5J3R A;  1DUG A;  5CP1 A;  1S3R A;  3OR5 A;  2FGX A;  2M80 A;  2H1G A;  1SJ6 A;  3PGT A;  1A2L A;  3FR9 A;  5DCH A;  3ERF A;  4KE3 A;  1GLQ A;  1M2A A;  1HNC A;  1O85 A;  4CDO A;  1RK4 A;  2IMF A;  1CQH A;  4KCE A;  2OBK A;  1R5A A;  1KEB A;  4K7N A;  4TR3 A;  3DVW A;  3F4R A;  3DRN A;  3BBY A;  3KP9 A;  3BCK A;  5A4W A;  4TN8 A;  3FY7 A;  1M9B A;  4L0W A;  2G0F A;  5AN1 A;  3CMI A;  1XOB A;  1GH2 A;  2YWM A;  5IMA A;  4JR6 A;  2P5R A;  3TKS A;  4MZW A;  1TI1 A;  3F0I A;  5EL8 A;  2K18 A;  4G0L A;  1SD8 A;  1OE8 A;  5IQY A;  2OE0 A;  7GSS A;  1BQ7 A;  2CZ2 A;  2OE1 A;  3D5J A;  5AIX A;  4TR4 A;  3EVI A;  4PNG A;  1C72 A;  4GSN A;  5LCZ A;  1O7U A;  3D6I A;  2R0P A;  2O87 A;  1GSS A;  1T4Z A;  1YKA A;  2YJ7 A;  3G7I A;  2PER A;  4MPF A;  4O32 A;  4WR4 A;  5G31 A;  6GST A;  5D9X A;  1XPV A;  1F6M C;  2HFD A;  4O5R A;  1A0R P;  4DEJ A;  4X4J A;  4MAB A;  2X4A A;  3BCI A;  1CQG A;  4I2T A;  1TRV A;  5J4U A;  3QAG A;  4JE1 A;  5DAK A;  3TJG A;  1B9Y C;  2VM2 A;  2XBI A;  4D73 B;  1EP8 A;  2NBS A;  2RM6 A;  5J41 A;  4G0K A;  2LQQ A;  1WIK A;  2JL4 A;  3H93 A;  3EU4 A;  4RQX A;  1BAY A;  3TJB A;  1SU9 A;  1GTI A;  2H71 A;  2AYT A;  2OAC A;  5HFI A;  5DAK B;  4TOP A;  3SWL A;  2F8F A;  1XWB A;  4OO4 A;  5KEJ A;  2HSY A;  4RUV A;  4XTS A;  1AW9 A;  1AUC A;  4G0I A;  1AXD A;  2YNX A;  5D9V A;  2JZT A;  3UEM A;  4N10 A;  1F9M A;  1SJZ A;  4FYU A;  1SL0 B;  3GFK A;  4ACS A;  2REM A;  3TJK A;  3CSH A;  5IPH A;  4HS1 A;  3HVV A;  4K7O A;  5AIV A;  2HLS A;  4DVC A;  2DML A;  2AJQ B;  2LUS A;  5ABR A;  3CSI A;  3H4K A;  3FZ9 A;  4PNF A;  2EC4 A;  2DJK A;  3EYT A;  1ACV A;  1TP9 A;  3GH6 A;  1VF1 A;  2PBJ A;  4MDC A;  4JBB A;  1TTZ A;  3KH9 A;  1GUM A;  4V1A g;  2N5B A;  5B6N A;  2OE3 A;  1BX9 A;  4HDE A;  3TKR A;  1E2Y A;  5KOX A;  3D21 A;  5EY6 A;  2LJA A;  2EIO A;  4GCI A;  4IVF A;  1XVW A;  5CO3 A;  4OO5 A;  5A4U A;  4KAE A;  4IGJ A;  3TCO A;  4ISD A;  1S3A A;  1XW6 A;  4MF6 A;  1OC3 A;  2VD0 A;  3I43 A;  3ZIJ A;  1MDJ A;  2R0C A;  1A0F A;  1AAZ A;  1EZK A;  1Q98 A;  4OCF A;  2QSI A;  1B48 A;  5CRD A;  1T7P B;  3TDG A;  1GLP A;  1G6W A;  4K5R A;  1ON4 A;  3ZZX A;  1T3B A;  2AB6 A;  5ECO B;  1HQO A;  4DSS A;  2VIM A;  2IWT A;  3N9J A;  3GL3 A;  1SYR A;  3IC8 A;  4OMV A;  4X43 A;  3HVN A;  2H73 A;  4YQM A;  3US3 A;  5JCG A;  3W8S A;  5ECL B;  1BYE A;  4PXO A;  2E0Q A;  5LNK e;  2M72 A;  5GST A;  1XZO A;  2FCH A;  2MBS A;  2GVP A;  2VCZ A;  4PQI A;  2AAW A;  4J2F A;  3RHB A;  2V6K A;  1X9W B;  4ZL7 A;  1ZMA A;  1PN0 A;  4BIK A;  1ERU A;  2IFQ B;  3TRP A;  3WYW A;  3V1W A;  3VWX A;  1IYI A;  5B6M A;  1DSB A;  3HKR A;  3F4T A;  9GSS A;  3H1N A;  2J23 A;  5GZZ B;  1T1V A;  4AJ6 A;  1PFO A;  1UC7 A;  4EL1 A;  5CRG A;  4EVM A;  1ZYN A;  3PIN A;  2A2P A;  3LYK A;  2IN3 A;  2HI7 A;  2HSM A;  2FA4 A;  3F6F A;  2FWF A;  5IMF A;  4ULX A;  2YOI A;  2YV7 A;  5G1L A;  2QKE A;  3TGZ A;  3HA9 A;  1XW9 A;  2LKU A;  2WJU A;  2VCQ A;  3Q74 A;  1JZO A;  3VFI A;  2R2J A;  4K1F A;  4Z2U A;  1TDI A;  2AV4 A;  2IPA A;  1B9X C;  3HVS A;  3Q6O A;  5HR3 A;  4KF9 A;  5IO0 A;  5IM9 A;  2VL3 A;  1GSY A;  1ZYQ B;  2YN1 A;  1Z9H A;  1UN2 A;  2LV3 A;  4GXZ A;  2GSQ A;  5F06 A;  1Z7P A;  4F9Z A;  1B4Q A;  12GS A;  2I1U A;  3QD9 A;  4FH8 A;  2DIZ A;  4I5Q A;  2ZUP A;  5DQS A;  1X0R A;  2QA2 A;  3CSJ A;  5G1K A;  2CT6 A;  2HRK A;  2IL3 A;  3TJF A;  3GKK A;  4F0C A;  2UZ8 A;  1V9W A;  3UBK A;  2F3M A;  5LD0 A;  3VUR A;  2OBI A;  2H8L A;  4MZB A;  5F0G A;  5DJM A;  1K3L A;  2PN8 A;  5B8A A;  1MD4 A;  2LJK A;  4E8E A;  3GMF A;  3KP8 A;  3RHC A;  4MA9 A;  3FW2 A;  5CNW A;  1T8E B;  1SEN A;  5C00 A;  2VCV A;  4POK A;  3WT1 A;  1F3A A;  1BED A;  5ECI B;  4HEA 2;  5G5F A;  3G9B A;  4H86 A;  5DAL A;  4BVY B;  2VL2 C;  1NHY A;  3M8N A;  5GSS A;  1YF0 A;  2ZCT A;  4V1A p;  5HR1 A;  5FT3 A;  1Z6M A;  4KH7 A;  1V58 A;  3GA4 A;  3LOR A;  2YAN A;  4ZL8 A;  1X5C A;  3PR8 A;  1U87 A;  4N11 A;  3ZVJ D;  5F05 A;  4EDY A;  5IMV A;  5DAL B;  3F3R A;  2JSZ A;  4ML1 A;  2OKA A;  3PH9 A;  1PX7 A;  1F37 A;  2K8V A;  1OVN A;  2C3N A;  3ZFL A;  2K6V A;  1X9M B;  1DE2 A;  3L4N A;  5ENU A;  1J08 A;  1B4P A;  4POB A;  1TW9 A;  1SK1 A;  2CQ9 A;  1TK0 B;  2QGV A;  1PQN A;  4Q5N A;  5C04 A;  2YWO A;  1TU8 A;  1G7E A;  4TW5 A;  3KZQ A;  2FD3 A;  2VO4 A;  1FG4 A;  2O85 A;  4EF0 A;  1F3B A;  1PKZ A;  4CW9 A;  1GRX A;  1Z5Y E;  4KX4 A;  3UMA A;  4QQ7 A;  1EWX A;  4I6X A;  4EC0 A;  3G7Y A;  4WF5 A;  1VF4 A;  3LYP A;  1XG8 A;  4GRF A;  2E2G A;  1M2B A;  2RII A;  1V2A A;  2XHF A;  3DML A;  3BD2 A;  1RW1 A;  5D93 A;  1TXX A;  1MDI A;  4BWQ A;  3BOA A;  4EIP A;  4IJ3 A;  4ECI A;  4MF5 A;  2LEG A;  3Q19 A;  1ERT A;  2AHE A;  3DVX A;  1XIY A;  4LA1 A;  4O92 A;  2YP6 A;  1THO A;  4FYB A;  4MK3 A;  1M99 A;  2GDR A;  1KNG A;  4HJ2 A;  3QAW A;  1FOV A;  3FKF A;  2JZS A;  2CV4 A;  2H76 A;  5F8B A;  4LLR A;  2JZR A;  2PPT A;  5ELA A;  3RAZ A;  3GKX A;  2YWI A;  1WOU A;  4JU5 A;  5ECP B;  5IPG A;  2GQK A;  4K6X A;  3D4T A;  1K0D A;  3FYG A;  3W8J A;  3M3M A;  2B1L A;  4XS4 A;  2H6X A;  1QMV A;  1XVQ A;  2BMX A;  2HXK A;  3F9U A;  4YKG A;  4PTS A;  5KN3 A;  4WKW A;  4I2U A;  5EPF A;  4NXI A;  4TR1 B;  4HI7 A;  5KN2 A;  1UA5 A;  3CYN A;  4BWS A;  1AQV A;  4K2D A;  5ECN B;  3ZML A;  1S3C A;  6GSU A;  1U88 A;  4AJ8 A;  4K0N A;  4XS4 B;  5E4W A;  1G7O A;  4BVX B;  3GKN A;  2VCT A;  4I8B A;  2A4H A;  11GS A;  5E59 A;  3KTB A;  2H19 A;  1ZYE A;  1J9B A;  2P31 A;  4MMM A;  2GS3 A;  1H4O A;  2KP1 A;  1EOH A;  3G7J A;  5D9W A;  2MMN A;  4YQV A;  1TK8 B;  2EIR A;  4XRD A;  3TOU A;  2C0E A;  4D73 A;  16GS A;  2TRC P;  4OD7 A;  4L5L A;  2R0G A;  4GQC A;  1QFN A;  4AJ7 A;  1K0O A;  3QFA C;  4ZB6 A;  3CXG A;  1Y6E A;  4O5Q A;  4YH2 A;  1EV4 A;  3IK7 A;  4F2I A;  4IQA A;  4CY8 A;  4KDX A;  3GRX A;  4ML6 A;  4G9H A;  1G0T A;  4JED A;  1EEJ A;  1J0F A;  2C3T A;  2XPE A;  4ZBB A;  4PUF C;  1EP7 A;  3LQ7 A;  4HQZ A;  1A2M A;  2G2Q A;  3ZMK A;  1WWJ A;  1ZZY A;  2H1D A;  2GZP A;  5HFK A;  1YEX A;  4O5U A;  3FHK A;  4YAV A;  3IV4 A;  5GAP D;  3Q18 A;  1FW1 A;  1TU7 A;  2L4C A;  1JZD A;  3IHQ A;  3A2W A;  3GNJ A;  2JSY A;  2QA1 A;  3ZIV A;  3F4S A;  2NTO A;  1HYU A;  2PU9 C;  4ZBD A;  3DXB A;  4XHM A;  1O81 A;  1XOA A;  1M3I A;  1QGV A;  3DEX A;  3TRX A;  1W4V A;  3QR6 A;  4EUY A;  1U3I A;  4KGI A;  1AC1 A;  3NIV A;  2DC5 A;  4NMU A;  3GH9 A;  2GSS A;  3EPT A;  1EGR A;  3KGK A;  3TKS E;  3F3Q A;  4MJE A;  1G6Y A;  1XW5 A;  2LNS A;  3MDK A;  3UAP A;  2HT9 A;  5D73 A;  1LBK A;  2KLX A;  4FYC A;  2DLX A;  2X49 A;  3JCM L;  4GST A;  1K3O A;  3FR3 A;  2JU5 A;  10GS A;  2GT5 A;  4WBR D;  3KD0 A;  3MWH A;  3QDN A;  3CRU A;  3ZRE A;  1THX A;  3IK9 A;  5A5K A;  2N5A A;  3GHA A;  5CRE A;  1WJK A;  1PX6 A;  2OA7 A;  2H70 A;  4MH3 A;  2VD1 A;  2F51 A;  3D0Z A;  5BRT A;  1V57 A;  2DKI A;  1A8Y A;  2PVO C;  1JLW A;  1XFL A;  2RLI A;  2H75 A;  3I6A A;  1B8X A;  2P5Q A;  3TKS C;  1X9S B;  2VUP A;  1NM3 A;  4YAP A;  1O73 A;  3K8N A;  4KDY A;  4WXT A;  2WGR A;  3HZ4 A;  3HJO A;  1OAZ A;  3ZLP A;  3LWA A;  4K7I A;  4ZB9 A;  1SJI A;  4F03 A;  3P8W A;  2I4A A;  3VK9 A;  4KSM A;  1S3D A;  2NPB A;  2WUL A;  1TK5 B;  3UL3 A;  3WT2 A;  1FO5 A;  4XS6 A;  1ZL9 A;  2IIY A;  2YZH A;  4K8M A;  2VM1 A;  4MJA A;  1PKW A;  2FUG 2;  6GSW A;  2IFQ A;  1ZOF A;  1SKR B;  2RM5 A;  3UVT A;  2R4V A;  6GSY A;  4IN0 A;  1T00 A;  1JZW A;  4DSQ A;  2C80 A;  1GWC A;  2HNL A;  4N30 A;  3J7Y b;  4TXO B;  3P7X A;  4IEL A;  3EMP A;  2YJH A;  4HU7 A;  3A3T A;  1ML6 A;  1TI3 A;  4WR5 A;  4HJM A;  2X64 A;  4PUR A;  4ECC A;  2HZF A;  3QMX A;  3J7Y k;  3TJJ A;  3QCP A;  4JRR A;  5ECK B;  1JHB A;  3KH7 A;  3KMO A;  4JR4 A;  5CYY A;  3A2X A;  2LJR A;  3UVH A;  4BA7 A;  3A5W A;  4MJB A;  1Y25 A;  4XCS A;  4IW9 A;  3KMN A;  1RQM A;  4ZL9 A;  3UJ1 A;  1ERW A;  1GSF A;  4A5P A;  3HVX A;  2MMA A;  3KEB A;  4V2L A;  2O8V B;  2YZU A;  4KA0 A;  1GL8 A;  5D96 A;  1LU4 A;  4G10 A;  4F82 A;  1VF2 A;  2WZ9 A;  3FMW A;  1WP0 A;  2H72 A;  4KB3 A;  3VWU A;  3WGX A;  2XPD A;  1OC9 B;  2LTK A;  1R7H A;  2CAQ A;  1JLV A;  1YEP A;  2C0F A;  3LXZ A;  2I9H A;  2CX3 A;  1NSW A;  3WD6 A;  5KN0 A;  4ZIL A;  1GTA A;  4RI6 A;  4BL7 B;  3TUE A;  3EE2 A;  2CAI A;  1LJR A;  3CTF A;  4ID0 A;  1SK2 A;  1VGL A;  1K0M A;  2VLU A;  4Q5F A;  2NVL A;  1K3Y A;  4K5S A;  5IOX A;  2DJ2 A;  2DBC A;  2LQO A;  4FQU A;  3I69 A;  2X8H A;  5ECM B;  1PSQ A;  2FWH A;  3O3T A;  4J57 E;  2IMK A;  2H6Z A;  4XS1 A;  1YY7 A;  4BVY A;  3R3E A;  2PVQ A;  2BJX A;  1XWG A;  3HD5 A;  2A2R A;  1UVZ A;  2Z9S A;  14GS A;  3CRT A;  2GTU A;  1U6T A;  1GTB A;  3LSZ A;  4USS A;  1X5D A;  4MPG A;  2V41 A;  2DIY A;  2LRT A;  3WGD A;  2DKH A;  3VLN A;  2YCD A;  3L9V A;  3TB2 A;  4IP6 A;  2H0I A;  2GZZ A;  2LS5 A;  1O8X A;  2XC2 A;  1PL1 A;  1ZYP A;  3IE3 A;  2MZC A;  4OWY A;  1EOG A;  2HRF A;  1T4Y A;  2H30 A;  3HY2 A;  4TR0 A;  3HCZ A;  3F6D A;  3ZL5 A;  4K0G A;  4L5O A;  5B7C A;  3LJR A;  5KN1 A;  2X99 A;  5JWQ B;  4RQR A;  5DDL A;  19GS A;  2CA8 A;  3D4M A;  4FIW A;  2TIR A;  3N5O A;  3ZRD A;  4NAX A;  17GS A;  4Z7X A;  3LXT A;  3L9S A;  3MSZ A;  5G30 A;  4PGT A;  1M3J A;  1FVJ A;  2WB9 A;  3WGE A;  2WDU A;  1USB A;  2B1K A;  3U6V A;  3O6T A;  3RDW A;  1WPI A;  1NW2 A;  4ZB8 A;  3E3E A;  1GSE A;  3A2V A; 
#chains in the Genus database with same CATH homology
 1VRS D;  1QXH A;  1MDK A;  2C1Y A;  1R5P A;  3HJM A;  2H01 A;  20GS A;  1Q4J A;  2D2Z A;  2VOC A;  1SK0 A;  3HZ8 A;  6GSX A;  4X1U A;  2HZE B;  5HFG A;  5ECS A;  2LNT A;  3O76 A;  4ECJ A;  2OAD A;  2MMZ A;  1I9D A;  4Z2T A;  1GSD A;  1F2E A;  1FAA A;  3GX8 A;  4POM A;  4V2N A;  4WEY A;  1QUW A;  1TJD A;  2C0G A;  2R5G A;  3EC3 A;  4TXV A;  2NDO A;  1IYH A;  1A23 A;  1W89 A;  4HZ2 A;  4XRA A;  2VLT A;  4GTU A;  1ILO A;  5FWG A;  1EV9 A;  3HYP A;  5ECQ B;  3D22 A;  5HR2 A;  4Q5R A;  2YPM A;  3NZN A;  1SKW B;  2N5F A;  3M9J A;  3RPP A;  4TR1 A;  4XIH A;  2L6C A;  4LMV A;  2B5X A;  3C7M A;  3L9U A;  2IMD A;  4V2M A;  5IMZ A;  5A4V A;  3APS A;  2DJ1 A;  5H5Q A;  5ID2 B;  2B5Y A;  2VLV A;  4BVX A;  1K0N A;  2QC7 A;  4KDU A;  4LL1 B;  2ES7 A;  3H79 A;  5G2Z A;  1OE7 A;  2GQM A;  1PN9 A;  5DBQ A;  5F07 A;  3EIN A;  4K9Z A;  1BG5 A;  4EE0 A;  1A2J A;  2MBT A;  1YKC A;  4POL A;  1DE1 A;  1SKS B;  2FY6 A;  4IHU A;  1GNW A;  1YJ6 A;  4MZC A;  2PUK C;  5DJL A;  2L59 A;  3ME7 A;  2F8A A;  2ON7 A;  1A24 A;  3KCM A;  2GST A;  3TRQ A;  3TOT A;  4PX1 A;  1XBS A;  4J56 E;  3APO A;  1Z7R A;  3DYR A;  2GT6 A;  4KW6 A;  4BPY A;  3HJP A;  4P3Y B;  3RPN A;  1PGT A;  3GKM A;  2KOK A;  4MLY A;  1TRS A;  2B7K A;  4N0Z A;  4CY6 A;  1X5E A;  1JZR A;  5D9T A;  1YZX A;  4QL9 A;  1MD3 A;  1AQW A;  3LEF A;  5IO2 A;  2GLR A;  2WS2 A;  3L78 A;  3AY8 A;  1PL2 A;  3MYD A;  4KUN A;  5CRH A;  4ECB A;  5JCU A;  2ALB A;  3LG6 A;  5IIZ A;  2TRX A;  5ELG A;  1ZGN A;  3QAV A;  1TRW A;  1V40 A;  2O7K A;  4HUA A;  3H8Q A;  4GF0 A;  1XCC A;  3IOS A;  2PGT A;  4NPB A;  5AIS A;  2K9F A;  5IOW A;  2RUE A;  2CVB A;  5H5S A;  1SL1 B;  4FO5 A;  5J5N A;  4WET A;  3FRC A;  5ECR B;  6GSS A;  2EIQ A;  3EUR A;  3GX0 A;  2KHP A;  5DCG A;  4Z2R A;  3UBL A;  3M1G A;  2C8U A;  4IJI A;  4MF7 A;  2IJY A;  2CVK A;  1HD2 A;  3SBC A;  3MIX A;  3IC4 A;  2WRT A;  4KCA A;  4YQU A;  4PQH A;  3VWV A;  2GSR A;  2L5L A;  6GSV A;  2MYG A;  4PUA A;  1PRX A;  2E7P A;  2FNO A;  4KND A;  2DJ3 A;  1GNE A;  3FZ4 A;  18GS A;  1PA3 A;  4GQF A;  1WRY A;  4EDZ A;  2H1B A;  4ZXG A;  4GWR A;  1MTC A;  4GSS A;  3DGQ A;  4NV2 A;  1I5G A;  5DQY A;  3I9V 2;  1TRU A;  2K8S A;  4IP1 A;  3P2A A;  4MH2 A;  5L71 A;  1GUK A;  1M7T A;  5HQP A;  3DIE A;  4I97 A;  2X8G A;  1GTU A;  3M9K A;  2I81 A;  3IBH A;  4TKY A;  3HDC A;  2ON5 A;  1FOH A;  1WE0 A;  3FEU A;  4ILF A;  2MMO A;  8GSS A;  1KBN A;  2LRC A;  4X0X A;  1QQ2 A;  4O7H A;  4HZ4 A;  3DKS A;  2YV9 A;  1FB6 A;  1H75 A;  3FK8 A;  3EU3 A;  3ERW A;  3CBU A;  3LFL A;  2C4J A;  4AF2 A;  2R37 A;  1MEK A;  2A2S A;  4L8E A;  2IME A;  4EO3 A;  3GTU A;  4EXJ A;  2FA8 A;  1YQ1 A;  5IMC A;  4HU9 A;  4NHZ A;  4NV5 A;  5CAX A;  4ZIJ A;  2R6K A;  5JWR B;  4OFN A;  2CX4 A;  2E2M A;  4NWY A;  5HR0 A;  4TXO A;  2VL2 A;  1HNA A;  1KTE A;  3VWW A;  4OCE A;  4HOJ A;  2AUV A;  4E8H A;  2B3S A;  3TKP A;  4TRX A;  3QPM A;  3GTU B;  4OFM A;  2GGT A;  2A4V A;  2V32 A;  1R26 A;  2GZY A;  2O89 A;  2YWN A;  1NHO A;  2FWE A;  3FR6 A;  13GS A;  3GV1 A;  2HYX A;  2VL9 A;  4LL4 B;  4YKF A;  5JCW A;  4DSS B;  2X8C A;  2F9S A;  4WF4 A;  2DSA A;  1TKD B;  5AGY A;  1YF1 A;  3APQ A;  1O8W A;  5GAN D;  3C1R A;  2JAD A;  1ZCP A;  2WCI A;  2B7J A;  1M0U A;  3MAK A;  1E6B A;  4EKZ A;  3QOU A;  3KXO A;  2IMI A;  4JZQ A;  5IMD A;  1OC9 A;  2JAC A;  3LW9 A;  4Q5Q A;  2KP2 A;  3VI7 A;  2VCW A;  5BMU A;  3BJ5 A;  2VCX A;  3TKQ A;  3ED3 A;  5G5E A;  4OFT A;  4BL7 A;  3EMX A;  1WMJ A;  1ST9 A;  5FHI A;  1PMT A;  3CTG A;  2FLS A;  5KOW A;  2HE3 A;  3VI5 A;  1U3A A;  3ZYW A;  2CVD A;  4DSR A;  2H0G A;  1GP1 A;  3KTL A;  2OJL A;  1OYJ A;  1GSU A;  2PMT A;  3FZ5 A;  1K0A A;  3IRA A;  1V98 A;  3PPU A;  4MP4 A;  3U5R E;  4IS0 A;  1URM A;  3W6G A;  2L5O A;  4AGS A;  2V2G A;  4CHS A;  1SYX A;  2H74 A;  5J9B A;  1GUH A;  1K0B A;  1O6J A;  1JFU A;  1OKD A;  3NOF A;  2P0G A;  3ZFB A;  1YDK A;  3KIJ A;  2HRN A;  1R4W A;  5COH A;  1FB0 A;  1Z6N A;  3E9J B;  2M46 A;  3ERG A;  2BTO T;  2H66 A;  4ZBA A;  4LMW A;  3HHV A;  3UAR A;  3R2Q A;  2R3X A;  3F63 A;  4IBP A;  3VPT A;  1PD2 1;  4WBJ A;  3QFB C;  1M9A A;  3GL5 A;  1XWC A;  2XBQ A;  3GST A;  2H6Y A;  3GYK A;  2DMM A;  1Z3E A;  2WFC A;  3C73 A;  4MNN A;  3UOM A;  1OC8 A;  2B6M A;  3IR4 A;  5CRW A;  4RI7 A;  1TOF A;  4IKH A;  3IAS 2;  4F0B A;  4EIQ A;  22GS A;  4GLT A;  3M0F A;  2DJ0 A;  3GSS A;  3IAM 2;  2C0D A;  4ICY A;  1DBY A;  5H5R A;  1EEM A;  2LRN A;  4G2E A;  2B5E A;  4L0U A;  1VF3 A;  1N8J A;  3IHG A;  1ABA A;  3UIW A;  1EGO A;  1K0C A;  3GUR A;  3ISO A;  4KSO A;  2VAF A;  4NHW A;  3RBT A;  1GSQ A;  4G19 A;  3ZIT A;  1QK8 A;  1SD9 A;  1XWA A;  4MJC A;  1M2D A;  2V6O A;  3IXR A;  1SL2 B;  5ECH B;  3C8E A;  2H0H A;  2H1A A;  3GN3 A;  5INY A;  2DJJ A;  3MNG A;  3EWL A;  3HXS A;  1FHE A;  2GQL A;  4TVE A;  2FHE A;  2KUC A;  3IPZ A;  3F8U A;  2L4Q A;  3IA1 A;  2RUF A;  3C71 A;  3L0H A;  2L57 A;  3ME8 A;  2HZE A;  1HNB A;  3DWV A;  5D8I A;  2ZNM A;  3KM6 A;  1XWK A;  1ERV A;  4QL7 A;  3P90 A;  1N2A A;  3LGC A;  2FWG A;  2L6D A;  5B8B A;  1GUL A;  2CZ3 A;  3DD3 A;  3GIX A;  2V1M A;  5EVO A;  2PWJ A;  4PQ1 A;  3IDV A;  1AIU A;  3S9F A;  4K2X A;  3KJY A;  5J9C A;  4MCU A;  2HSH A;  2I3Y A;  3FZA A;  4IQ1 A;  3E0U A;  5JWO B;  3VPQ A;  3ZTL A;  1FVK A;  1A8L A;  5DVB A;  1BJX A;  2J9H A;  2C3Q A;  3ZVJ A;  4N0V A;  3GUS A;  1OKT A;  4HQS A;  1AQX A;  1XXU A;  3A5I A;  2HRA A;  2LST A;  3C1S A;  5ID2 A;  5J3R A;  1DUG A;  5CP1 A;  3OR5 A;  2FGX A;  2M80 A;  2H1G A;  1SJ6 A;  3PGT A;  1A2L A;  3FR9 A;  5DCH A;  3ERF A;  4KE3 A;  1GLQ A;  1M2A A;  1HNC A;  1O85 A;  4CDO A;  1RK4 A;  2IMF A;  1CQH A;  4KCE A;  2OBK A;  1R5A A;  1KEB A;  4K7N A;  4TR3 A;  3DVW A;  3F4R A;  3DRN A;  3BBY A;  3KP9 A;  3BCK A;  5A4W A;  4TN8 A;  3FY7 A;  1M9B A;  4L0W A;  2G0F A;  5AN1 A;  3CMI A;  1XOB A;  1GH2 A;  2YWM A;  5IMA A;  4JR6 A;  2P5R A;  3TKS A;  4MZW A;  1TI1 A;  3F0I A;  5EL8 A;  2K18 A;  4G0L A;  1SD8 A;  1OE8 A;  5IQY A;  2OE0 A;  7GSS A;  1BQ7 A;  2CZ2 A;  2OE1 A;  3D5J A;  5AIX A;  4TR4 A;  3EVI A;  4PNG A;  1C72 A;  4GSN A;  5LCZ A;  1O7U A;  3D6I A;  2R0P A;  2O87 A;  1GSS A;  1T4Z A;  1YKA A;  2YJ7 A;  3G7I A;  2PER A;  4MPF A;  4O32 A;  4WR4 A;  5G31 A;  6GST A;  5D9X A;  1XPV A;  1F6M C;  2HFD A;  4O5R A;  1A0R P;  4DEJ A;  4X4J A;  4MAB A;  2X4A A;  3BCI A;  1CQG A;  4I2T A;  1TRV A;  5J4U A;  3QAG A;  4JE1 A;  5DAK A;  3TJG A;  1B9Y C;  2VM2 A;  2XBI A;  4D73 B;  1EP8 A;  2NBS A;  2RM6 A;  5J41 A;  4G0K A;  2LQQ A;  1WIK A;  2JL4 A;  3H93 A;  3EU4 A;  4RQX A;  1BAY A;  3TJB A;  1SU9 A;  1GTI A;  2H71 A;  2AYT A;  2OAC A;  5HFI A;  5DAK B;  4TOP A;  3SWL A;  2F8F A;  1XWB A;  4OO4 A;  5KEJ A;  2HSY A;  4RUV A;  4XTS A;  1AW9 A;  1AUC A;  4G0I A;  1AXD A;  2YNX A;  5D9V A;  2JZT A;  3UEM A;  4N10 A;  1F9M A;  1SJZ A;  4FYU A;  1SL0 B;  3GFK A;  4ACS A;  2REM A;  3TJK A;  3CSH A;  5IPH A;  4HS1 A;  3HVV A;  4K7O A;  5AIV A;  2HLS A;  4DVC A;  2DML A;  2AJQ B;  2LUS A;  5ABR A;  3CSI A;  3H4K A;  3FZ9 A;  4PNF A;  2EC4 A;  2DJK A;  3EYT A;  1ACV A;  1TP9 A;  3GH6 A;  1VF1 A;  2PBJ A;  4MDC A;  4JBB A;  1TTZ A;  3KH9 A;  1GUM A;  4V1A g;  2N5B A;  5B6N A;  2OE3 A;  1BX9 A;  4HDE A;  3TKR A;  1E2Y A;  5KOX A;  3D21 A;  5EY6 A;  2LJA A;  2EIO A;  4GCI A;  4IVF A;  1XVW A;  5CO3 A;  4OO5 A;  5A4U A;  4KAE A;  4IGJ A;  3TCO A;  4ISD A;  1S3A A;  1XW6 A;  4MF6 A;  1OC3 A;  2VD0 A;  3I43 A;  3ZIJ A;  1MDJ A;  2R0C A;  1A0F A;  1AAZ A;  1EZK A;  1Q98 A;  4OCF A;  2QSI A;  1B48 A;  5CRD A;  1T7P B;  3TDG A;  1GLP A;  1G6W A;  4K5R A;  1ON4 A;  3ZZX A;  1T3B A;  2AB6 A;  5ECO B;  1HQO A;  4DSS A;  2VIM A;  2IWT A;  3N9J A;  3GL3 A;  1SYR A;  3IC8 A;  4OMV A;  4X43 A;  2H73 A;  4YQM A;  3US3 A;  5JCG A;  3W8S A;  5ECL B;  1BYE A;  4PXO A;  2E0Q A;  5LNK e;  2M72 A;  5GST A;  1XZO A;  2FCH A;  2MBS A;  2GVP A;  2VCZ A;  4PQI A;  2AAW A;  4J2F A;  3RHB A;  2V6K A;  1X9W B;  4ZL7 A;  1ZMA A;  1PN0 A;  1ERU A;  2IFQ B;  3TRP A;  3WYW A;  3V1W A;  3VWX A;  1IYI A;  5B6M A;  1DSB A;  3HKR A;  3F4T A;  9GSS A;  3H1N A;  2J23 A;  5GZZ B;  1T1V A;  4AJ6 A;  1UC7 A;  4EL1 A;  5CRG A;  4EVM A;  1ZYN A;  3PIN A;  2A2P A;  3LYK A;  2IN3 A;  2HI7 A;  2HSM A;  2FA4 A;  3F6F A;  2FWF A;  5IMF A;  4ULX A;  2YOI A;  2YV7 A;  5G1L A;  2QKE A;  3TGZ A;  3HA9 A;  1XW9 A;  2LKU A;  2WJU A;  2VCQ A;  3Q74 A;  1JZO A;  3VFI A;  2R2J A;  4K1F A;  4Z2U A;  1TDI A;  2AV4 A;  2IPA A;  1B9X C;  3HVS A;  3Q6O A;  5HR3 A;  4KF9 A;  5IO0 A;  5IM9 A;  2VL3 A;  1GSY A;  1ZYQ B;  2YN1 A;  1Z9H A;  1UN2 A;  2LV3 A;  4GXZ A;  2GSQ A;  5F06 A;  1Z7P A;  4F9Z A;  1B4Q A;  12GS A;  2I1U A;  3QD9 A;  4FH8 A;  2DIZ A;  4I5Q A;  2ZUP A;  5DQS A;  1X0R A;  2QA2 A;  3CSJ A;  5G1K A;  2CT6 A;  2HRK A;  2IL3 A;  3TJF A;  3GKK A;  4F0C A;  2UZ8 A;  1V9W A;  3UBK A;  2F3M A;  5LD0 A;  3VUR A;  2OBI A;  2H8L A;  4MZB A;  5F0G A;  5DJM A;  1K3L A;  2PN8 A;  5B8A A;  1MD4 A;  2LJK A;  4E8E A;  3GMF A;  3KP8 A;  3RHC A;  4MA9 A;  3FW2 A;  5CNW A;  1T8E B;  1SEN A;  5C00 A;  2VCV A;  4POK A;  3WT1 A;  1F3A A;  1BED A;  5ECI B;  4HEA 2;  5G5F A;  3G9B A;  4H86 A;  5DAL A;  4BVY B;  2VL2 C;  1NHY A;  3M8N A;  5GSS A;  1YF0 A;  2ZCT A;  4V1A p;  5HR1 A;  5FT3 A;  1Z6M A;  4KH7 A;  1V58 A;  3GA4 A;  3LOR A;  2YAN A;  4ZL8 A;  1X5C A;  3PR8 A;  1U87 A;  4N11 A;  3ZVJ D;  5F05 A;  4EDY A;  5IMV A;  5DAL B;  3F3R A;  2JSZ A;  4ML1 A;  2OKA A;  3PH9 A;  1PX7 A;  1F37 A;  2K8V A;  1OVN A;  2C3N A;  3ZFL A;  2K6V A;  1X9M B;  1DE2 A;  3L4N A;  5ENU A;  1J08 A;  1B4P A;  4POB A;  1TW9 A;  1SK1 A;  2CQ9 A;  1TK0 B;  2QGV A;  1PQN A;  4Q5N A;  5C04 A;  2YWO A;  1TU8 A;  1G7E A;  4TW5 A;  3KZQ A;  2FD3 A;  2VO4 A;  1FG4 A;  2O85 A;  4EF0 A;  1F3B A;  1PKZ A;  4CW9 A;  1GRX A;  1Z5Y E;  4KX4 A;  3UMA A;  4QQ7 A;  1EWX A;  4I6X A;  4EC0 A;  3G7Y A;  4WF5 A;  1VF4 A;  3LYP A;  4GRF A;  2E2G A;  1M2B A;  2RII A;  1V2A A;  2XHF A;  3DML A;  3BD2 A;  1RW1 A;  5D93 A;  1TXX A;  1MDI A;  4BWQ A;  3BOA A;  4EIP A;  4IJ3 A;  4ECI A;  4MF5 A;  2LEG A;  3Q19 A;  1ERT A;  2AHE A;  3DVX A;  1XIY A;  4LA1 A;  4O92 A;  2YP6 A;  1THO A;  4FYB A;  4MK3 A;  1M99 A;  2GDR A;  1KNG A;  4HJ2 A;  3QAW A;  1FOV A;  3FKF A;  2JZS A;  2CV4 A;  2H76 A;  5F8B A;  4LLR A;  2JZR A;  2PPT A;  5ELA A;  3RAZ A;  3GKX A;  2YWI A;  1WOU A;  4JU5 A;  5ECP B;  5IPG A;  2GQK A;  4K6X A;  3D4T A;  1K0D A;  3FYG A;  3W8J A;  3M3M A;  2B1L A;  4XS4 A;  2H6X A;  1QMV A;  1XVQ A;  2BMX A;  2HXK A;  3F9U A;  4YKG A;  4PTS A;  5KN3 A;  4WKW A;  4I2U A;  5EPF A;  4NXI A;  4TR1 B;  4HI7 A;  5KN2 A;  1UA5 A;  3CYN A;  4BWS A;  1AQV A;  4K2D A;  5ECN B;  3ZML A;  1S3C A;  6GSU A;  1U88 A;  4AJ8 A;  4K0N A;  4XS4 B;  5E4W A;  1G7O A;  4BVX B;  3GKN A;  2VCT A;  4I8B A;  2A4H A;  11GS A;  5E59 A;  3KTB A;  2H19 A;  1ZYE A;  1J9B A;  2P31 A;  4MMM A;  2GS3 A;  1H4O A;  2KP1 A;  1EOH A;  3G7J A;  5D9W A;  2MMN A;  4YQV A;  1TK8 B;  2EIR A;  4XRD A;  3TOU A;  2C0E A;  4D73 A;  16GS A;  2TRC P;  4OD7 A;  4L5L A;  2R0G A;  4GQC A;  1QFN A;  4AJ7 A;  1K0O A;  3QFA C;  4ZB6 A;  3CXG A;  1Y6E A;  4O5Q A;  4YH2 A;  1EV4 A;  3IK7 A;  4F2I A;  4IQA A;  4CY8 A;  4KDX A;  3GRX A;  4ML6 A;  4G9H A;  1G0T A;  4JED A;  1EEJ A;  1J0F A;  2C3T A;  2XPE A;  4ZBB A;  4PUF C;  1EP7 A;  3LQ7 A;  4HQZ A;  1A2M A;  2G2Q A;  3ZMK A;  1WWJ A;  1ZZY A;  2H1D A;  2GZP A;  5HFK A;  1YEX A;  4O5U A;  3FHK A;  4YAV A;  3IV4 A;  5GAP D;  3Q18 A;  1FW1 A;  1TU7 A;  2L4C A;  1JZD A;  3IHQ A;  3A2W A;  3GNJ A;  2JSY A;  2QA1 A;  3ZIV A;  3F4S A;  2NTO A;  1HYU A;  2PU9 C;  4ZBD A;  3DXB A;  4XHM A;  1O81 A;  1XOA A;  1QGV A;  3DEX A;  3TRX A;  1W4V A;  3QR6 A;  4EUY A;  1U3I A;  4KGI A;  1AC1 A;  3NIV A;  2DC5 A;  4NMU A;  3GH9 A;  2GSS A;  3EPT A;  1EGR A;  3KGK A;  3TKS E;  3F3Q A;  4MJE A;  1G6Y A;  1XW5 A;  2LNS A;  3MDK A;  3UAP A;  2HT9 A;  5D73 A;  1LBK A;  2KLX A;  4FYC A;  2DLX A;  2X49 A;  3JCM L;  4GST A;  1K3O A;  3FR3 A;  2JU5 A;  10GS A;  2GT5 A;  4WBR D;  3KD0 A;  3MWH A;  3QDN A;  3CRU A;  3ZRE A;  1THX A;  3IK9 A;  5A5K A;  2N5A A;  3GHA A;  5CRE A;  1WJK A;  1PX6 A;  2OA7 A;  2H70 A;  4MH3 A;  2VD1 A;  2F51 A;  3D0Z A;  5BRT A;  1V57 A;  2DKI A;  1A8Y A;  2PVO C;  1JLW A;  1XFL A;  2RLI A;  2H75 A;  3I6A A;  1B8X A;  2P5Q A;  3TKS C;  1X9S B;  2VUP A;  1NM3 A;  4YAP A;  1O73 A;  3K8N A;  4KDY A;  4WXT A;  2WGR A;  3HZ4 A;  3HJO A;  1OAZ A;  3ZLP A;  3LWA A;  4K7I A;  4ZB9 A;  1SJI A;  4F03 A;  3P8W A;  2I4A A;  3VK9 A;  4KSM A;  1S3D A;  2NPB A;  2WUL A;  1TK5 B;  3UL3 A;  3WT2 A;  1FO5 A;  4XS6 A;  1ZL9 A;  2IIY A;  2YZH A;  4K8M A;  2VM1 A;  4MJA A;  1PKW A;  2FUG 2;  6GSW A;  2IFQ A;  1ZOF A;  1SKR B;  2RM5 A;  3UVT A;  2R4V A;  6GSY A;  4IN0 A;  1T00 A;  1JZW A;  4DSQ A;  2C80 A;  1GWC A;  2HNL A;  4N30 A;  3J7Y b;  4TXO B;  3P7X A;  4IEL A;  3EMP A;  2YJH A;  4HU7 A;  3A3T A;  1ML6 A;  1TI3 A;  4WR5 A;  4HJM A;  2X64 A;  4PUR A;  4ECC A;  2HZF A;  3QMX A;  3J7Y k;  3TJJ A;  3QCP A;  4JRR A;  5ECK B;  1JHB A;  3KH7 A;  3KMO A;  4JR4 A;  5CYY A;  3A2X A;  2LJR A;  3UVH A;  4BA7 A;  3A5W A;  4MJB A;  1Y25 A;  4XCS A;  4IW9 A;  3KMN A;  1RQM A;  4ZL9 A;  3UJ1 A;  1ERW A;  1GSF A;  4A5P A;  3HVX A;  2MMA A;  3KEB A;  4V2L A;  2O8V B;  2YZU A;  4KA0 A;  1GL8 A;  5D96 A;  1LU4 A;  4G10 A;  4F82 A;  1VF2 A;  2WZ9 A;  3FMW A;  1WP0 A;  2H72 A;  4KB3 A;  3VWU A;  3WGX A;  2XPD A;  1OC9 B;  2LTK A;  1R7H A;  2CAQ A;  1JLV A;  1YEP A;  2C0F A;  3LXZ A;  2I9H A;  2CX3 A;  1NSW A;  3WD6 A;  5KN0 A;  4ZIL A;  1GTA A;  4RI6 A;  4BL7 B;  3TUE A;  3EE2 A;  2CAI A;  1LJR A;  3CTF A;  4ID0 A;  1SK2 A;  1VGL A;  1K0M A;  2VLU A;  4Q5F A;  2NVL A;  1K3Y A;  4K5S A;  5IOX A;  2DJ2 A;  2DBC A;  2LQO A;  4FQU A;  3I69 A;  2X8H A;  5ECM B;  1PSQ A;  2FWH A;  3O3T A;  4J57 E;  2IMK A;  2H6Z A;  4XS1 A;  1YY7 A;  4BVY A;  3R3E A;  2PVQ A;  2BJX A;  1XWG A;  3HD5 A;  2A2R A;  1UVZ A;  2Z9S A;  14GS A;  3CRT A;  2GTU A;  1U6T A;  1GTB A;  3LSZ A;  4USS A;  1X5D A;  4MPG A;  2V41 A;  2DIY A;  2LRT A;  3WGD A;  2DKH A;  3VLN A;  2YCD A;  3L9V A;  3TB2 A;  4IP6 A;  2H0I A;  2GZZ A;  2LS5 A;  1O8X A;  2XC2 A;  1PL1 A;  1ZYP A;  3IE3 A;  2MZC A;  4OWY A;  1EOG A;  2HRF A;  1T4Y A;  2H30 A;  3HY2 A;  4TR0 A;  3HCZ A;  3F6D A;  3ZL5 A;  4K0G A;  4L5O A;  5B7C A;  3LJR A;  5KN1 A;  2X99 A;  5JWQ B;  4RQR A;  5DDL A;  19GS A;  2CA8 A;  3D4M A;  4FIW A;  2TIR A;  3N5O A;  3ZRD A;  4NAX A;  17GS A;  4Z7X A;  3LXT A;  3L9S A;  3MSZ A;  5G30 A;  4PGT A;  1FVJ A;  2WB9 A;  3WGE A;  2WDU A;  1USB A;  2B1K A;  3U6V A;  3O6T A;  3RDW A;  1WPI A;  1NW2 A;  4ZB8 A;  3E3E A;  1GSE A;  3A2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...