2KP1A

Solution structure of the a' domain of thermophilic fungal protein disulfide isomerase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
GPLGSEGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVDATANDVPDEIQGFPTIKLYPAGAKGQPVTYSGSRTVEDLIKFIAENGKYKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein disulfide-isomerase
publication title Redox-Dependent Domain Rearrangement of Protein Disulfide Isomerase Coupled with Exposure of Its Substrate-Binding Hydrophobic Surface
pubmed doi rcsb
source organism Humicola insolens
molecule tags Isomerase
total genus 29
structure length 121
sequence length 121
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2kp1A00
3U5RE 2NVLA 4PX1A 4ULXA 4WR5A 4K0GA 3N5OA 5CREA 5G5EA 2YWOA 4POLA 3KGKA 10GSA 3VPQA 6GSSA 4DSSA 1MEKA 4O92A 1WP0A 1QUWA 4ZL7A 1XZOA 3RBTA 4YAVA 3KH9A 5GZZB 3D0ZA 2VM2A 2L6DA 1TRVA 3WGEA 1X9WB 4BA7A 2FNOA 4K9ZA 2HE3A 1HD2A 4N0VA 3FZAA 2LQQA 2I81A 1TTZA 5ECSA 3LJRA 1JZRA 1C72A 3ME7A 2K8SA 4EDZA 2YV7A 2V1MA 1MTCA 2FY6A 4FO5A 3KEBA 2C0DA 4K0NA 3M8NA 3FZ4A 5ECOB 4ZBDA 2PPTA 5LNKe 4E8EA 1NM3A 4KA0A 3L4NA 1BJXA 4F0CA 2YV9A 2GTUA 4GSSA 1E2YA 1YQ1A 3KCMA 2AV4A 4HU7A 2OJLA 3GX0A 1QMVA 1E6BA 3F8UA 5IIZA 3KTLA 2H71A 5CNWA 2I3YA 2OE0A 1KBNA 4G9HA 3VK9A 5KN1A 1G0TA 4TR1A 3UIWA 4IHUA 4ID0A 4HZ2A 3JCML 1AQVA 2C1YA 1B4PA 4ZL9A 3TOUA 4F82A 3F9UA 4NV5A 1HQOA 2K18A 5IO0A 4JR6A 1V9WA 5ID2A 1S3AA 2L57A 2LV3A 3LXTA 2WDUA 5F06A 5H5SA 2V6KA 2MMOA 1WIKA 2LJAA 1WPIA 4WXTA 2YANA 2G2QA 2B7JA 1XVQA 4MF5A 5G1KA 3DVXA 4ILFA 4WEYA 4AGSA 2H1AA 2GSQA 5ECMB 1PX7A 1B48A 4KE3A 4PQ1A 1JZWA 2HXKA 4KNDA 2MYGA 1GSQA 4MCUA 4P3YB 4N11A 3HZ8A 2HZEA 5JWQB 5AGYA 13GSA 3ZIVA 3FW2A 1T4YA 5DALA 1TK5B 1EV9A 2AJQB 2PERA 4KW6A 2P5QA 3M3MA 2K8VA 1SKWB 4WBJA 5G30A 4MJAA 3ZZXA 4ECIA 1K0NA 2IMEA 2YPMA 1QGVA 3TKPA 4WF4A 7GSSA 4O32A 1FOVA 5ECRB 2WFCA 3A3TA 3IBHA 2C0FA 1B9YC 1YZXA 1K0MA 4ZILA 5KN3A 4HU9A 5G5FA 4OCFA 2AHEA 1THXA 16GSA 4X0XA 1EOGA 2R6KA 5GAND 3ZMKA 3GTUB 3ZVJD 2VLUA 3EE2A 3L9UA 2CVDA 1SJ6A 5HFIA 4EF0A 2GSTA 5CAXA 2P5RA 1QXHA 2RUFA 5DDLA 3QFBC 2YWIA 5DAKB 1ZGNA 2K9FA 4FYUA 1GNWA 5F8BA 2FD3A 2OE1A 2VM1A 3QR6A 4GSNA 2X8CA 5IO2A 2H19A 3I43A 2DSAA 4N10A 3A5WA 3RPPA 3D22A 5J41A 3VURA 4TW5A 3BOAA 1T3BA 2VO4A 4D73A 2IFQB 2VCTA 4KH7A 2ES7A 1GSYA 5EY6A 5D9WA 1GH2A 3L9SA 4V2MA 3MAKA 4DVCA 3FR3A 5FT3A 4NPBA 1TRWA 2R3XA 1VGLA 2OE3A 3IK9A 3HA9A 5EL8A 4KSOA 1ZL9A 3ERWA 2PVQA 4IVFA 4K6XA 2C3QA 2MZCA 1GTIA 1O8XA 1G7OA 2TIRA 2FUG2 3RHCA 3LQ7A 4Q5NA 1PSQA 3VFIA 1MDIA 1NHYA 3DIEA 4KDYA 4EVMA 1BG5A 1Y25A 3IK7A 3KZQA 2BJXA 1XCCA 3DYRA 1PA3A 2YP6A 2C8UA 1N8JA 1G6WA 1N2AA 5L71A 3TJKA 5ECIB 3DRNA 4EO3A 1SYXA 5CO3A 1EEJA 1T8EB 4HUAA 1GL8A 5GAPD 2VIMA 3H4KA 3TKSA 2VLTA 1A0RP 2BTOT 4LLRA 3TCOA 5ENUA 5F05A 4F03A 2DIZA 1WMJA 2LJRA 6GSYA 2VL2C 3A2WA 3ZYWA 3IHQA 4TR0A 3HJMA 3TKRA 4TXOA 2L5LA 3KIJA 3I69A 2B5EA 4WETA 2WRTA 4FIWA 3ZREA 3FZ9A 4I97A 2NPBA 1XBSA 4FH8A 1A0FA 3GH6A 4PQHA 4ZB9A 2LQOA 3BBYA 4IW9A 1A2LA 3C71A 3U6VA 2X8GA 1TK8B 2YN1A 4V1Ap 2R37A 5IOWA 4ECCA 4F9ZA 3ERFA 2YZUA 3EU4A 3IDVA 4KAEA 3F6FA 2KP2A 2RM6A 2JU5A 3TDGA 1K0CA 3GSTA 1NSWA 4LL4B 3SBCA 2GT6A 1B8XA 5KN0A 2CVBA 1RQMA 3QAWA 5HR2A 5ECHB 1FVJA 4JZQA 1T00A 6GSTA 2FA4A 1ZYEA 2EIOA 2H30A 4GRFA 2LKUA 4YQMA 1XVWA 4YQUA 4NHWA 3CRTA 3OR5A 3TJBA 3PR8A 1F9MA 3F3RA 1UN2A 3GX8A 4L8EA 1A2MA 4POMA 1F3AA 2F51A 1XOAA 2CX3A 1OVNA 4GF0A 2ZCTA 3GURA 3GA4A 1U6TA 1V57A 4OD7A 1VF1A 4PNFA 4YAPA 3KD0A 1ERVA 4KX4A 2VCZA 4XS4B 3FZ5A 4I5QA 4OCEA 1SKSB 2XPEA 4L5OA 3TUEA 1XWBA 14GSA 3EYTA 2C0GA 4WBRD 2F3MA 4Q5QA 3FYGA 4IELA 2WZ9A 3W6GA 4GTUA 2GQMA 1U87A 2VL9A 3TKSE 3KJYA 1WOUA 2BMXA 1ERUA 1EEMA 2FCHA 3GHAA 4ZIJA 1RW1A 1R5AA 4MZCA 2RIIA 4GXZA 3DEXA 2C0EA 3GH9A 2GS3A 2ON5A 1O73A 4MA9A 1DE1A 2TRCP 2DLXA 4J56E 3GRXA 1FG4A 2VAFA 2PVOC 2WGRA 3LYPA 4NWYA 3J7Yb 1WRYA 2C3TA 1ERWA 4V1Ag 3WYWA 4DSRA 2I1UA 2E7PA 2L6CA 2OA7A 2GZYA 2VCVA 3FK8A 1DBYA 1TDIA 5IMZA 3ZMLA 3W8SA 3WGXA 3N9JA 4AJ8A 2H0HA 2GGTA 1PGTA 1TU7A 2OKAA 1A2JA 3UJ1A 3O76A 1T7PB 17GSA 3O6TA 3HHVA 2YOIA 3HCZA 2B1KA 3HVXA 1M2BA 1X0RA 1XIYA 4E8HA 2PMTA 3EMPA 3TRXA 1EP7A 1SENA 4K8MA 5ELGA 1A8LA 4KCEA 1SJIA 4L0UA 1OC3A 2GT5A 5E59A 2H66A 4MPGA 2JADA 1TXXA 2HT9A 4Z7XA 2V41A 3SWLA 1LU4A 2DJ2A 2WCIA 3UL3A 4ML6A 4XIHA 2D2ZA 4PNGA 1H4OA 4TN8A 2DC5A 3VWUA 5JCWA 4MPFA 1M0UA 2M72A 3L0HA 1W89A 3GL5A 3KTBA 2OACA 2YWMA 3E9JB 1HNAA 1G6YA 5HFGA 3HDCA 4N0ZA 2C4JA 1X9MB 1K0AA 4OFMA 4RI6A 12GSA 1F2EA 5G31A 4IQAA 1GNEA 5D8IA 3MNGA 1TJDA 3LGCA 4QL7A 4CW9A 2GLRA 2H73A 3TJGA 1DSBA 1MDKA 3ZTLA 2F8FA 2MBSA 4HJMA 1XW6A 5CRDA 2XBQA 3F0IA 4BL7A 2CVKA 2GQKA 1U3IA 5F07A 4HJ2A 2HRNA 2HZEB 3F6DA 3G7IA 2PN8A 4ECBA 3A2VA 5CRGA 4KGIA 4MJBA 6GSXA 3IOSA 5AN1A 4RI7A 2JSYA 2LNTA 4MLYA 2PGTA 3GV1A 4BVYA 4MJEA 4EC0A 1X9SB 1AAZA 1TRUA 4V2NA 2AYTA 5HR1A 2VD0A 3AY8A 3VPTA 3DWVA 3VLNA 3IAM2 3UEMA 4GWRA 1RK4A 4L0WA 5J5NA 2E2MA 1PKWA 2E2GA 5FWGA 3KXOA 4K2DA 1OKDA 3CSIA 2B3SA 22GSA 3GKNA 3QPMA 1WWJA 2QC7A 1MD3A 1KNGA 4BWQA 3RPNA 2MMNA 4G2EA 4JRRA 4XS6A 1KEBA 1SU9A 5IMFA 1EGOA 4XTSA 2XC2A 4ZL8A 1ZMAA 4NAXA 2VLVA 3ZVJA 3C1RA 1XWCA 2Z9SA 1CQGA 2O89A 3IR4A 3C73A 2NTOA 3UARA 1X5CA 3CMIA 4RQXA 5ECNB 2PBJA 1XOBA 1Z7RA 2CAQA 3UAPA 3KMOA 4AJ7A 3V1WA 4TRXA 2IMDA 5AIXA 3IV4A 3VI5A 2X8HA 3ZL5A 3H8QA 3GTUA 4KB3A 1JLWA 1ZOFA 3P7XA 4ZB6A 3PINA 3LEFA 2HFDA 3PH9A 2G0FA 5A4VA 5DAKA 2IJYA 2I4AA 2DMMA 2J23A 2J9HA 1J0FA 3APQA 1TI1A 3IAS2 1JHBA 2YZHA 4HDEA 3ZRDA 5DQSA 4GQCA 1I5GA 5J4UA 3CTFA 3I9V2 4IN0A 4NMUA 1XW9A 2VCQA 4HEA2 1UVZA 4HZ4A 2IFQA 1SD9A 1M9AA 3UVHA 1F6MC 1NW2A 1YEXA 2R4VA 2L5OA 1PX6A 2TRXA 1ZCPA 3Q18A 4N30A 1K0DA 1VF2A 3ZITA 2JACA 3F4RA 2H72A 2KUCA 3ZIJA 3EU3A 1SKRB 3EWLA 5ECPB 4OFTA 1BX9A 3Q6OA 5ECQB 1AUCA 3VWVA 2LRNA 4BVXA 3LYKA 3D4MA 3D4TA 1YEPA 3FY7A 5HQPA 2HNLA 2KHPA 3M1GA 1MD4A 2PU9C 1OC9A 5IMAA 2H74A 1WJKA 1TKDB 3QOUA 6GSVA 3W8JA 3D21A 3G7JA 1K0BA 3FR6A 1JZDA 3GKXA 4DSQA 3HVSA 5D9XA 3GN3A 4ISDA 5CYYA 3CTGA 3F4SA 1AQXA 5KN2A 5E4WA 1BYEA 4TXOB 4JU5A 4NV2A 4AJ6A 5LCZA 1SK2A 5CRWA 2RUEA 1THOA 1UA5A 5IMCA 5AISA 1GP1A 4XCSA 5B8BA 1S3DA 4O7HA 1PMTA 3EMXA 2IIYA 4LA1A 5JWOB 4Q5RA 2H8LA 2RM5A 1GTBA 4IS0A 3QMXA 2B1LA 4KSMA 1HNCA 1GSSA 2X99A 3BJ5A 2PUKC 1QK8A 2A2RA 4ZXGA 5DCHA 1PD21 5DQYA 4EE0A 5EVOA 5DJLA 2JSZA 1TRSA 1O85A 2L4CA 5KEJA 4G19A 2V6OA 3TKSC 2GDRA 4GQFA 1A23A 2EIRA 4V2LA 3BCIA 1EV4A 2N5BA 1V98A 2XHFA 3Q74A 5B6NA 4AF2A 2FWFA 5G1LA 4MP4A 1HYUA 1GRXA 4DEJA 2B7KA 3WT1A 4NXIA 1YDKA 2I9HA 1URMA 4RUVA 5J9BA 4ZBAA 2C80A 5A4WA 2H1DA 1OYJA 3ME8A 3KH7A 2IPAA 2XBIA 4PQIA 2ZNMA 1GTAA 1BAYA 2H1GA 5CRHA 3KM6A 1GSDA 5J9CA 1SL0B 1SL2B 2HLSA 2GZZA 4IJ3A 5HR3A 1YF1A 2CAIA 3VWXA 5J3RA 3RDWA 2VCXA 2AUVA 4TXVA 3ED3A 3EVIA 5GSSA 4MH2A 3GYKA 8GSSA 5D73A 5EPFA 4IQ1A 3A2XA 3F3QA 3H79A 5ECKB 2M80A 5AIVA 1XXUA 2H75A 3TJJA 3HVVA 1Z6NA 1EZKA 1O81A 1U3AA 3D5JA 4LMWA 2LJKA 1VRSD 5HFKA 2OBIA 3ZFLA 2REMA 4I8BA 1T1VA 2FWHA 2GZPA 1PQNA 1O8WA 2O87A 4POBA 3M9KA 3Q19A 3GL3A 2LUSA 2KP1A 4XRDA 3WD6A 3TRPA 11GSA 2ZUPA 4XS4A 3PGTA 3QCPA 2FA8A 1R4WA 1GUKA 2CX4A 1ABAA 1B4QA 4XS1A 5F0GA 3S9FA 4MMMA 5D9TA 2KOKA 1G7EA 1AIUA 2K6VA 2A4VA 2B5XA 1EGRA 1Q98A 3L9VA 1FO5A 1K3LA 3DMLA 2KLXA 3QDNA 4OWYA 5C00A 3LFLA 1GUHA 3GFKA 4DSSB 3LXZA 3IXRA 2AAWA 1TU8A 2B6MA 3TOTA 4WR4A 4EKZA 6GSWA 3H93A 4JE1A 1PL2A 2JZRA 2L59A 4IGJA 2HYXA 4J57E 5D9VA 2OBKA 4RQRA 1GTUA 3TRQA 4PURA 2P31A 4H86A 3ZFBA 1USBA 5GSTA 4WKWA 2PWJA 2DJJA 4OMVA 3C7MA 4KCAA 3GNJA 1ILOA 3FR9A 5B7CA 2H0IA 1KTEA 2IWTA 1GWCA 3KMNA 4HQZA 2RLIA 4I2UA 3IC4A 4GSTA 1R26A 4KDUA 3HKRA 2N5FA 1BEDA 2LRTA 2P0GA 1F3BA 2LNSA 1O7UA 5IM9A 4ML1A 2E0QA 5INYA 1J9BA 2R5GA 4IP6A 2EIQA 4YQVA 4HS1A 1Y6EA 1OKTA 1AC1A 1AXDA 4KUNA 4TR1B 4TVEA 2VUPA 1EP8A 4MABA 1MDJA 5JWRB 5ID2B 3DKSA 4JEDA 2DJKA 3J7Yk 4CHSA 2FWGA 1Z9HA 4ZBBA 4EXJA 3I6AA 3CSJA 1U88A 3NIVA 3F4TA 4MJCA 2N5AA 1Q4JA 3MSZA 1J08A 1M2AA 4F2IA 3GUSA 5B8AA 1YJ6A 4O5RA 2CV4A 3LG6A 2H6YA 4NHZA 2GSSA 5H5QA 1DE2A 4QL9A 3G9BA 4TKYA 2B5YA 1ZYQB 2IL3A 4L5LA 3MDKA 5A4UA 3UMAA 1FB6A 3HXSA 2LTKA 3VWWA 4ZB8A 5DALB 2VCWA 3FRCA 5JCGA 4MK3A 5ABRA 1B9XC 1XPVA 1CQHA 1TW9A 5D96A 4HI7A 2FLSA 3ZLPA 5LD0A 1R7HA 2CZ3A 3G7YA 2O8VB 3RAZA 1A8YA 2IMFA 1YY7A 2R2JA 3WGDA 5DJMA 1SL1B 3TKQA 6GSUA 4FYBA 3MWHA 3HJOA 2F8AA 2YJ7A 1GSUA 2NDOA 1NHOA 4HQSA 4POKA 4PGTA 2GQLA 3LORA 4MZWA 4LL1B 5IMDA 5D93A 3E0UA 4K7IA 5ECLB 4F0BA 2YJHA 3C1SA 3NOFA 1SK0A 5DCGA 1LJRA 4MDCA 5C04A 1PKZA 2GSRA 3CRUA 2ON7A 2NBSA 3EURA 4ACSA 1PRXA 1TOFA 5IOXA 4IKHA 4D73B 1XFLA 2EC4A 1XWGA 1QQ2A 3CYNA 3EC3A 1SD8A 3BD2A 4ECJA 4TR3A 5CP1A 5FHIA 2GVPA 4EL1A 1GSEA 2CT6A 2H6XA 2O7KA 1AQWA 1VF4A 1GLQA 1M7TA 4IBPA 4LMVA 3TB2A 2C3NA 5IPHA 1VF3A 2AB6A 2L4QA 3HJPA 4OO5A 3F63A 4X1UA 1OAZA 4OO4A 2H0GA 3QD9A 5DBQA 1O6JA 1FVKA 5IPGA 1AW9A 5HR0A 3CSHA 3D6IA 3UVTA 1YF0A 2YCDA 4MF7A 1ST9A 1V2AA 2YWNA 3IA1A 1TI3A 3VI7A 3DD3A 2WB9A 3LWAA 3L78A 2F9SA 2VL2A 4MZBA 1M9BA 3UBKA 1M2DA 3FHKA 3HD5A 3WT2A 4KDXA 4WF5A 2YNXA 3RHBA 1PL1A 2IN3A 4G10A 4TR4A 1OC9B 1W4VA 3DGQA 1FHEA 3P2AA 4EDYA 2IMKA 4OFNA 2HRFA 4GLTA 1JZOA 3E3EA 1R5PA 3GKMA 2FHEA 2LS5A 4GCIA 4K1FA 2CQ9A 3UOMA 3QAGA 3P8WA 2DJ0A 2MMAA 5H5RA 4K7NA 2O85A 3R2QA 2H76A 1EWXA 2VD1A 2JZSA 1SJZA 4J2FA 3TGZA 3DVWA 3HYPA 3O3TA 4FYCA 5B6MA 2JZTA 1M99A 2DJ1A 3K8NA 1V58A 19GSA 3US3A 5IQYA 2DBCA 1FB0A 1ZZYA 2HZFA 1FW1A 2JL4A 3APOA 1ML6A 3QFAC 1DUGA 3HZ4A 3FKFA 2HSYA 1Z7PA 2H6ZA 5G2ZA 2M46A 1OC8A 1XWKA 2QGVA 4XHMA 1T4ZA 2CZ2A 4MH3A 2LSTA 1X5EA 2H70A 2V2GA 3UBLA 2FWEA 2V32A 1GULA 2DIYA 1K3OA 4XRAA 4IP1A 1HNBA 2LRCA 2FGXA 1ACVA 1TK0B 3APSA 5A5KA 2HSHA 3C8EA 1WE0A 4MF6A 2HI7A 1I9DA 3HY2A 3M9JA 4QQ7A 18GSA 1K0OA 4HOJA 2VL3A 4PUFC 2DJ3A 4CDOA 2XPDA 2H01A 4I6XA 4IJIA 1S3CA 1V40A 3EINA 4BPYA 2WS2A 3BCKA 1Z5YE 3IRAA 3NZNA 3LSZA 1QFNA 2H1BA 3GMFA 1GLPA 3GIXA 3CBUA 1JFUA 1OE8A 3DXBA 1Z3EA 4I2TA 1YKAA 20GSA 1A24A 1IYIA 4Q5FA 2IMIA 1JLVA 2QSIA 1XWAA 3TJFA 1X5DA 3ISOA 2OADA 3KP8A 1TP9A 3QAVA 3GSSA 4X43A 4PUAA 4JR4A 1GUMA 2WJUA 1Z6MA 4TOPA 3IE3A 1SYRA 5ELAA 1BQ7A 2ALBA 1GSFA 4K7OA 3FEUA 1EOHA 1PN9A 2DMLA 1K3YA 1XW5A 5COHA 3M0FA 2X64A 2QKEA 1LBKA 1ON4A 5IMVA 5JCUA 4BWSA 1UC7A 2VOCA 3GKKA 1F37A 4PXOA 3KP9A 2CA8A 2MMZA 4JBBA 1IYHA 1OE7A 1SK1A 2WULA 9GSSA 1YKCA 1FAAA 5DVBA 2LEGA 3ERGA 3IPZA 3CXGA 1ERTA 1H75A 4EUYA 4YH2A 3P90A 2MBTA 2A2SA 3H1NA
chains in the Genus database with same CATH superfamily
3U5RE 2NVLA 4PX1A 4ULXA 4WR5A 4K0GA 3N5OA 5CREA 5G5EA 2YWOA 4POLA 3KGKA 10GSA 3VPQA 6GSSA 4DSSA 1MEKA 4O92A 1WP0A 1QUWA 4ZL7A 1XZOA 3RBTA 4YAVA 3KH9A 5GZZB 3D0ZA 2VM2A 2L6DA 1TRVA 3WGEA 1X9WB 4BA7A 1M3JA 2FNOA 4K9ZA 2HE3A 1HD2A 4N0VA 3FZAA 4ICYA 2LQQA 2I81A 1TTZA 4YKFA 5ECSA 3LJRA 1JZRA 1C72A 3ME7A 2K8SA 4EDZA 2YV7A 2V1MA 1MTCA 2FY6A 4FO5A 3KEBA 2C0DA 4K0NA 3M8NA 3FZ4A 5ECOB 4ZBDA 2PPTA 5LNKe 4E8EA 1NM3A 4KA0A 3L4NA 1BJXA 4F0CA 2YV9A 2GTUA 4GSSA 1E2YA 1YQ1A 3KCMA 2AV4A 3EPTA 4HU7A 1FOHA 2OJLA 3GX0A 1QMVA 1E6BA 3F8UA 5IIZA 3KTLA 2H71A 5CNWA 2I3YA 2OE0A 1KBNA 4G9HA 3VK9A 5KN1A 1G0TA 4TR1A 3UIWA 4IHUA 4ID0A 4HZ2A 3JCML 1AQVA 2C1YA 1B4PA 4ZL9A 3TOUA 4F82A 3F9UA 4NV5A 1HQOA 2K18A 5IO0A 4JR6A 4BL7B 1V9WA 5ID2A 1S3AA 2L57A 2LV3A 3LXTA 2WDUA 5F06A 5H5SA 2V6KA 2MMOA 1WIKA 2LJAA 1WPIA 4WXTA 2YANA 2G2QA 2B7JA 1XVQA 4MF5A 5G1KA 3DVXA 4ILFA 4WEYA 4AGSA 2H1AA 2GSQA 5ECMB 1PX7A 1B48A 4KE3A 4PQ1A 1JZWA 2HXKA 4KNDA 2MYGA 1GSQA 4MCUA 4P3YB 4N11A 3HZ8A 2HZEA 5JWQB 5AGYA 13GSA 3ZIVA 3FW2A 1T4YA 5DALA 4O5UA 1TK5B 1EV9A 2AJQB 2PERA 4KW6A 2P5QA 3M3MA 2R0PA 2K8VA 1SKWB 4WBJA 5G30A 4MJAA 3ZZXA 4ECIA 1K0NA 2IMEA 2YPMA 1QGVA 3TKPA 4WF4A 7GSSA 4Z2UA 4O32A 1FOVA 5ECRB 2WFCA 3A3TA 4PTSA 3IBHA 2C0FA 1B9YC 1YZXA 1K0MA 4ZILA 5KN3A 4HU9A 5G5FA 4OCFA 2AHEA 1THXA 16GSA 4X0XA 1EOGA 2R6KA 5GAND 3ZMKA 3GTUB 3ZVJD 2VLUA 3EE2A 3L9UA 2CVDA 1SJ6A 5HFIA 4EF0A 2GSTA 5CAXA 2P5RA 1QXHA 2RUFA 5DDLA 3QFBC 2YWIA 2X4AA 5DAKB 1ZGNA 2K9FA 4FYUA 1GNWA 5F8BA 2FD3A 2OE1A 2VM1A 3QR6A 4GSNA 2X8CA 5IO2A 1PN0A 1ZYPA 2H19A 3I43A 2DSAA 4N10A 3A5WA 3RPPA 3D22A 5J41A 3VURA 4TW5A 3BOAA 1T3BA 2VO4A 4D73A 2IFQB 2VCTA 4KH7A 2ES7A 1GSYA 5EY6A 5D9WA 1GH2A 3L9SA 4V2MA 3MAKA 4DVCA 3FR3A 5FT3A 4NPBA 1TRWA 2R3XA 1VGLA 2OE3A 3IK9A 3HA9A 5EL8A 4KSOA 1ZL9A 3ERWA 2PVQA 4IVFA 4K6XA 2C3QA 2MZCA 1GTIA 1O8XA 1G7OA 2TIRA 2FUG2 3RHCA 3LQ7A 4Q5NA 1PSQA 3VFIA 1MDIA 1NHYA 3DIEA 4KDYA 4EVMA 1BG5A 1Y25A 3IK7A 3KZQA 2BJXA 1XCCA 3DYRA 1PA3A 2YP6A 2C8UA 1N8JA 1G6WA 1N2AA 5L71A 3TJKA 5ECIB 3DRNA 4EO3A 1SYXA 5CO3A 1EEJA 1T8EB 4HUAA 1GL8A 5GAPD 2VIMA 3H4KA 3TKSA 2VLTA 1A0RP 2BTOT 4LLRA 3TCOA 5ENUA 5F05A 4F03A 2DIZA 1WMJA 2LJRA 6GSYA 2VL2C 3A2WA 3ZYWA 4HSCX 3IHQA 4TR0A 3HJMA 3TKRA 4TXOA 2L5LA 3KIJA 3I69A 2B5EA 4WETA 2WRTA 4FIWA 3ZREA 3FZ9A 4I97A 2NPBA 4YKGA 1XBSA 4FH8A 1A0FA 3GH6A 3HVNA 4PQHA 4ZB9A 2LQOA 3BBYA 4IW9A 1A2LA 3C71A 3U6VA 2X8GA 1TK8B 2YN1A 4V1Ap 2R37A 5IOWA 4ECCA 4F9ZA 3ERFA 2YZUA 3EU4A 3IDVA 4KAEA 3F6FA 2KP2A 2RM6A 2JU5A 3TDGA 1K0CA 3GSTA 1NSWA 4LL4B 3SBCA 2GT6A 1B8XA 5KN0A 2CVBA 1RQMA 3QAWA 5HR2A 5ECHB 1FVJA 4JZQA 1T00A 1S3RA 6GSTA 2FA4A 1ZYEA 2EIOA 2H30A 4GRFA 2LKUA 4YQMA 1XVWA 4YQUA 4NHWA 3CRTA 4Z2RA 3OR5A 3TJBA 3PR8A 1F9MA 3F3RA 1UN2A 3GX8A 4L8EA 1A2MA 4POMA 1F3AA 2F51A 1XOAA 2CX3A 1OVNA 4GF0A 2ZCTA 3GURA 3GA4A 1U6TA 1V57A 4OD7A 1VF1A 4EIPA 4PNFA 4YAPA 3KD0A 1ERVA 4KX4A 2VCZA 4XS4B 5BMUA 3FZ5A 4I5QA 4OCEA 1SKSB 2XPEA 4K5RA 4L5OA 3TUEA 1XWBA 14GSA 3EYTA 2C0GA 4WBRD 2F3MA 4Q5QA 3FYGA 4MNNA 4IELA 2WZ9A 2DKIA 3W6GA 4GTUA 2GQMA 4K2XA 1U87A 2VL9A 3R3EA 3TKSE 3KJYA 1WOUA 2BMXA 1ERUA 1EEMA 2FCHA 3GHAA 4ZIJA 1RW1A 1R5AA 4MZCA 2RIIA 4GXZA 3DEXA 2A4HA 2C0EA 3GH9A 2GS3A 2ON5A 1O73A 4MA9A 1DE1A 2TRCP 2DLXA 4J56E 3GRXA 1FG4A 2VAFA 2PVOC 2WGRA 3LYPA 4NWYA 3J7Yb 1WRYA 2C3TA 1ERWA 4V1Ag 3WYWA 4DSRA 2I1UA 2E7PA 2L6CA 2OA7A 2GZYA 2VCVA 3FK8A 1DBYA 1TDIA 5IMZA 3ZMLA 3W8SA 3WGXA 3N9JA 4AJ8A 2H0HA 2GGTA 1PGTA 1TU7A 2OKAA 1A2JA 3UJ1A 3O76A 1T7PB 17GSA 3O6TA 3HHVA 2YOIA 3HCZA 2B1KA 3HVXA 1M2BA 1X0RA 1XIYA 4E8HA 2PMTA 3EMPA 3TRXA 1EP7A 1SENA 4K8MA 5ELGA 1A8LA 1M3IA 4KCEA 1SJIA 1XG8A 4L0UA 1OC3A 2GT5A 5E59A 2H66A 4MPGA 2JADA 1TXXA 2HT9A 4Z7XA 2V41A 3SWLA 1LU4A 2DJ2A 2WCIA 3UL3A 4ML6A 4XIHA 2D2ZA 4PNGA 1H4OA 4TN8A 2DC5A 3VWUA 5JCWA 4MPFA 1M0UA 2M72A 3L0HA 1W89A 3GL5A 3KTBA 2OACA 2YWMA 4EIQA 3E9JB 1HNAA 1G6YA 5HFGA 3HDCA 4N0ZA 2C4JA 1X9MB 1K0AA 4OFMA 4RI6A 12GSA 1F2EA 5G31A 4IQAA 1GNEA 5D8IA 3MNGA 1TJDA 2QA2A 3LGCA 4QL7A 4CW9A 2GLRA 2H73A 3TJGA 1DSBA 1MDKA 3ZTLA 2F8FA 2MBSA 4HJMA 4BIKA 1XW6A 5CRDA 2XBQA 3F0IA 4BL7A 2CVKA 2GQKA 1U3IA 5F07A 4HJ2A 2HRNA 2HZEB 3F6DA 3G7IA 2PN8A 4ECBA 3A2VA 5CRGA 4KGIA 4MJBA 6GSXA 3IOSA 5AN1A 4RI7A 2JSYA 2LNTA 4MLYA 2PGTA 3GV1A 4BVYA 4MJEA 4EC0A 1X9SB 4K5SA 3FMWA 4USSA 1AAZA 1TRUA 4V2NA 2AYTA 5HR1A 4O5QA 2VD0A 3AY8A 3VPTA 3DWVA 3VLNA 3IAM2 3UEMA 4GWRA 1RK4A 4L0WA 5J5NA 2E2MA 1PKWA 2E2GA 5FWGA 3KXOA 4K2DA 1OKDA 3CSIA 2B3SA 22GSA 3GKNA 3QPMA 4KF9A 1WWJA 2QC7A 1MD3A 1KNGA 4BWQA 3RPNA 2MMNA 4G2EA 4JRRA 4XS6A 1KEBA 1SU9A 5IMFA 1EGOA 4XTSA 2XC2A 4ZL8A 1ZMAA 4NAXA 2VLVA 3ZVJA 3C1RA 1XWCA 2Z9SA 1CQGA 2O89A 3IR4A 3C73A 2NTOA 3UARA 1X5CA 3CMIA 4RQXA 5ECNB 2PBJA 1XOBA 1Z7RA 2CAQA 3UAPA 3KMOA 4AJ7A 3V1WA 4TRXA 2IMDA 5AIXA 3IV4A 3VI5A 2X8HA 3ZL5A 3H8QA 3GTUA 4KB3A 1JLWA 1ZOFA 3P7XA 4ZB6A 3PINA 3LEFA 2HFDA 3PH9A 2G0FA 5A4VA 5DAKA 2IJYA 2I4AA 2DMMA 2J23A 2J9HA 1J0FA 3APQA 1TI1A 3IAS2 4FQUA 1JHBA 2YZHA 4HDEA 3ZRDA 5DQSA 4GQCA 1I5GA 5J4UA 3CTFA 3I9V2 4IN0A 4NMUA 1XW9A 2VCQA 4HEA2 1UVZA 4HZ4A 2IFQA 1SD9A 1M9AA 3UVHA 1F6MC 1NW2A 1YEXA 2R4VA 2L5OA 1PX6A 2TRXA 1ZCPA 3Q18A 4N30A 1K0DA 1VF2A 3ZITA 2JACA 3F4RA 2H72A 2KUCA 3ZIJA 3EU3A 1SKRB 3EWLA 5ECPB 4OFTA 1BX9A 3Q6OA 5ECQB 1AUCA 3VWVA 2LRNA 4BVXA 3LYKA 3D4MA 3D4TA 1YEPA 3FY7A 5HQPA 2HNLA 2KHPA 3M1GA 1MD4A 2PU9C 1OC9A 4G0KA 5IMAA 3IC8A 2H74A 1WJKA 1TKDB 3QOUA 6GSVA 3W8JA 3D21A 3G7JA 1K0BA 3FR6A 1JZDA 3GKXA 4DSQA 3HVSA 5D9XA 3GN3A 4ISDA 5CYYA 3CTGA 3F4SA 1AQXA 5KN2A 5E4WA 1BYEA 4TXOB 4JU5A 4NV2A 4AJ6A 5LCZA 1SK2A 5CRWA 2RUEA 1THOA 1UA5A 5IMCA 5AISA 1GP1A 4XCSA 5B8BA 1S3DA 4O7HA 1PMTA 3EMXA 2IIYA 4LA1A 5JWOB 4Q5RA 2H8LA 2RM5A 1GTBA 4IS0A 3QMXA 2B1LA 4KSMA 1HNCA 1GSSA 2X99A 3BJ5A 2PUKC 1QK8A 2A2RA 4ZXGA 5DCHA 1PD21 5DQYA 4EE0A 5EVOA 5DJLA 2JSZA 1TRSA 1O85A 2L4CA 5KEJA 4G19A 2V6OA 3TKSC 2GDRA 4GQFA 1A23A 2EIRA 4V2LA 3BCIA 1EV4A 3CQFA 2N5BA 1V98A 2XHFA 3Q74A 5B6NA 4AF2A 2FWFA 5G1LA 4MP4A 4G0LA 1HYUA 1GRXA 4DEJA 2B7KA 3WT1A 4NXIA 1YDKA 2I9HA 1URMA 4RUVA 5J9BA 4ZBAA 2C80A 5A4WA 2H1DA 1OYJA 3ME8A 3KH7A 2IPAA 2XBIA 4PQIA 2ZNMA 1GTAA 1BAYA 2H1GA 5CRHA 3KM6A 1GSDA 5J9CA 1SL0B 1SL2B 2HLSA 2GZZA 4IJ3A 5HR3A 1YF1A 2CAIA 3VWXA 5J3RA 3RDWA 2QA1A 2VCXA 2AUVA 4TXVA 3ED3A 3EVIA 5GSSA 4MH2A 3GYKA 8GSSA 5D73A 5EPFA 4IQ1A 3A2XA 3F3QA 3H79A 5ECKB 2M80A 5AIVA 1XXUA 2H75A 3TJJA 3HVVA 1Z6NA 1EZKA 1O81A 1U3AA 3MYDA 3D5JA 3LW9A 4LMWA 2LJKA 1VRSD 5HFKA 2OBIA 3ZFLA 2REMA 4I8BA 1T1VA 2FWHA 2GZPA 1PQNA 1O8WA 2O87A 4POBA 3M9KA 3Q19A 3GL3A 2LUSA 2KP1A 4XRDA 3WD6A 3TRPA 11GSA 2ZUPA 4XS4A 3PGTA 3QCPA 2FA8A 1R4WA 1GUKA 2CX4A 1ABAA 1B4QA 4XS1A 5F0GA 3S9FA 4MMMA 5D9TA 2KOKA 1G7EA 1AIUA 2K6VA 2A4VA 2B5XA 1EGRA 1Q98A 3L9VA 1FO5A 1K3LA 3DMLA 2KLXA 3QDNA 4OWYA 5C00A 3LFLA 1GUHA 3GFKA 4DSSB 3LXZA 3IXRA 2AAWA 1TU8A 2B6MA 3TOTA 4WR4A 4EKZA 6GSWA 3H93A 4JE1A 1PL2A 2JZRA 2L59A 4IGJA 2HYXA 4J57E 5D9VA 2OBKA 4RQRA 1GTUA 3TRQA 4PURA 2P31A 4H86A 3ZFBA 1USBA 5GSTA 4WKWA 2PWJA 2DJJA 2A2PA 4OMVA 3C7MA 4KCAA 3GNJA 1ILOA 3FR9A 5B7CA 2H0IA 1KTEA 2IWTA 1GWCA 3KMNA 4HQZA 2RLIA 4I2UA 3IC4A 4GSTA 1R26A 4KDUA 3HKRA 2N5FA 1BEDA 2LRTA 2P0GA 1F3BA 2LNSA 1O7UA 5IM9A 4ML1A 2E0QA 5INYA 1J9BA 2R5GA 4IP6A 2EIQA 4YQVA 4HS1A 1Y6EA 1OKTA 1AC1A 1AXDA 4KUNA 4TR1B 4TVEA 2HRKA 2VUPA 1EP8A 4MABA 1MDJA 5JWRB 5ID2B 3DKSA 4JEDA 2DJKA 3J7Yk 4CHSA 3PPUA 2FWGA 2R0CA 1Z9HA 4ZBBA 4EXJA 3I6AA 3CSJA 1U88A 3NIVA 3F4TA 4MJCA 2N5AA 1Q4JA 3MSZA 1J08A 1M2AA 4F2IA 3GUSA 5B8AA 1YJ6A 4O5RA 3MIXA 2CV4A 3LG6A 2H6YA 4NHZA 2GSSA 5H5QA 1DE2A 4QL9A 3G9BA 4TKYA 2B5YA 1ZYQB 2IL3A 4L5LA 3MDKA 5A4UA 3UMAA 1FB6A 4A5PA 3HXSA 1ZYNA 2LTKA 3VWWA 4ZB8A 4BVYB 5DALB 2VCWA 3FRCA 5JCGA 4MK3A 5ABRA 1B9XC 1XPVA 1CQHA 1TW9A 5D96A 4HI7A 2FLSA 3ZLPA 5LD0A 1R7HA 2CZ3A 3G7YA 2O8VB 3RAZA 1A8YA 2IMFA 1YY7A 2R2JA 3WGDA 5DJMA 1SL1B 3TKQA 6GSUA 4FYBA 1PFOA 3MWHA 3HJOA 2F8AA 2YJ7A 1GSUA 2NDOA 1NHOA 4HQSA 4POKA 4PGTA 3IHGA 2GQLA 3LORA 4MZWA 4LL1B 5IMDA 5D93A 3E0UA 4K7IA 5ECLB 4F0BA 2YJHA 3C1SA 3NOFA 1SK0A 5DCGA 1LJRA 4MDCA 5C04A 1PKZA 2GSRA 3CRUA 2ON7A 2NBSA 3EURA 4ACSA 1PRXA 1TOFA 5IOXA 4IKHA 4D73B 1XFLA 2EC4A 1XWGA 1QQ2A 3CYNA 3EC3A 1SD8A 3BD2A 4ECJA 4TR3A 5CP1A 5FHIA 2GVPA 4EL1A 1GSEA 2CT6A 2H6XA 2O7KA 1AQWA 1VF4A 1GLQA 1M7TA 4IBPA 4LMVA 3TB2A 2C3NA 5IPHA 1VF3A 2AB6A 2L4QA 3HJPA 4OO5A 3F63A 4X1UA 1OAZA 4OO4A 2H0GA 3QD9A 5DBQA 1O6JA 1FVKA 5IPGA 1AW9A 5HR0A 3CSHA 3D6IA 3UVTA 1YF0A 2YCDA 4MF7A 1ST9A 4X4JA 1V2AA 2YWNA 3IA1A 1TI3A 3VI7A 3DD3A 2WB9A 3LWAA 3L78A 2F9SA 2VL2A 4MZBA 1M9BA 3UBKA 1M2DA 4BVXB 3FHKA 3HD5A 3WT2A 4KDXA 4WF5A 2YNXA 3RHBA 1PL1A 2IN3A 4G10A 4TR4A 1OC9B 1W4VA 3DGQA 1FHEA 2DKHA 3P2AA 2IMKA 4EDYA 4OFNA 2HRFA 4GLTA 1JZOA 3E3EA 1R5PA 3GKMA 2FHEA 2LS5A 4GCIA 4K1FA 2CQ9A 3UOMA 3QAGA 3P8WA 2DJ0A 2MMAA 4CY8A 5H5RA 4K7NA 2O85A 3R2QA 2H76A 1EWXA 2VD1A 4CY6A 2JZSA 1SJZA 4J2FA 3TGZA 3DVWA 3HYPA 3O3TA 4FYCA 5KOXA 5B6MA 2JZTA 1M99A 2DJ1A 3K8NA 1V58A 19GSA 3US3A 2HRAA 5IQYA 2DBCA 1FB0A 1ZZYA 2HZFA 2R0GA 1FW1A 2JL4A 3APOA 1ML6A 3QFAC 4G0IA 1DUGA 3HZ4A 3FKFA 2HSYA 1Z7PA 2H6ZA 2UZ8A 5G2ZA 2M46A 1OC8A 1XWKA 2QGVA 4XHMA 1T4ZA 2CZ2A 4MH3A 3A5IA 2LSTA 1X5EA 2H70A 2V2GA 3UBLA 2FWEA 2V32A 1GULA 2DIYA 1K3OA 4XRAA 4Z2TA 4IP1A 1HNBA 2LRCA 2FGXA 1ACVA 1TK0B 3APSA 5A5KA 2HSHA 3C8EA 1WE0A 4MF6A 2HI7A 1I9DA 3HY2A 3M9JA 4QQ7A 18GSA 1K0OA 4HOJA 2VL3A 4PUFC 2DJ3A 4CDOA 2XPDA 2H01A 4I6XA 4IJIA 1S3CA 1V40A 3EINA 4BPYA 2WS2A 3BCKA 1Z5YE 3IRAA 3NZNA 3LSZA 1QFNA 2H1BA 3GMFA 1GLPA 3GIXA 3CBUA 5BRTA 1JFUA 1OE8A 3DXBA 1Z3EA 4I2TA 1YKAA 20GSA 1A24A 1IYIA 4Q5FA 2IMIA 1JLVA 2QSIA 1XWAA 3TJFA 1X5DA 3ISOA 2OADA 3KP8A 1TP9A 3QAVA 3GSSA 4X43A 4PUAA 4JR4A 1GUMA 2WJUA 1Z6MA 4TOPA 3IE3A 2HSMA 1SYRA 5ELAA 1BQ7A 2ALBA 1GSFA 4K7OA 3FEUA 1EOHA 1PN9A 2DMLA 1K3YA 1XW5A 5COHA 5KOWA 3M0FA 2X64A 2X49A 2QKEA 1LBKA 1ON4A 5IMVA 5JCUA 4BWSA 1UC7A 2VOCA 3GKKA 1F37A 4PXOA 3KP9A 2CA8A 2MMZA 4JBBA 1IYHA 1OE7A 1SK1A 2WULA 9GSSA 1YKCA 1FAAA 5DVBA 2LEGA 3ERGA 3IPZA 3CXGA 1ERTA 1H75A 4EUYA 4YH2A 3P90A 2MBTA 2A2SA 3H1NA
chains in the Genus database with same CATH topology
3U5RE 2NVLA 4PX1A 4ULXA 4WR5A 4K0GA 3N5OA 5CREA 5G5EA 2YWOA 4POLA 3KGKA 10GSA 3VPQA 6GSSA 4DSSA 1MEKA 4O92A 1WP0A 1QUWA 4ZL7A 1XZOA 3RBTA 4YAVA 3KH9A 5GZZB 3D0ZA 2VM2A 2L6DA 1TRVA 3WGEA 1X9WB 4BA7A 2FNOA 4K9ZA 2HE3A 1HD2A 4N0VA 3FZAA 4ICYA 2LQQA 2I81A 1TTZA 4YKFA 5ECSA 3LJRA 1JZRA 1C72A 3ME7A 2K8SA 4EDZA 2YV7A 2V1MA 1MTCA 2FY6A 4FO5A 3KEBA 2C0DA 4K0NA 3M8NA 3FZ4A 5ECOB 4ZBDA 2PPTA 5LNKe 4E8EA 1NM3A 4KA0A 3L4NA 1BJXA 4F0CA 2YV9A 2GTUA 4GSSA 1E2YA 1YQ1A 3KCMA 2AV4A 3EPTA 4HU7A 1FOHA 2OJLA 3GX0A 1QMVA 1E6BA 3F8UA 5IIZA 3KTLA 2H71A 5CNWA 2I3YA 2OE0A 1KBNA 4G9HA 3VK9A 5KN1A 1G0TA 4TR1A 3UIWA 4IHUA 4ID0A 4HZ2A 3JCML 1AQVA 2C1YA 1B4PA 4ZL9A 3TOUA 4F82A 3F9UA 4NV5A 1HQOA 2K18A 5IO0A 4JR6A 4BL7B 1V9WA 5ID2A 1S3AA 2L57A 2LV3A 3LXTA 2WDUA 5F06A 5H5SA 2V6KA 2MMOA 1WIKA 2LJAA 1WPIA 4WXTA 2YANA 2G2QA 2B7JA 1XVQA 4MF5A 5G1KA 3DVXA 4ILFA 4WEYA 4AGSA 2H1AA 2GSQA 5ECMB 1PX7A 1B48A 4KE3A 4PQ1A 1JZWA 2HXKA 4KNDA 2MYGA 1GSQA 4MCUA 4P3YB 4N11A 3HZ8A 2HZEA 5JWQB 5AGYA 13GSA 3ZIVA 3FW2A 1T4YA 5DALA 4O5UA 1TK5B 1EV9A 2AJQB 2PERA 4KW6A 2P5QA 3M3MA 2R0PA 2K8VA 1SKWB 4WBJA 5G30A 4MJAA 3ZZXA 4ECIA 1K0NA 2IMEA 2YPMA 1QGVA 3TKPA 4WF4A 7GSSA 4Z2UA 4O32A 1FOVA 5ECRB 2WFCA 3A3TA 4PTSA 3IBHA 2C0FA 1B9YC 1YZXA 1K0MA 4ZILA 5KN3A 4HU9A 5G5FA 4OCFA 2AHEA 1THXA 16GSA 4X0XA 1EOGA 2R6KA 5GAND 3ZMKA 3GTUB 3ZVJD 2VLUA 3EE2A 3L9UA 2CVDA 1SJ6A 5HFIA 4EF0A 2GSTA 5CAXA 2P5RA 1QXHA 2RUFA 5DDLA 3QFBC 2YWIA 2X4AA 5DAKB 1ZGNA 2K9FA 4FYUA 1GNWA 5F8BA 2FD3A 2OE1A 2VM1A 3QR6A 4GSNA 2X8CA 5IO2A 1PN0A 1ZYPA 2H19A 3I43A 2DSAA 4N10A 3A5WA 3RPPA 3D22A 5J41A 3VURA 4TW5A 3BOAA 1T3BA 2VO4A 4D73A 2IFQB 2VCTA 4KH7A 2ES7A 1GSYA 5EY6A 5D9WA 1GH2A 3L9SA 4V2MA 3MAKA 4DVCA 3FR3A 5FT3A 4NPBA 1TRWA 2R3XA 1VGLA 2OE3A 3IK9A 3HA9A 5EL8A 4KSOA 1ZL9A 3ERWA 2PVQA 4IVFA 4K6XA 2C3QA 2MZCA 1GTIA 1O8XA 1G7OA 2TIRA 2FUG2 3RHCA 3LQ7A 4Q5NA 1PSQA 3VFIA 1MDIA 1NHYA 3DIEA 4KDYA 4EVMA 1BG5A 1Y25A 3IK7A 3KZQA 2BJXA 1XCCA 3DYRA 1PA3A 2YP6A 2C8UA 1N8JA 1G6WA 1N2AA 5L71A 3TJKA 5ECIB 3DRNA 4EO3A 1SYXA 5CO3A 1EEJA 1T8EB 4HUAA 1GL8A 5GAPD 2VIMA 3H4KA 3TKSA 2VLTA 1A0RP 2BTOT 4LLRA 3TCOA 5ENUA 5F05A 4F03A 2DIZA 1WMJA 2LJRA 6GSYA 2VL2C 3A2WA 3ZYWA 3IHQA 4TR0A 3HJMA 3TKRA 4TXOA 2L5LA 3KIJA 3I69A 2B5EA 4WETA 2WRTA 4FIWA 3ZREA 3FZ9A 4I97A 2NPBA 4YKGA 1XBSA 4FH8A 1A0FA 3GH6A 4PQHA 4ZB9A 2LQOA 3BBYA 4IW9A 1A2LA 3C71A 3U6VA 2X8GA 1TK8B 2YN1A 4V1Ap 2R37A 5IOWA 4ECCA 4F9ZA 3ERFA 2YZUA 3EU4A 3IDVA 4KAEA 3F6FA 2KP2A 2RM6A 2JU5A 3TDGA 1K0CA 3GSTA 1NSWA 4LL4B 3SBCA 2GT6A 1B8XA 5KN0A 2CVBA 1RQMA 3QAWA 5HR2A 5ECHB 1FVJA 4JZQA 1T00A 6GSTA 2FA4A 1ZYEA 2EIOA 2H30A 4GRFA 2LKUA 4YQMA 1XVWA 4YQUA 4NHWA 3CRTA 4Z2RA 3OR5A 3TJBA 3PR8A 1F9MA 3F3RA 1UN2A 3GX8A 4L8EA 1A2MA 4POMA 1F3AA 2F51A 1XOAA 2CX3A 1OVNA 4GF0A 2ZCTA 3GURA 3GA4A 1U6TA 1V57A 4OD7A 1VF1A 4EIPA 4PNFA 4YAPA 3KD0A 1ERVA 4KX4A 2VCZA 4XS4B 5BMUA 3FZ5A 4I5QA 4OCEA 1SKSB 2XPEA 4K5RA 4L5OA 3TUEA 1XWBA 14GSA 3EYTA 2C0GA 4WBRD 2F3MA 4Q5QA 3FYGA 4MNNA 4IELA 2WZ9A 2DKIA 3W6GA 4GTUA 2GQMA 4K2XA 1U87A 2VL9A 3R3EA 3TKSE 3KJYA 1WOUA 2BMXA 1ERUA 1EEMA 2FCHA 3GHAA 4ZIJA 1RW1A 1R5AA 4MZCA 2RIIA 4GXZA 3DEXA 2A4HA 2C0EA 3GH9A 2GS3A 2ON5A 1O73A 4MA9A 1DE1A 2TRCP 2DLXA 4J56E 3GRXA 1FG4A 2VAFA 2PVOC 2WGRA 3LYPA 4NWYA 3J7Yb 1WRYA 2C3TA 1ERWA 4V1Ag 3WYWA 4DSRA 2I1UA 2E7PA 2L6CA 2OA7A 2GZYA 2VCVA 3FK8A 1DBYA 1TDIA 5IMZA 3ZMLA 3W8SA 3WGXA 3N9JA 4AJ8A 2H0HA 2GGTA 1PGTA 1TU7A 2OKAA 1A2JA 3UJ1A 3O76A 1T7PB 17GSA 3O6TA 3HHVA 2YOIA 3HCZA 2B1KA 3HVXA 1M2BA 1X0RA 1XIYA 4E8HA 2PMTA 3EMPA 3TRXA 1EP7A 1SENA 4K8MA 5ELGA 1A8LA 4KCEA 1SJIA 4L0UA 1OC3A 2GT5A 5E59A 2H66A 4MPGA 2JADA 1TXXA 2HT9A 4Z7XA 2V41A 3SWLA 1LU4A 2DJ2A 2WCIA 3UL3A 4ML6A 4XIHA 2D2ZA 4PNGA 1H4OA 4TN8A 2DC5A 3VWUA 5JCWA 4MPFA 1M0UA 2M72A 3L0HA 1W89A 3GL5A 3KTBA 2OACA 2YWMA 4EIQA 3E9JB 1HNAA 1G6YA 5HFGA 3HDCA 4N0ZA 2C4JA 1X9MB 1K0AA 4OFMA 4RI6A 12GSA 1F2EA 5G31A 4IQAA 1GNEA 5D8IA 3MNGA 1TJDA 2QA2A 3LGCA 4QL7A 4CW9A 2GLRA 2H73A 3TJGA 1DSBA 1MDKA 3ZTLA 2F8FA 2MBSA 4HJMA 1XW6A 5CRDA 2XBQA 3F0IA 4BL7A 2CVKA 2GQKA 1U3IA 5F07A 4HJ2A 2HRNA 2HZEB 3F6DA 3G7IA 2PN8A 4ECBA 3A2VA 5CRGA 4KGIA 4MJBA 6GSXA 3IOSA 5AN1A 4RI7A 2JSYA 2LNTA 4MLYA 2PGTA 3GV1A 4BVYA 4MJEA 4EC0A 1X9SB 4K5SA 3FMWA 4USSA 1AAZA 1TRUA 4V2NA 2AYTA 5HR1A 4O5QA 2VD0A 3AY8A 3VPTA 3DWVA 3VLNA 3IAM2 3UEMA 4GWRA 1RK4A 4L0WA 5J5NA 2E2MA 1PKWA 2E2GA 5FWGA 3KXOA 4K2DA 1OKDA 3CSIA 2B3SA 22GSA 3GKNA 3QPMA 4KF9A 1WWJA 2QC7A 1MD3A 1KNGA 4BWQA 3RPNA 2MMNA 4G2EA 4JRRA 4XS6A 1KEBA 1SU9A 5IMFA 1EGOA 4XTSA 2XC2A 4ZL8A 1ZMAA 4NAXA 2VLVA 3ZVJA 3C1RA 1XWCA 2Z9SA 1CQGA 2O89A 3IR4A 3C73A 2NTOA 3UARA 1X5CA 3CMIA 4RQXA 5ECNB 2PBJA 1XOBA 1Z7RA 2CAQA 3UAPA 3KMOA 4AJ7A 3V1WA 4TRXA 2IMDA 5AIXA 3IV4A 3VI5A 2X8HA 3ZL5A 3H8QA 3GTUA 4KB3A 1JLWA 1ZOFA 3P7XA 4ZB6A 3PINA 3LEFA 2HFDA 3PH9A 2G0FA 5A4VA 5DAKA 2IJYA 2I4AA 2DMMA 2J23A 2J9HA 1J0FA 3APQA 1TI1A 3IAS2 4FQUA 1JHBA 2YZHA 4HDEA 3ZRDA 5DQSA 4GQCA 1I5GA 5J4UA 3CTFA 3I9V2 4IN0A 4NMUA 1XW9A 2VCQA 4HEA2 1UVZA 4HZ4A 2IFQA 1SD9A 1M9AA 3UVHA 1F6MC 1NW2A 1YEXA 2R4VA 2L5OA 1PX6A 2TRXA 1ZCPA 3Q18A 4N30A 1K0DA 1VF2A 3ZITA 2JACA 3F4RA 2H72A 2KUCA 3ZIJA 3EU3A 1SKRB 3EWLA 5ECPB 4OFTA 1BX9A 3Q6OA 5ECQB 1AUCA 3VWVA 2LRNA 4BVXA 3LYKA 3D4MA 3D4TA 1YEPA 3FY7A 5HQPA 2HNLA 2KHPA 3M1GA 1MD4A 2PU9C 1OC9A 4G0KA 5IMAA 3IC8A 2H74A 1WJKA 1TKDB 3QOUA 6GSVA 3W8JA 3D21A 3G7JA 1K0BA 3FR6A 1JZDA 3GKXA 4DSQA 3HVSA 5D9XA 3GN3A 4ISDA 5CYYA 3CTGA 3F4SA 1AQXA 5KN2A 5E4WA 1BYEA 4TXOB 4JU5A 4NV2A 4AJ6A 5LCZA 1SK2A 5CRWA 2RUEA 1THOA 1UA5A 5IMCA 5AISA 1GP1A 4XCSA 5B8BA 1S3DA 4O7HA 1PMTA 3EMXA 2IIYA 4LA1A 5JWOB 4Q5RA 2H8LA 2RM5A 1GTBA 4IS0A 3QMXA 2B1LA 4KSMA 1HNCA 1GSSA 2X99A 3BJ5A 2PUKC 1QK8A 2A2RA 4ZXGA 5DCHA 1PD21 5DQYA 4EE0A 5EVOA 5DJLA 2JSZA 1TRSA 1O85A 2L4CA 5KEJA 4G19A 2V6OA 3TKSC 2GDRA 4GQFA 1A23A 2EIRA 4V2LA 3BCIA 1EV4A 2N5BA 1V98A 2XHFA 3Q74A 5B6NA 4AF2A 2FWFA 5G1LA 4MP4A 4G0LA 1HYUA 1GRXA 4DEJA 2B7KA 3WT1A 4NXIA 1YDKA 2I9HA 1URMA 4RUVA 5J9BA 4ZBAA 2C80A 5A4WA 2H1DA 1OYJA 3ME8A 3KH7A 2IPAA 2XBIA 4PQIA 2ZNMA 1GTAA 1BAYA 2H1GA 5CRHA 3KM6A 1GSDA 5J9CA 1SL0B 1SL2B 2HLSA 2GZZA 4IJ3A 5HR3A 1YF1A 2CAIA 3VWXA 5J3RA 3RDWA 2QA1A 2VCXA 2AUVA 4TXVA 3ED3A 3EVIA 5GSSA 4MH2A 3GYKA 8GSSA 5D73A 5EPFA 4IQ1A 3A2XA 3F3QA 3H79A 5ECKB 2M80A 5AIVA 1XXUA 2H75A 3TJJA 3HVVA 1Z6NA 1EZKA 1O81A 1U3AA 3MYDA 3D5JA 3LW9A 4LMWA 2LJKA 1VRSD 5HFKA 2OBIA 3ZFLA 2REMA 4I8BA 1T1VA 2FWHA 2GZPA 1PQNA 1O8WA 2O87A 4POBA 3M9KA 3Q19A 3GL3A 2LUSA 2KP1A 4XRDA 3WD6A 3TRPA 11GSA 2ZUPA 4XS4A 3PGTA 3QCPA 2FA8A 1R4WA 1GUKA 2CX4A 1ABAA 1B4QA 4XS1A 5F0GA 3S9FA 4MMMA 5D9TA 2KOKA 1G7EA 1AIUA 2K6VA 2A4VA 2B5XA 1EGRA 1Q98A 3L9VA 1FO5A 1K3LA 3DMLA 2KLXA 3QDNA 4OWYA 5C00A 3LFLA 1GUHA 3GFKA 4DSSB 3LXZA 3IXRA 2AAWA 1TU8A 2B6MA 3TOTA 4WR4A 4EKZA 6GSWA 3H93A 4JE1A 1PL2A 2JZRA 2L59A 4IGJA 2HYXA 4J57E 5D9VA 2OBKA 4RQRA 1GTUA 3TRQA 4PURA 2P31A 4H86A 3ZFBA 1USBA 5GSTA 4WKWA 2PWJA 2DJJA 2A2PA 4OMVA 3C7MA 4KCAA 3GNJA 1ILOA 3FR9A 5B7CA 2H0IA 1KTEA 2IWTA 1GWCA 3KMNA 4HQZA 2RLIA 4I2UA 3IC4A 4GSTA 1R26A 4KDUA 3HKRA 2N5FA 1BEDA 2LRTA 2P0GA 1F3BA 2LNSA 1O7UA 5IM9A 4ML1A 2E0QA 5INYA 1J9BA 2R5GA 4IP6A 2EIQA 4YQVA 4HS1A 1Y6EA 1OKTA 1AC1A 1AXDA 4KUNA 4TR1B 4TVEA 2HRKA 2VUPA 1EP8A 4MABA 1MDJA 5JWRB 5ID2B 3DKSA 4JEDA 2DJKA 3J7Yk 4CHSA 3PPUA 2FWGA 2R0CA 1Z9HA 4ZBBA 4EXJA 3I6AA 3CSJA 1U88A 3NIVA 3F4TA 4MJCA 2N5AA 1Q4JA 3MSZA 1J08A 1M2AA 4F2IA 3GUSA 5B8AA 1YJ6A 4O5RA 3MIXA 2CV4A 3LG6A 2H6YA 4NHZA 2GSSA 5H5QA 1DE2A 4QL9A 3G9BA 4TKYA 2B5YA 1ZYQB 2IL3A 4L5LA 3MDKA 5A4UA 3UMAA 1FB6A 4A5PA 3HXSA 1ZYNA 2LTKA 3VWWA 4ZB8A 4BVYB 5DALB 2VCWA 3FRCA 5JCGA 4MK3A 5ABRA 1B9XC 1XPVA 1CQHA 1TW9A 5D96A 4HI7A 2FLSA 3ZLPA 5LD0A 1R7HA 2CZ3A 3G7YA 2O8VB 3RAZA 1A8YA 2IMFA 1YY7A 2R2JA 3WGDA 5DJMA 1SL1B 3TKQA 6GSUA 4FYBA 3MWHA 3HJOA 2F8AA 2YJ7A 1GSUA 2NDOA 1NHOA 4HQSA 4POKA 4PGTA 3IHGA 2GQLA 3LORA 4MZWA 4LL1B 5IMDA 5D93A 3E0UA 4K7IA 5ECLB 4F0BA 2YJHA 3C1SA 3NOFA 1SK0A 5DCGA 1LJRA 4MDCA 5C04A 1PKZA 2GSRA 3CRUA 2ON7A 2NBSA 3EURA 4ACSA 1PRXA 1TOFA 5IOXA 4IKHA 4D73B 1XFLA 2EC4A 1XWGA 1QQ2A 3CYNA 3EC3A 1SD8A 3BD2A 4ECJA 4TR3A 5CP1A 5FHIA 2GVPA 4EL1A 1GSEA 2CT6A 2H6XA 2O7KA 1AQWA 1VF4A 1GLQA 1M7TA 4IBPA 4LMVA 3TB2A 2C3NA 5IPHA 1VF3A 2AB6A 2L4QA 3HJPA 4OO5A 3F63A 4X1UA 1OAZA 4OO4A 2H0GA 3QD9A 5DBQA 1O6JA 1FVKA 5IPGA 1AW9A 5HR0A 3CSHA 3D6IA 3UVTA 1YF0A 2YCDA 4MF7A 1ST9A 4X4JA 1V2AA 2YWNA 3IA1A 1TI3A 3VI7A 3DD3A 2WB9A 3LWAA 3L78A 2F9SA 2VL2A 4MZBA 1M9BA 3UBKA 1M2DA 4BVXB 3FHKA 3HD5A 3WT2A 4KDXA 4WF5A 2YNXA 3RHBA 1PL1A 2IN3A 4G10A 4TR4A 1OC9B 1W4VA 3DGQA 1FHEA 2DKHA 3P2AA 2IMKA 4EDYA 4OFNA 2HRFA 4GLTA 1JZOA 3E3EA 1R5PA 3GKMA 2FHEA 2LS5A 4GCIA 4K1FA 2CQ9A 3UOMA 3QAGA 3P8WA 2DJ0A 2MMAA 4CY8A 5H5RA 4K7NA 2O85A 3R2QA 2H76A 1EWXA 2VD1A 4CY6A 2JZSA 1SJZA 4J2FA 3TGZA 3DVWA 3HYPA 3O3TA 4FYCA 5KOXA 5B6MA 2JZTA 1M99A 2DJ1A 3K8NA 1V58A 19GSA 3US3A 2HRAA 5IQYA 2DBCA 1FB0A 1ZZYA 2HZFA 2R0GA 1FW1A 2JL4A 3APOA 1ML6A 3QFAC 4G0IA 1DUGA 3HZ4A 3FKFA 2HSYA 1Z7PA 2H6ZA 2UZ8A 5G2ZA 2M46A 1OC8A 1XWKA 2QGVA 4XHMA 1T4ZA 2CZ2A 4MH3A 3A5IA 2LSTA 1X5EA 2H70A 2V2GA 3UBLA 2FWEA 2V32A 1GULA 2DIYA 1K3OA 4XRAA 4Z2TA 4IP1A 1HNBA 2LRCA 2FGXA 1ACVA 1TK0B 3APSA 5A5KA 2HSHA 3C8EA 1WE0A 4MF6A 2HI7A 1I9DA 3HY2A 3M9JA 4QQ7A 18GSA 1K0OA 4HOJA 2VL3A 4PUFC 2DJ3A 4CDOA 2XPDA 2H01A 4I6XA 4IJIA 1S3CA 1V40A 3EINA 4BPYA 2WS2A 3BCKA 1Z5YE 3IRAA 3NZNA 3LSZA 1QFNA 2H1BA 3GMFA 1GLPA 3GIXA 3CBUA 5BRTA 1JFUA 1OE8A 3DXBA 1Z3EA 4I2TA 1YKAA 20GSA 1A24A 1IYIA 4Q5FA 2IMIA 1JLVA 2QSIA 1XWAA 3TJFA 1X5DA 3ISOA 2OADA 3KP8A 1TP9A 3QAVA 3GSSA 4X43A 4PUAA 4JR4A 1GUMA 2WJUA 1Z6MA 4TOPA 3IE3A 2HSMA 1SYRA 5ELAA 1BQ7A 2ALBA 1GSFA 4K7OA 3FEUA 1EOHA 1PN9A 2DMLA 1K3YA 1XW5A 5COHA 5KOWA 3M0FA 2X64A 2X49A 2QKEA 1LBKA 1ON4A 5IMVA 5JCUA 4BWSA 1UC7A 2VOCA 3GKKA 1F37A 4PXOA 3KP9A 2CA8A 2MMZA 4JBBA 1IYHA 1OE7A 1SK1A 2WULA 9GSSA 1YKCA 1FAAA 5DVBA 2LEGA 3ERGA 3IPZA 3CXGA 1ERTA 1H75A 4EUYA 4YH2A 3P90A 2MBTA 2A2SA 3H1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5R E;  2NVL A;  4PX1 A;  4ULX A;  4WR5 A;  4K0G A;  3N5O A;  5CRE A;  5G5E A;  2YWO A;  4POL A;  3KGK A;  10GS A;  3VPQ A;  6GSS A;  4DSS A;  1MEK A;  4O92 A;  1WP0 A;  1QUW A;  4ZL7 A;  1XZO A;  3RBT A;  4YAV A;  3KH9 A;  5GZZ B;  3D0Z A;  2VM2 A;  2L6D A;  1TRV A;  3WGE A;  1X9W B;  4BA7 A;  2FNO A;  4K9Z A;  2HE3 A;  1HD2 A;  4N0V A;  3FZA A;  2LQQ A;  2I81 A;  1TTZ A;  5ECS A;  3LJR A;  1JZR A;  1C72 A;  3ME7 A;  2K8S A;  4EDZ A;  2YV7 A;  2V1M A;  1MTC A;  2FY6 A;  4FO5 A;  3KEB A;  2C0D A;  4K0N A;  3M8N A;  3FZ4 A;  5ECO B;  4ZBD A;  2PPT A;  5LNK e;  4E8E A;  1NM3 A;  4KA0 A;  3L4N A;  1BJX A;  4F0C A;  2YV9 A;  2GTU A;  4GSS A;  1E2Y A;  1YQ1 A;  3KCM A;  2AV4 A;  4HU7 A;  2OJL A;  3GX0 A;  1QMV A;  1E6B A;  3F8U A;  5IIZ A;  3KTL A;  2H71 A;  5CNW A;  2I3Y A;  2OE0 A;  1KBN A;  4G9H A;  3VK9 A;  5KN1 A;  1G0T A;  4TR1 A;  3UIW A;  4IHU A;  4ID0 A;  4HZ2 A;  3JCM L;  1AQV A;  2C1Y A;  1B4P A;  4ZL9 A;  3TOU A;  4F82 A;  3F9U A;  4NV5 A;  1HQO A;  2K18 A;  5IO0 A;  4JR6 A;  1V9W A;  5ID2 A;  1S3A A;  2L57 A;  2LV3 A;  3LXT A;  2WDU A;  5F06 A;  5H5S A;  2V6K A;  2MMO A;  1WIK A;  2LJA A;  1WPI A;  4WXT A;  2YAN A;  2G2Q A;  2B7J A;  1XVQ A;  4MF5 A;  5G1K A;  3DVX A;  4ILF A;  4WEY A;  4AGS A;  2H1A A;  2GSQ A;  5ECM B;  1PX7 A;  1B48 A;  4KE3 A;  4PQ1 A;  1JZW A;  2HXK A;  4KND A;  2MYG A;  1GSQ A;  4MCU A;  4P3Y B;  4N11 A;  3HZ8 A;  2HZE A;  5JWQ B;  5AGY A;  13GS A;  3ZIV A;  3FW2 A;  1T4Y A;  5DAL A;  1TK5 B;  1EV9 A;  2AJQ B;  2PER A;  4KW6 A;  2P5Q A;  3M3M A;  2K8V A;  1SKW B;  4WBJ A;  5G30 A;  4MJA A;  3ZZX A;  4ECI A;  1K0N A;  2IME A;  2YPM A;  1QGV A;  3TKP A;  4WF4 A;  7GSS A;  4O32 A;  1FOV A;  5ECR B;  2WFC A;  3A3T A;  3IBH A;  2C0F A;  1B9Y C;  1YZX A;  1K0M A;  4ZIL A;  5KN3 A;  4HU9 A;  5G5F A;  4OCF A;  2AHE A;  1THX A;  16GS A;  4X0X A;  1EOG A;  2R6K A;  5GAN D;  3ZMK A;  3GTU B;  3ZVJ D;  2VLU A;  3EE2 A;  3L9U A;  2CVD A;  1SJ6 A;  5HFI A;  4EF0 A;  2GST A;  5CAX A;  2P5R A;  1QXH A;  2RUF A;  5DDL A;  3QFB C;  2YWI A;  5DAK B;  1ZGN A;  2K9F A;  4FYU A;  1GNW A;  5F8B A;  2FD3 A;  2OE1 A;  2VM1 A;  3QR6 A;  4GSN A;  2X8C A;  5IO2 A;  2H19 A;  3I43 A;  2DSA A;  4N10 A;  3A5W A;  3RPP A;  3D22 A;  5J41 A;  3VUR A;  4TW5 A;  3BOA A;  1T3B A;  2VO4 A;  4D73 A;  2IFQ B;  2VCT A;  4KH7 A;  2ES7 A;  1GSY A;  5EY6 A;  5D9W A;  1GH2 A;  3L9S A;  4V2M A;  3MAK A;  4DVC A;  3FR3 A;  5FT3 A;  4NPB A;  1TRW A;  2R3X A;  1VGL A;  2OE3 A;  3IK9 A;  3HA9 A;  5EL8 A;  4KSO A;  1ZL9 A;  3ERW A;  2PVQ A;  4IVF A;  4K6X A;  2C3Q A;  2MZC A;  1GTI A;  1O8X A;  1G7O A;  2TIR A;  2FUG 2;  3RHC A;  3LQ7 A;  4Q5N A;  1PSQ A;  3VFI A;  1MDI A;  1NHY A;  3DIE A;  4KDY A;  4EVM A;  1BG5 A;  1Y25 A;  3IK7 A;  3KZQ A;  2BJX A;  1XCC A;  3DYR A;  1PA3 A;  2YP6 A;  2C8U A;  1N8J A;  1G6W A;  1N2A A;  5L71 A;  3TJK A;  5ECI B;  3DRN A;  4EO3 A;  1SYX A;  5CO3 A;  1EEJ A;  1T8E B;  4HUA A;  1GL8 A;  5GAP D;  2VIM A;  3H4K A;  3TKS A;  2VLT A;  1A0R P;  2BTO T;  4LLR A;  3TCO A;  5ENU A;  5F05 A;  4F03 A;  2DIZ A;  1WMJ A;  2LJR A;  6GSY A;  2VL2 C;  3A2W A;  3ZYW A;  3IHQ A;  4TR0 A;  3HJM A;  3TKR A;  4TXO A;  2L5L A;  3KIJ A;  3I69 A;  2B5E A;  4WET A;  2WRT A;  4FIW A;  3ZRE A;  3FZ9 A;  4I97 A;  2NPB A;  1XBS A;  4FH8 A;  1A0F A;  3GH6 A;  4PQH A;  4ZB9 A;  2LQO A;  3BBY A;  4IW9 A;  1A2L A;  3C71 A;  3U6V A;  2X8G A;  1TK8 B;  2YN1 A;  4V1A p;  2R37 A;  5IOW A;  4ECC A;  4F9Z A;  3ERF A;  2YZU A;  3EU4 A;  3IDV A;  4KAE A;  3F6F A;  2KP2 A;  2RM6 A;  2JU5 A;  3TDG A;  1K0C A;  3GST A;  1NSW A;  4LL4 B;  3SBC A;  2GT6 A;  1B8X A;  5KN0 A;  2CVB A;  1RQM A;  3QAW A;  5HR2 A;  5ECH B;  1FVJ A;  4JZQ A;  1T00 A;  6GST A;  2FA4 A;  1ZYE A;  2EIO A;  2H30 A;  4GRF A;  2LKU A;  4YQM A;  1XVW A;  4YQU A;  4NHW A;  3CRT A;  3OR5 A;  3TJB A;  3PR8 A;  1F9M A;  3F3R A;  1UN2 A;  3GX8 A;  4L8E A;  1A2M A;  4POM A;  1F3A A;  2F51 A;  1XOA A;  2CX3 A;  1OVN A;  4GF0 A;  2ZCT A;  3GUR A;  3GA4 A;  1U6T A;  1V57 A;  4OD7 A;  1VF1 A;  4PNF A;  4YAP A;  3KD0 A;  1ERV A;  4KX4 A;  2VCZ A;  4XS4 B;  3FZ5 A;  4I5Q A;  4OCE A;  1SKS B;  2XPE A;  4L5O A;  3TUE A;  1XWB A;  14GS A;  3EYT A;  2C0G A;  4WBR D;  2F3M A;  4Q5Q A;  3FYG A;  4IEL A;  2WZ9 A;  3W6G A;  4GTU A;  2GQM A;  1U87 A;  2VL9 A;  3TKS E;  3KJY A;  1WOU A;  2BMX A;  1ERU A;  1EEM A;  2FCH A;  3GHA A;  4ZIJ A;  1RW1 A;  1R5A A;  4MZC A;  2RII A;  4GXZ A;  3DEX A;  2C0E A;  3GH9 A;  2GS3 A;  2ON5 A;  1O73 A;  4MA9 A;  1DE1 A;  2TRC P;  2DLX A;  4J56 E;  3GRX A;  1FG4 A;  2VAF A;  2PVO C;  2WGR A;  3LYP A;  4NWY A;  3J7Y b;  1WRY A;  2C3T A;  1ERW A;  4V1A g;  3WYW A;  4DSR A;  2I1U A;  2E7P A;  2L6C A;  2OA7 A;  2GZY A;  2VCV A;  3FK8 A;  1DBY A;  1TDI A;  5IMZ A;  3ZML A;  3W8S A;  3WGX A;  3N9J A;  4AJ8 A;  2H0H A;  2GGT A;  1PGT A;  1TU7 A;  2OKA A;  1A2J A;  3UJ1 A;  3O76 A;  1T7P B;  17GS A;  3O6T A;  3HHV A;  2YOI A;  3HCZ A;  2B1K A;  3HVX A;  1M2B A;  1X0R A;  1XIY A;  4E8H A;  2PMT A;  3EMP A;  3TRX A;  1EP7 A;  1SEN A;  4K8M A;  5ELG A;  1A8L A;  4KCE A;  1SJI A;  4L0U A;  1OC3 A;  2GT5 A;  5E59 A;  2H66 A;  4MPG A;  2JAD A;  1TXX A;  2HT9 A;  4Z7X A;  2V41 A;  3SWL A;  1LU4 A;  2DJ2 A;  2WCI A;  3UL3 A;  4ML6 A;  4XIH A;  2D2Z A;  4PNG A;  1H4O A;  4TN8 A;  2DC5 A;  3VWU A;  5JCW A;  4MPF A;  1M0U A;  2M72 A;  3L0H A;  1W89 A;  3GL5 A;  3KTB A;  2OAC A;  2YWM A;  3E9J B;  1HNA A;  1G6Y A;  5HFG A;  3HDC A;  4N0Z A;  2C4J A;  1X9M B;  1K0A A;  4OFM A;  4RI6 A;  12GS A;  1F2E A;  5G31 A;  4IQA A;  1GNE A;  5D8I A;  3MNG A;  1TJD A;  3LGC A;  4QL7 A;  4CW9 A;  2GLR A;  2H73 A;  3TJG A;  1DSB A;  1MDK A;  3ZTL A;  2F8F A;  2MBS A;  4HJM A;  1XW6 A;  5CRD A;  2XBQ A;  3F0I A;  4BL7 A;  2CVK A;  2GQK A;  1U3I A;  5F07 A;  4HJ2 A;  2HRN A;  2HZE B;  3F6D A;  3G7I A;  2PN8 A;  4ECB A;  3A2V A;  5CRG A;  4KGI A;  4MJB A;  6GSX A;  3IOS A;  5AN1 A;  4RI7 A;  2JSY A;  2LNT A;  4MLY A;  2PGT A;  3GV1 A;  4BVY A;  4MJE A;  4EC0 A;  1X9S B;  1AAZ A;  1TRU A;  4V2N A;  2AYT A;  5HR1 A;  2VD0 A;  3AY8 A;  3VPT A;  3DWV A;  3VLN A;  3IAM 2;  3UEM A;  4GWR A;  1RK4 A;  4L0W A;  5J5N A;  2E2M A;  1PKW A;  2E2G A;  5FWG A;  3KXO A;  4K2D A;  1OKD A;  3CSI A;  2B3S A;  22GS A;  3GKN A;  3QPM A;  1WWJ A;  2QC7 A;  1MD3 A;  1KNG A;  4BWQ A;  3RPN A;  2MMN A;  4G2E A;  4JRR A;  4XS6 A;  1KEB A;  1SU9 A;  5IMF A;  1EGO A;  4XTS A;  2XC2 A;  4ZL8 A;  1ZMA A;  4NAX A;  2VLV A;  3ZVJ A;  3C1R A;  1XWC A;  2Z9S A;  1CQG A;  2O89 A;  3IR4 A;  3C73 A;  2NTO A;  3UAR A;  1X5C A;  3CMI A;  4RQX A;  5ECN B;  2PBJ A;  1XOB A;  1Z7R A;  2CAQ A;  3UAP A;  3KMO A;  4AJ7 A;  3V1W A;  4TRX A;  2IMD A;  5AIX A;  3IV4 A;  3VI5 A;  2X8H A;  3ZL5 A;  3H8Q A;  3GTU A;  4KB3 A;  1JLW A;  1ZOF A;  3P7X A;  4ZB6 A;  3PIN A;  3LEF A;  2HFD A;  3PH9 A;  2G0F A;  5A4V A;  5DAK A;  2IJY A;  2I4A A;  2DMM A;  2J23 A;  2J9H A;  1J0F A;  3APQ A;  1TI1 A;  3IAS 2;  1JHB A;  2YZH A;  4HDE A;  3ZRD A;  5DQS A;  4GQC A;  1I5G A;  5J4U A;  3CTF A;  3I9V 2;  4IN0 A;  4NMU A;  1XW9 A;  2VCQ A;  4HEA 2;  1UVZ A;  4HZ4 A;  2IFQ A;  1SD9 A;  1M9A A;  3UVH A;  1F6M C;  1NW2 A;  1YEX A;  2R4V A;  2L5O A;  1PX6 A;  2TRX A;  1ZCP A;  3Q18 A;  4N30 A;  1K0D A;  1VF2 A;  3ZIT A;  2JAC A;  3F4R A;  2H72 A;  2KUC A;  3ZIJ A;  3EU3 A;  1SKR B;  3EWL A;  5ECP B;  4OFT A;  1BX9 A;  3Q6O A;  5ECQ B;  1AUC A;  3VWV A;  2LRN A;  4BVX A;  3LYK A;  3D4M A;  3D4T A;  1YEP A;  3FY7 A;  5HQP A;  2HNL A;  2KHP A;  3M1G A;  1MD4 A;  2PU9 C;  1OC9 A;  5IMA A;  2H74 A;  1WJK A;  1TKD B;  3QOU A;  6GSV A;  3W8J A;  3D21 A;  3G7J A;  1K0B A;  3FR6 A;  1JZD A;  3GKX A;  4DSQ A;  3HVS A;  5D9X A;  3GN3 A;  4ISD A;  5CYY A;  3CTG A;  3F4S A;  1AQX A;  5KN2 A;  5E4W A;  1BYE A;  4TXO B;  4JU5 A;  4NV2 A;  4AJ6 A;  5LCZ A;  1SK2 A;  5CRW A;  2RUE A;  1THO A;  1UA5 A;  5IMC A;  5AIS A;  1GP1 A;  4XCS A;  5B8B A;  1S3D A;  4O7H A;  1PMT A;  3EMX A;  2IIY A;  4LA1 A;  5JWO B;  4Q5R A;  2H8L A;  2RM5 A;  1GTB A;  4IS0 A;  3QMX A;  2B1L A;  4KSM A;  1HNC A;  1GSS A;  2X99 A;  3BJ5 A;  2PUK C;  1QK8 A;  2A2R A;  4ZXG A;  5DCH A;  1PD2 1;  5DQY A;  4EE0 A;  5EVO A;  5DJL A;  2JSZ A;  1TRS A;  1O85 A;  2L4C A;  5KEJ A;  4G19 A;  2V6O A;  3TKS C;  2GDR A;  4GQF A;  1A23 A;  2EIR A;  4V2L A;  3BCI A;  1EV4 A;  2N5B A;  1V98 A;  2XHF A;  3Q74 A;  5B6N A;  4AF2 A;  2FWF A;  5G1L A;  4MP4 A;  1HYU A;  1GRX A;  4DEJ A;  2B7K A;  3WT1 A;  4NXI A;  1YDK A;  2I9H A;  1URM A;  4RUV A;  5J9B A;  4ZBA A;  2C80 A;  5A4W A;  2H1D A;  1OYJ A;  3ME8 A;  3KH7 A;  2IPA A;  2XBI A;  4PQI A;  2ZNM A;  1GTA A;  1BAY A;  2H1G A;  5CRH A;  3KM6 A;  1GSD A;  5J9C A;  1SL0 B;  1SL2 B;  2HLS A;  2GZZ A;  4IJ3 A;  5HR3 A;  1YF1 A;  2CAI A;  3VWX A;  5J3R A;  3RDW A;  2VCX A;  2AUV A;  4TXV A;  3ED3 A;  3EVI A;  5GSS A;  4MH2 A;  3GYK A;  8GSS A;  5D73 A;  5EPF A;  4IQ1 A;  3A2X A;  3F3Q A;  3H79 A;  5ECK B;  2M80 A;  5AIV A;  1XXU A;  2H75 A;  3TJJ A;  3HVV A;  1Z6N A;  1EZK A;  1O81 A;  1U3A A;  3D5J A;  4LMW A;  2LJK A;  1VRS D;  5HFK A;  2OBI A;  3ZFL A;  2REM A;  4I8B A;  1T1V A;  2FWH A;  2GZP A;  1PQN A;  1O8W A;  2O87 A;  4POB A;  3M9K A;  3Q19 A;  3GL3 A;  2LUS A;  2KP1 A;  4XRD A;  3WD6 A;  3TRP A;  11GS A;  2ZUP A;  4XS4 A;  3PGT A;  3QCP A;  2FA8 A;  1R4W A;  1GUK A;  2CX4 A;  1ABA A;  1B4Q A;  4XS1 A;  5F0G A;  3S9F A;  4MMM A;  5D9T A;  2KOK A;  1G7E A;  1AIU A;  2K6V A;  2A4V A;  2B5X A;  1EGR A;  1Q98 A;  3L9V A;  1FO5 A;  1K3L A;  3DML A;  2KLX A;  3QDN A;  4OWY A;  5C00 A;  3LFL A;  1GUH A;  3GFK A;  4DSS B;  3LXZ A;  3IXR A;  2AAW A;  1TU8 A;  2B6M A;  3TOT A;  4WR4 A;  4EKZ A;  6GSW A;  3H93 A;  4JE1 A;  1PL2 A;  2JZR A;  2L59 A;  4IGJ A;  2HYX A;  4J57 E;  5D9V A;  2OBK A;  4RQR A;  1GTU A;  3TRQ A;  4PUR A;  2P31 A;  4H86 A;  3ZFB A;  1USB A;  5GST A;  4WKW A;  2PWJ A;  2DJJ A;  4OMV A;  3C7M A;  4KCA A;  3GNJ A;  1ILO A;  3FR9 A;  5B7C A;  2H0I A;  1KTE A;  2IWT A;  1GWC A;  3KMN A;  4HQZ A;  2RLI A;  4I2U A;  3IC4 A;  4GST A;  1R26 A;  4KDU A;  3HKR A;  2N5F A;  1BED A;  2LRT A;  2P0G A;  1F3B A;  2LNS A;  1O7U A;  5IM9 A;  4ML1 A;  2E0Q A;  5INY A;  1J9B A;  2R5G A;  4IP6 A;  2EIQ A;  4YQV A;  4HS1 A;  1Y6E A;  1OKT A;  1AC1 A;  1AXD A;  4KUN A;  4TR1 B;  4TVE A;  2VUP A;  1EP8 A;  4MAB A;  1MDJ A;  5JWR B;  5ID2 B;  3DKS A;  4JED A;  2DJK A;  3J7Y k;  4CHS A;  2FWG A;  1Z9H A;  4ZBB A;  4EXJ A;  3I6A A;  3CSJ A;  1U88 A;  3NIV A;  3F4T A;  4MJC A;  2N5A A;  1Q4J A;  3MSZ A;  1J08 A;  1M2A A;  4F2I A;  3GUS A;  5B8A A;  1YJ6 A;  4O5R A;  2CV4 A;  3LG6 A;  2H6Y A;  4NHZ A;  2GSS A;  5H5Q A;  1DE2 A;  4QL9 A;  3G9B A;  4TKY A;  2B5Y A;  1ZYQ B;  2IL3 A;  4L5L A;  3MDK A;  5A4U A;  3UMA A;  1FB6 A;  3HXS A;  2LTK A;  3VWW A;  4ZB8 A;  5DAL B;  2VCW A;  3FRC A;  5JCG A;  4MK3 A;  5ABR A;  1B9X C;  1XPV A;  1CQH A;  1TW9 A;  5D96 A;  4HI7 A;  2FLS A;  3ZLP A;  5LD0 A;  1R7H A;  2CZ3 A;  3G7Y A;  2O8V B;  3RAZ A;  1A8Y A;  2IMF A;  1YY7 A;  2R2J A;  3WGD A;  5DJM A;  1SL1 B;  3TKQ A;  6GSU A;  4FYB A;  3MWH A;  3HJO A;  2F8A A;  2YJ7 A;  1GSU A;  2NDO A;  1NHO A;  4HQS A;  4POK A;  4PGT A;  2GQL A;  3LOR A;  4MZW A;  4LL1 B;  5IMD A;  5D93 A;  3E0U A;  4K7I A;  5ECL B;  4F0B A;  2YJH A;  3C1S A;  3NOF A;  1SK0 A;  5DCG A;  1LJR A;  4MDC A;  5C04 A;  1PKZ A;  2GSR A;  3CRU A;  2ON7 A;  2NBS A;  3EUR A;  4ACS A;  1PRX A;  1TOF A;  5IOX A;  4IKH A;  4D73 B;  1XFL A;  2EC4 A;  1XWG A;  1QQ2 A;  3CYN A;  3EC3 A;  1SD8 A;  3BD2 A;  4ECJ A;  4TR3 A;  5CP1 A;  5FHI A;  2GVP A;  4EL1 A;  1GSE A;  2CT6 A;  2H6X A;  2O7K A;  1AQW A;  1VF4 A;  1GLQ A;  1M7T A;  4IBP A;  4LMV A;  3TB2 A;  2C3N A;  5IPH A;  1VF3 A;  2AB6 A;  2L4Q A;  3HJP A;  4OO5 A;  3F63 A;  4X1U A;  1OAZ A;  4OO4 A;  2H0G A;  3QD9 A;  5DBQ A;  1O6J A;  1FVK A;  5IPG A;  1AW9 A;  5HR0 A;  3CSH A;  3D6I A;  3UVT A;  1YF0 A;  2YCD A;  4MF7 A;  1ST9 A;  1V2A A;  2YWN A;  3IA1 A;  1TI3 A;  3VI7 A;  3DD3 A;  2WB9 A;  3LWA A;  3L78 A;  2F9S A;  2VL2 A;  4MZB A;  1M9B A;  3UBK A;  1M2D A;  3FHK A;  3HD5 A;  3WT2 A;  4KDX A;  4WF5 A;  2YNX A;  3RHB A;  1PL1 A;  2IN3 A;  4G10 A;  4TR4 A;  1OC9 B;  1W4V A;  3DGQ A;  1FHE A;  3P2A A;  4EDY A;  2IMK A;  4OFN A;  2HRF A;  4GLT A;  1JZO A;  3E3E A;  1R5P A;  3GKM A;  2FHE A;  2LS5 A;  4GCI A;  4K1F A;  2CQ9 A;  3UOM A;  3QAG A;  3P8W A;  2DJ0 A;  2MMA A;  5H5R A;  4K7N A;  2O85 A;  3R2Q A;  2H76 A;  1EWX A;  2VD1 A;  2JZS A;  1SJZ A;  4J2F A;  3TGZ A;  3DVW A;  3HYP A;  3O3T A;  4FYC A;  5B6M A;  2JZT A;  1M99 A;  2DJ1 A;  3K8N A;  1V58 A;  19GS A;  3US3 A;  5IQY A;  2DBC A;  1FB0 A;  1ZZY A;  2HZF A;  1FW1 A;  2JL4 A;  3APO A;  1ML6 A;  3QFA C;  1DUG A;  3HZ4 A;  3FKF A;  2HSY A;  1Z7P A;  2H6Z A;  5G2Z A;  2M46 A;  1OC8 A;  1XWK A;  2QGV A;  4XHM A;  1T4Z A;  2CZ2 A;  4MH3 A;  2LST A;  1X5E A;  2H70 A;  2V2G A;  3UBL A;  2FWE A;  2V32 A;  1GUL A;  2DIY A;  1K3O A;  4XRA A;  4IP1 A;  1HNB A;  2LRC A;  2FGX A;  1ACV A;  1TK0 B;  3APS A;  5A5K A;  2HSH A;  3C8E A;  1WE0 A;  4MF6 A;  2HI7 A;  1I9D A;  3HY2 A;  3M9J A;  4QQ7 A;  18GS A;  1K0O A;  4HOJ A;  2VL3 A;  4PUF C;  2DJ3 A;  4CDO A;  2XPD A;  2H01 A;  4I6X A;  4IJI A;  1S3C A;  1V40 A;  3EIN A;  4BPY A;  2WS2 A;  3BCK A;  1Z5Y E;  3IRA A;  3NZN A;  3LSZ A;  1QFN A;  2H1B A;  3GMF A;  1GLP A;  3GIX A;  3CBU A;  1JFU A;  1OE8 A;  3DXB A;  1Z3E A;  4I2T A;  1YKA A;  20GS A;  1A24 A;  1IYI A;  4Q5F A;  2IMI A;  1JLV A;  2QSI A;  1XWA A;  3TJF A;  1X5D A;  3ISO A;  2OAD A;  3KP8 A;  1TP9 A;  3QAV A;  3GSS A;  4X43 A;  4PUA A;  4JR4 A;  1GUM A;  2WJU A;  1Z6M A;  4TOP A;  3IE3 A;  1SYR A;  5ELA A;  1BQ7 A;  2ALB A;  1GSF A;  4K7O A;  3FEU A;  1EOH A;  1PN9 A;  2DML A;  1K3Y A;  1XW5 A;  5COH A;  3M0F A;  2X64 A;  2QKE A;  1LBK A;  1ON4 A;  5IMV A;  5JCU A;  4BWS A;  1UC7 A;  2VOC A;  3GKK A;  1F37 A;  4PXO A;  3KP9 A;  2CA8 A;  2MMZ A;  4JBB A;  1IYH A;  1OE7 A;  1SK1 A;  2WUL A;  9GSS A;  1YKC A;  1FAA A;  5DVB A;  2LEG A;  3ERG A;  3IPZ A;  3CXG A;  1ERT A;  1H75 A;  4EUY A;  4YH2 A;  3P90 A;  2MBT A;  2A2S A;  3H1N A; 
#chains in the Genus database with same CATH topology
 3U5R E;  2NVL A;  4PX1 A;  4ULX A;  4WR5 A;  4K0G A;  3N5O A;  5CRE A;  5G5E A;  2YWO A;  4POL A;  3KGK A;  10GS A;  3VPQ A;  6GSS A;  4DSS A;  1MEK A;  4O92 A;  1WP0 A;  1QUW A;  4ZL7 A;  1XZO A;  3RBT A;  4YAV A;  3KH9 A;  5GZZ B;  3D0Z A;  2VM2 A;  2L6D A;  1TRV A;  3WGE A;  1X9W B;  4BA7 A;  1M3J A;  2FNO A;  4K9Z A;  2HE3 A;  1HD2 A;  4N0V A;  3FZA A;  4ICY A;  2LQQ A;  2I81 A;  1TTZ A;  4YKF A;  5ECS A;  3LJR A;  1JZR A;  1C72 A;  3ME7 A;  2K8S A;  4EDZ A;  2YV7 A;  2V1M A;  1MTC A;  2FY6 A;  4FO5 A;  3KEB A;  2C0D A;  4K0N A;  3M8N A;  3FZ4 A;  5ECO B;  4ZBD A;  2PPT A;  5LNK e;  4E8E A;  1NM3 A;  4KA0 A;  3L4N A;  1BJX A;  4F0C A;  2YV9 A;  2GTU A;  4GSS A;  1E2Y A;  1YQ1 A;  3KCM A;  2AV4 A;  3EPT A;  4HU7 A;  1FOH A;  2OJL A;  3GX0 A;  1QMV A;  1E6B A;  3F8U A;  5IIZ A;  3KTL A;  2H71 A;  5CNW A;  2I3Y A;  2OE0 A;  1KBN A;  4G9H A;  3VK9 A;  5KN1 A;  1G0T A;  4TR1 A;  3UIW A;  4IHU A;  4ID0 A;  4HZ2 A;  3JCM L;  1AQV A;  2C1Y A;  1B4P A;  4ZL9 A;  3TOU A;  4F82 A;  3F9U A;  4NV5 A;  1HQO A;  2K18 A;  5IO0 A;  4JR6 A;  4BL7 B;  1V9W A;  5ID2 A;  1S3A A;  2L57 A;  2LV3 A;  3LXT A;  2WDU A;  5F06 A;  5H5S A;  2V6K A;  2MMO A;  1WIK A;  2LJA A;  1WPI A;  4WXT A;  2YAN A;  2G2Q A;  2B7J A;  1XVQ A;  4MF5 A;  5G1K A;  3DVX A;  4ILF A;  4WEY A;  4AGS A;  2H1A A;  2GSQ A;  5ECM B;  1PX7 A;  1B48 A;  4KE3 A;  4PQ1 A;  1JZW A;  2HXK A;  4KND A;  2MYG A;  1GSQ A;  4MCU A;  4P3Y B;  4N11 A;  3HZ8 A;  2HZE A;  5JWQ B;  5AGY A;  13GS A;  3ZIV A;  3FW2 A;  1T4Y A;  5DAL A;  4O5U A;  1TK5 B;  1EV9 A;  2AJQ B;  2PER A;  4KW6 A;  2P5Q A;  3M3M A;  2R0P A;  2K8V A;  1SKW B;  4WBJ A;  5G30 A;  4MJA A;  3ZZX A;  4ECI A;  1K0N A;  2IME A;  2YPM A;  1QGV A;  3TKP A;  4WF4 A;  7GSS A;  4Z2U A;  4O32 A;  1FOV A;  5ECR B;  2WFC A;  3A3T A;  4PTS A;  3IBH A;  2C0F A;  1B9Y C;  1YZX A;  1K0M A;  4ZIL A;  5KN3 A;  4HU9 A;  5G5F A;  4OCF A;  2AHE A;  1THX A;  16GS A;  4X0X A;  1EOG A;  2R6K A;  5GAN D;  3ZMK A;  3GTU B;  3ZVJ D;  2VLU A;  3EE2 A;  3L9U A;  2CVD A;  1SJ6 A;  5HFI A;  4EF0 A;  2GST A;  5CAX A;  2P5R A;  1QXH A;  2RUF A;  5DDL A;  3QFB C;  2YWI A;  2X4A A;  5DAK B;  1ZGN A;  2K9F A;  4FYU A;  1GNW A;  5F8B A;  2FD3 A;  2OE1 A;  2VM1 A;  3QR6 A;  4GSN A;  2X8C A;  5IO2 A;  1PN0 A;  1ZYP A;  2H19 A;  3I43 A;  2DSA A;  4N10 A;  3A5W A;  3RPP A;  3D22 A;  5J41 A;  3VUR A;  4TW5 A;  3BOA A;  1T3B A;  2VO4 A;  4D73 A;  2IFQ B;  2VCT A;  4KH7 A;  2ES7 A;  1GSY A;  5EY6 A;  5D9W A;  1GH2 A;  3L9S A;  4V2M A;  3MAK A;  4DVC A;  3FR3 A;  5FT3 A;  4NPB A;  1TRW A;  2R3X A;  1VGL A;  2OE3 A;  3IK9 A;  3HA9 A;  5EL8 A;  4KSO A;  1ZL9 A;  3ERW A;  2PVQ A;  4IVF A;  4K6X A;  2C3Q A;  2MZC A;  1GTI A;  1O8X A;  1G7O A;  2TIR A;  2FUG 2;  3RHC A;  3LQ7 A;  4Q5N A;  1PSQ A;  3VFI A;  1MDI A;  1NHY A;  3DIE A;  4KDY A;  4EVM A;  1BG5 A;  1Y25 A;  3IK7 A;  3KZQ A;  2BJX A;  1XCC A;  3DYR A;  1PA3 A;  2YP6 A;  2C8U A;  1N8J A;  1G6W A;  1N2A A;  5L71 A;  3TJK A;  5ECI B;  3DRN A;  4EO3 A;  1SYX A;  5CO3 A;  1EEJ A;  1T8E B;  4HUA A;  1GL8 A;  5GAP D;  2VIM A;  3H4K A;  3TKS A;  2VLT A;  1A0R P;  2BTO T;  4LLR A;  3TCO A;  5ENU A;  5F05 A;  4F03 A;  2DIZ A;  1WMJ A;  2LJR A;  6GSY A;  2VL2 C;  3A2W A;  3ZYW A;  4HSC X;  3IHQ A;  4TR0 A;  3HJM A;  3TKR A;  4TXO A;  2L5L A;  3KIJ A;  3I69 A;  2B5E A;  4WET A;  2WRT A;  4FIW A;  3ZRE A;  3FZ9 A;  4I97 A;  2NPB A;  4YKG A;  1XBS A;  4FH8 A;  1A0F A;  3GH6 A;  3HVN A;  4PQH A;  4ZB9 A;  2LQO A;  3BBY A;  4IW9 A;  1A2L A;  3C71 A;  3U6V A;  2X8G A;  1TK8 B;  2YN1 A;  4V1A p;  2R37 A;  5IOW A;  4ECC A;  4F9Z A;  3ERF A;  2YZU A;  3EU4 A;  3IDV A;  4KAE A;  3F6F A;  2KP2 A;  2RM6 A;  2JU5 A;  3TDG A;  1K0C A;  3GST A;  1NSW A;  4LL4 B;  3SBC A;  2GT6 A;  1B8X A;  5KN0 A;  2CVB A;  1RQM A;  3QAW A;  5HR2 A;  5ECH B;  1FVJ A;  4JZQ A;  1T00 A;  1S3R A;  6GST A;  2FA4 A;  1ZYE A;  2EIO A;  2H30 A;  4GRF A;  2LKU A;  4YQM A;  1XVW A;  4YQU A;  4NHW A;  3CRT A;  4Z2R A;  3OR5 A;  3TJB A;  3PR8 A;  1F9M A;  3F3R A;  1UN2 A;  3GX8 A;  4L8E A;  1A2M A;  4POM A;  1F3A A;  2F51 A;  1XOA A;  2CX3 A;  1OVN A;  4GF0 A;  2ZCT A;  3GUR A;  3GA4 A;  1U6T A;  1V57 A;  4OD7 A;  1VF1 A;  4EIP A;  4PNF A;  4YAP A;  3KD0 A;  1ERV A;  4KX4 A;  2VCZ A;  4XS4 B;  5BMU A;  3FZ5 A;  4I5Q A;  4OCE A;  1SKS B;  2XPE A;  4K5R A;  4L5O A;  3TUE A;  1XWB A;  14GS A;  3EYT A;  2C0G A;  4WBR D;  2F3M A;  4Q5Q A;  3FYG A;  4MNN A;  4IEL A;  2WZ9 A;  2DKI A;  3W6G A;  4GTU A;  2GQM A;  4K2X A;  1U87 A;  2VL9 A;  3R3E A;  3TKS E;  3KJY A;  1WOU A;  2BMX A;  1ERU A;  1EEM A;  2FCH A;  3GHA A;  4ZIJ A;  1RW1 A;  1R5A A;  4MZC A;  2RII A;  4GXZ A;  3DEX A;  2A4H A;  2C0E A;  3GH9 A;  2GS3 A;  2ON5 A;  1O73 A;  4MA9 A;  1DE1 A;  2TRC P;  2DLX A;  4J56 E;  3GRX A;  1FG4 A;  2VAF A;  2PVO C;  2WGR A;  3LYP A;  4NWY A;  3J7Y b;  1WRY A;  2C3T A;  1ERW A;  4V1A g;  3WYW A;  4DSR A;  2I1U A;  2E7P A;  2L6C A;  2OA7 A;  2GZY A;  2VCV A;  3FK8 A;  1DBY A;  1TDI A;  5IMZ A;  3ZML A;  3W8S A;  3WGX A;  3N9J A;  4AJ8 A;  2H0H A;  2GGT A;  1PGT A;  1TU7 A;  2OKA A;  1A2J A;  3UJ1 A;  3O76 A;  1T7P B;  17GS A;  3O6T A;  3HHV A;  2YOI A;  3HCZ A;  2B1K A;  3HVX A;  1M2B A;  1X0R A;  1XIY A;  4E8H A;  2PMT A;  3EMP A;  3TRX A;  1EP7 A;  1SEN A;  4K8M A;  5ELG A;  1A8L A;  1M3I A;  4KCE A;  1SJI A;  1XG8 A;  4L0U A;  1OC3 A;  2GT5 A;  5E59 A;  2H66 A;  4MPG A;  2JAD A;  1TXX A;  2HT9 A;  4Z7X A;  2V41 A;  3SWL A;  1LU4 A;  2DJ2 A;  2WCI A;  3UL3 A;  4ML6 A;  4XIH A;  2D2Z A;  4PNG A;  1H4O A;  4TN8 A;  2DC5 A;  3VWU A;  5JCW A;  4MPF A;  1M0U A;  2M72 A;  3L0H A;  1W89 A;  3GL5 A;  3KTB A;  2OAC A;  2YWM A;  4EIQ A;  3E9J B;  1HNA A;  1G6Y A;  5HFG A;  3HDC A;  4N0Z A;  2C4J A;  1X9M B;  1K0A A;  4OFM A;  4RI6 A;  12GS A;  1F2E A;  5G31 A;  4IQA A;  1GNE A;  5D8I A;  3MNG A;  1TJD A;  2QA2 A;  3LGC A;  4QL7 A;  4CW9 A;  2GLR A;  2H73 A;  3TJG A;  1DSB A;  1MDK A;  3ZTL A;  2F8F A;  2MBS A;  4HJM A;  4BIK A;  1XW6 A;  5CRD A;  2XBQ A;  3F0I A;  4BL7 A;  2CVK A;  2GQK A;  1U3I A;  5F07 A;  4HJ2 A;  2HRN A;  2HZE B;  3F6D A;  3G7I A;  2PN8 A;  4ECB A;  3A2V A;  5CRG A;  4KGI A;  4MJB A;  6GSX A;  3IOS A;  5AN1 A;  4RI7 A;  2JSY A;  2LNT A;  4MLY A;  2PGT A;  3GV1 A;  4BVY A;  4MJE A;  4EC0 A;  1X9S B;  4K5S A;  3FMW A;  4USS A;  1AAZ A;  1TRU A;  4V2N A;  2AYT A;  5HR1 A;  4O5Q A;  2VD0 A;  3AY8 A;  3VPT A;  3DWV A;  3VLN A;  3IAM 2;  3UEM A;  4GWR A;  1RK4 A;  4L0W A;  5J5N A;  2E2M A;  1PKW A;  2E2G A;  5FWG A;  3KXO A;  4K2D A;  1OKD A;  3CSI A;  2B3S A;  22GS A;  3GKN A;  3QPM A;  4KF9 A;  1WWJ A;  2QC7 A;  1MD3 A;  1KNG A;  4BWQ A;  3RPN A;  2MMN A;  4G2E A;  4JRR A;  4XS6 A;  1KEB A;  1SU9 A;  5IMF A;  1EGO A;  4XTS A;  2XC2 A;  4ZL8 A;  1ZMA A;  4NAX A;  2VLV A;  3ZVJ A;  3C1R A;  1XWC A;  2Z9S A;  1CQG A;  2O89 A;  3IR4 A;  3C73 A;  2NTO A;  3UAR A;  1X5C A;  3CMI A;  4RQX A;  5ECN B;  2PBJ A;  1XOB A;  1Z7R A;  2CAQ A;  3UAP A;  3KMO A;  4AJ7 A;  3V1W A;  4TRX A;  2IMD A;  5AIX A;  3IV4 A;  3VI5 A;  2X8H A;  3ZL5 A;  3H8Q A;  3GTU A;  4KB3 A;  1JLW A;  1ZOF A;  3P7X A;  4ZB6 A;  3PIN A;  3LEF A;  2HFD A;  3PH9 A;  2G0F A;  5A4V A;  5DAK A;  2IJY A;  2I4A A;  2DMM A;  2J23 A;  2J9H A;  1J0F A;  3APQ A;  1TI1 A;  3IAS 2;  4FQU A;  1JHB A;  2YZH A;  4HDE A;  3ZRD A;  5DQS A;  4GQC A;  1I5G A;  5J4U A;  3CTF A;  3I9V 2;  4IN0 A;  4NMU A;  1XW9 A;  2VCQ A;  4HEA 2;  1UVZ A;  4HZ4 A;  2IFQ A;  1SD9 A;  1M9A A;  3UVH A;  1F6M C;  1NW2 A;  1YEX A;  2R4V A;  2L5O A;  1PX6 A;  2TRX A;  1ZCP A;  3Q18 A;  4N30 A;  1K0D A;  1VF2 A;  3ZIT A;  2JAC A;  3F4R A;  2H72 A;  2KUC A;  3ZIJ A;  3EU3 A;  1SKR B;  3EWL A;  5ECP B;  4OFT A;  1BX9 A;  3Q6O A;  5ECQ B;  1AUC A;  3VWV A;  2LRN A;  4BVX A;  3LYK A;  3D4M A;  3D4T A;  1YEP A;  3FY7 A;  5HQP A;  2HNL A;  2KHP A;  3M1G A;  1MD4 A;  2PU9 C;  1OC9 A;  4G0K A;  5IMA A;  3IC8 A;  2H74 A;  1WJK A;  1TKD B;  3QOU A;  6GSV A;  3W8J A;  3D21 A;  3G7J A;  1K0B A;  3FR6 A;  1JZD A;  3GKX A;  4DSQ A;  3HVS A;  5D9X A;  3GN3 A;  4ISD A;  5CYY A;  3CTG A;  3F4S A;  1AQX A;  5KN2 A;  5E4W A;  1BYE A;  4TXO B;  4JU5 A;  4NV2 A;  4AJ6 A;  5LCZ A;  1SK2 A;  5CRW A;  2RUE A;  1THO A;  1UA5 A;  5IMC A;  5AIS A;  1GP1 A;  4XCS A;  5B8B A;  1S3D A;  4O7H A;  1PMT A;  3EMX A;  2IIY A;  4LA1 A;  5JWO B;  4Q5R A;  2H8L A;  2RM5 A;  1GTB A;  4IS0 A;  3QMX A;  2B1L A;  4KSM A;  1HNC A;  1GSS A;  2X99 A;  3BJ5 A;  2PUK C;  1QK8 A;  2A2R A;  4ZXG A;  5DCH A;  1PD2 1;  5DQY A;  4EE0 A;  5EVO A;  5DJL A;  2JSZ A;  1TRS A;  1O85 A;  2L4C A;  5KEJ A;  4G19 A;  2V6O A;  3TKS C;  2GDR A;  4GQF A;  1A23 A;  2EIR A;  4V2L A;  3BCI A;  1EV4 A;  3CQF A;  2N5B A;  1V98 A;  2XHF A;  3Q74 A;  5B6N A;  4AF2 A;  2FWF A;  5G1L A;  4MP4 A;  4G0L A;  1HYU A;  1GRX A;  4DEJ A;  2B7K A;  3WT1 A;  4NXI A;  1YDK A;  2I9H A;  1URM A;  4RUV A;  5J9B A;  4ZBA A;  2C80 A;  5A4W A;  2H1D A;  1OYJ A;  3ME8 A;  3KH7 A;  2IPA A;  2XBI A;  4PQI A;  2ZNM A;  1GTA A;  1BAY A;  2H1G A;  5CRH A;  3KM6 A;  1GSD A;  5J9C A;  1SL0 B;  1SL2 B;  2HLS A;  2GZZ A;  4IJ3 A;  5HR3 A;  1YF1 A;  2CAI A;  3VWX A;  5J3R A;  3RDW A;  2QA1 A;  2VCX A;  2AUV A;  4TXV A;  3ED3 A;  3EVI A;  5GSS A;  4MH2 A;  3GYK A;  8GSS A;  5D73 A;  5EPF A;  4IQ1 A;  3A2X A;  3F3Q A;  3H79 A;  5ECK B;  2M80 A;  5AIV A;  1XXU A;  2H75 A;  3TJJ A;  3HVV A;  1Z6N A;  1EZK A;  1O81 A;  1U3A A;  3MYD A;  3D5J A;  3LW9 A;  4LMW A;  2LJK A;  1VRS D;  5HFK A;  2OBI A;  3ZFL A;  2REM A;  4I8B A;  1T1V A;  2FWH A;  2GZP A;  1PQN A;  1O8W A;  2O87 A;  4POB A;  3M9K A;  3Q19 A;  3GL3 A;  2LUS A;  2KP1 A;  4XRD A;  3WD6 A;  3TRP A;  11GS A;  2ZUP A;  4XS4 A;  3PGT A;  3QCP A;  2FA8 A;  1R4W A;  1GUK A;  2CX4 A;  1ABA A;  1B4Q A;  4XS1 A;  5F0G A;  3S9F A;  4MMM A;  5D9T A;  2KOK A;  1G7E A;  1AIU A;  2K6V A;  2A4V A;  2B5X A;  1EGR A;  1Q98 A;  3L9V A;  1FO5 A;  1K3L A;  3DML A;  2KLX A;  3QDN A;  4OWY A;  5C00 A;  3LFL A;  1GUH A;  3GFK A;  4DSS B;  3LXZ A;  3IXR A;  2AAW A;  1TU8 A;  2B6M A;  3TOT A;  4WR4 A;  4EKZ A;  6GSW A;  3H93 A;  4JE1 A;  1PL2 A;  2JZR A;  2L59 A;  4IGJ A;  2HYX A;  4J57 E;  5D9V A;  2OBK A;  4RQR A;  1GTU A;  3TRQ A;  4PUR A;  2P31 A;  4H86 A;  3ZFB A;  1USB A;  5GST A;  4WKW A;  2PWJ A;  2DJJ A;  2A2P A;  4OMV A;  3C7M A;  4KCA A;  3GNJ A;  1ILO A;  3FR9 A;  5B7C A;  2H0I A;  1KTE A;  2IWT A;  1GWC A;  3KMN A;  4HQZ A;  2RLI A;  4I2U A;  3IC4 A;  4GST A;  1R26 A;  4KDU A;  3HKR A;  2N5F A;  1BED A;  2LRT A;  2P0G A;  1F3B A;  2LNS A;  1O7U A;  5IM9 A;  4ML1 A;  2E0Q A;  5INY A;  1J9B A;  2R5G A;  4IP6 A;  2EIQ A;  4YQV A;  4HS1 A;  1Y6E A;  1OKT A;  1AC1 A;  1AXD A;  4KUN A;  4TR1 B;  4TVE A;  2HRK A;  2VUP A;  1EP8 A;  4MAB A;  1MDJ A;  5JWR B;  5ID2 B;  3DKS A;  4JED A;  2DJK A;  3J7Y k;  4CHS A;  3PPU A;  2FWG A;  2R0C A;  1Z9H A;  4ZBB A;  4EXJ A;  3I6A A;  3CSJ A;  1U88 A;  3NIV A;  3F4T A;  4MJC A;  2N5A A;  1Q4J A;  3MSZ A;  1J08 A;  1M2A A;  4F2I A;  3GUS A;  5B8A A;  1YJ6 A;  4O5R A;  3MIX A;  2CV4 A;  3LG6 A;  2H6Y A;  4NHZ A;  2GSS A;  5H5Q A;  1DE2 A;  4QL9 A;  3G9B A;  4TKY A;  2B5Y A;  1ZYQ B;  2IL3 A;  4L5L A;  3MDK A;  5A4U A;  3UMA A;  1FB6 A;  4A5P A;  3HXS A;  1ZYN A;  2LTK A;  3VWW A;  4ZB8 A;  4BVY B;  5DAL B;  2VCW A;  3FRC A;  5JCG A;  4MK3 A;  5ABR A;  1B9X C;  1XPV A;  1CQH A;  1TW9 A;  5D96 A;  4HI7 A;  2FLS A;  3ZLP A;  5LD0 A;  1R7H A;  2CZ3 A;  3G7Y A;  2O8V B;  3RAZ A;  1A8Y A;  2IMF A;  1YY7 A;  2R2J A;  3WGD A;  5DJM A;  1SL1 B;  3TKQ A;  6GSU A;  4FYB A;  1PFO A;  3MWH A;  3HJO A;  2F8A A;  2YJ7 A;  1GSU A;  2NDO A;  1NHO A;  4HQS A;  4POK A;  4PGT A;  3IHG A;  2GQL A;  3LOR A;  4MZW A;  4LL1 B;  5IMD A;  5D93 A;  3E0U A;  4K7I A;  5ECL B;  4F0B A;  2YJH A;  3C1S A;  3NOF A;  1SK0 A;  5DCG A;  1LJR A;  4MDC A;  5C04 A;  1PKZ A;  2GSR A;  3CRU A;  2ON7 A;  2NBS A;  3EUR A;  4ACS A;  1PRX A;  1TOF A;  5IOX A;  4IKH A;  4D73 B;  1XFL A;  2EC4 A;  1XWG A;  1QQ2 A;  3CYN A;  3EC3 A;  1SD8 A;  3BD2 A;  4ECJ A;  4TR3 A;  5CP1 A;  5FHI A;  2GVP A;  4EL1 A;  1GSE A;  2CT6 A;  2H6X A;  2O7K A;  1AQW A;  1VF4 A;  1GLQ A;  1M7T A;  4IBP A;  4LMV A;  3TB2 A;  2C3N A;  5IPH A;  1VF3 A;  2AB6 A;  2L4Q A;  3HJP A;  4OO5 A;  3F63 A;  4X1U A;  1OAZ A;  4OO4 A;  2H0G A;  3QD9 A;  5DBQ A;  1O6J A;  1FVK A;  5IPG A;  1AW9 A;  5HR0 A;  3CSH A;  3D6I A;  3UVT A;  1YF0 A;  2YCD A;  4MF7 A;  1ST9 A;  4X4J A;  1V2A A;  2YWN A;  3IA1 A;  1TI3 A;  3VI7 A;  3DD3 A;  2WB9 A;  3LWA A;  3L78 A;  2F9S A;  2VL2 A;  4MZB A;  1M9B A;  3UBK A;  1M2D A;  4BVX B;  3FHK A;  3HD5 A;  3WT2 A;  4KDX A;  4WF5 A;  2YNX A;  3RHB A;  1PL1 A;  2IN3 A;  4G10 A;  4TR4 A;  1OC9 B;  1W4V A;  3DGQ A;  1FHE A;  2DKH A;  3P2A A;  2IMK A;  4EDY A;  4OFN A;  2HRF A;  4GLT A;  1JZO A;  3E3E A;  1R5P A;  3GKM A;  2FHE A;  2LS5 A;  4GCI A;  4K1F A;  2CQ9 A;  3UOM A;  3QAG A;  3P8W A;  2DJ0 A;  2MMA A;  4CY8 A;  5H5R A;  4K7N A;  2O85 A;  3R2Q A;  2H76 A;  1EWX A;  2VD1 A;  4CY6 A;  2JZS A;  1SJZ A;  4J2F A;  3TGZ A;  3DVW A;  3HYP A;  3O3T A;  4FYC A;  5KOX A;  5B6M A;  2JZT A;  1M99 A;  2DJ1 A;  3K8N A;  1V58 A;  19GS A;  3US3 A;  2HRA A;  5IQY A;  2DBC A;  1FB0 A;  1ZZY A;  2HZF A;  2R0G A;  1FW1 A;  2JL4 A;  3APO A;  1ML6 A;  3QFA C;  4G0I A;  1DUG A;  3HZ4 A;  3FKF A;  2HSY A;  1Z7P A;  2H6Z A;  2UZ8 A;  5G2Z A;  2M46 A;  1OC8 A;  1XWK A;  2QGV A;  4XHM A;  1T4Z A;  2CZ2 A;  4MH3 A;  3A5I A;  2LST A;  1X5E A;  2H70 A;  2V2G A;  3UBL A;  2FWE A;  2V32 A;  1GUL A;  2DIY A;  1K3O A;  4XRA A;  4Z2T A;  4IP1 A;  1HNB A;  2LRC A;  2FGX A;  1ACV A;  1TK0 B;  3APS A;  5A5K A;  2HSH A;  3C8E A;  1WE0 A;  4MF6 A;  2HI7 A;  1I9D A;  3HY2 A;  3M9J A;  4QQ7 A;  18GS A;  1K0O A;  4HOJ A;  2VL3 A;  4PUF C;  2DJ3 A;  4CDO A;  2XPD A;  2H01 A;  4I6X A;  4IJI A;  1S3C A;  1V40 A;  3EIN A;  4BPY A;  2WS2 A;  3BCK A;  1Z5Y E;  3IRA A;  3NZN A;  3LSZ A;  1QFN A;  2H1B A;  3GMF A;  1GLP A;  3GIX A;  3CBU A;  5BRT A;  1JFU A;  1OE8 A;  3DXB A;  1Z3E A;  4I2T A;  1YKA A;  20GS A;  1A24 A;  1IYI A;  4Q5F A;  2IMI A;  1JLV A;  2QSI A;  1XWA A;  3TJF A;  1X5D A;  3ISO A;  2OAD A;  3KP8 A;  1TP9 A;  3QAV A;  3GSS A;  4X43 A;  4PUA A;  4JR4 A;  1GUM A;  2WJU A;  1Z6M A;  4TOP A;  3IE3 A;  2HSM A;  1SYR A;  5ELA A;  1BQ7 A;  2ALB A;  1GSF A;  4K7O A;  3FEU A;  1EOH A;  1PN9 A;  2DML A;  1K3Y A;  1XW5 A;  5COH A;  5KOW A;  3M0F A;  2X64 A;  2X49 A;  2QKE A;  1LBK A;  1ON4 A;  5IMV A;  5JCU A;  4BWS A;  1UC7 A;  2VOC A;  3GKK A;  1F37 A;  4PXO A;  3KP9 A;  2CA8 A;  2MMZ A;  4JBB A;  1IYH A;  1OE7 A;  1SK1 A;  2WUL A;  9GSS A;  1YKC A;  1FAA A;  5DVB A;  2LEG A;  3ERG A;  3IPZ A;  3CXG A;  1ERT A;  1H75 A;  4EUY A;  4YH2 A;  3P90 A;  2MBT A;  2A2S A;  3H1N A; 
#chains in the Genus database with same CATH homology
 3U5R E;  2NVL A;  4PX1 A;  4ULX A;  4WR5 A;  4K0G A;  3N5O A;  5CRE A;  5G5E A;  2YWO A;  4POL A;  3KGK A;  10GS A;  3VPQ A;  6GSS A;  4DSS A;  1MEK A;  4O92 A;  1WP0 A;  1QUW A;  4ZL7 A;  1XZO A;  3RBT A;  4YAV A;  3KH9 A;  5GZZ B;  3D0Z A;  2VM2 A;  2L6D A;  1TRV A;  3WGE A;  1X9W B;  4BA7 A;  2FNO A;  4K9Z A;  2HE3 A;  1HD2 A;  4N0V A;  3FZA A;  4ICY A;  2LQQ A;  2I81 A;  1TTZ A;  4YKF A;  5ECS A;  3LJR A;  1JZR A;  1C72 A;  3ME7 A;  2K8S A;  4EDZ A;  2YV7 A;  2V1M A;  1MTC A;  2FY6 A;  4FO5 A;  3KEB A;  2C0D A;  4K0N A;  3M8N A;  3FZ4 A;  5ECO B;  4ZBD A;  2PPT A;  5LNK e;  4E8E A;  1NM3 A;  4KA0 A;  3L4N A;  1BJX A;  4F0C A;  2YV9 A;  2GTU A;  4GSS A;  1E2Y A;  1YQ1 A;  3KCM A;  2AV4 A;  3EPT A;  4HU7 A;  1FOH A;  2OJL A;  3GX0 A;  1QMV A;  1E6B A;  3F8U A;  5IIZ A;  3KTL A;  2H71 A;  5CNW A;  2I3Y A;  2OE0 A;  1KBN A;  4G9H A;  3VK9 A;  5KN1 A;  1G0T A;  4TR1 A;  3UIW A;  4IHU A;  4ID0 A;  4HZ2 A;  3JCM L;  1AQV A;  2C1Y A;  1B4P A;  4ZL9 A;  3TOU A;  4F82 A;  3F9U A;  4NV5 A;  1HQO A;  2K18 A;  5IO0 A;  4JR6 A;  4BL7 B;  1V9W A;  5ID2 A;  1S3A A;  2L57 A;  2LV3 A;  3LXT A;  2WDU A;  5F06 A;  5H5S A;  2V6K A;  2MMO A;  1WIK A;  2LJA A;  1WPI A;  4WXT A;  2YAN A;  2G2Q A;  2B7J A;  1XVQ A;  4MF5 A;  5G1K A;  3DVX A;  4ILF A;  4WEY A;  4AGS A;  2H1A A;  2GSQ A;  5ECM B;  1PX7 A;  1B48 A;  4KE3 A;  4PQ1 A;  1JZW A;  2HXK A;  4KND A;  2MYG A;  1GSQ A;  4MCU A;  4P3Y B;  4N11 A;  3HZ8 A;  2HZE A;  5JWQ B;  5AGY A;  13GS A;  3ZIV A;  3FW2 A;  1T4Y A;  5DAL A;  4O5U A;  1TK5 B;  1EV9 A;  2AJQ B;  2PER A;  4KW6 A;  2P5Q A;  3M3M A;  2R0P A;  2K8V A;  1SKW B;  4WBJ A;  5G30 A;  4MJA A;  3ZZX A;  4ECI A;  1K0N A;  2IME A;  2YPM A;  1QGV A;  3TKP A;  4WF4 A;  7GSS A;  4Z2U A;  4O32 A;  1FOV A;  5ECR B;  2WFC A;  3A3T A;  4PTS A;  3IBH A;  2C0F A;  1B9Y C;  1YZX A;  1K0M A;  4ZIL A;  5KN3 A;  4HU9 A;  5G5F A;  4OCF A;  2AHE A;  1THX A;  16GS A;  4X0X A;  1EOG A;  2R6K A;  5GAN D;  3ZMK A;  3GTU B;  3ZVJ D;  2VLU A;  3EE2 A;  3L9U A;  2CVD A;  1SJ6 A;  5HFI A;  4EF0 A;  2GST A;  5CAX A;  2P5R A;  1QXH A;  2RUF A;  5DDL A;  3QFB C;  2YWI A;  2X4A A;  5DAK B;  1ZGN A;  2K9F A;  4FYU A;  1GNW A;  5F8B A;  2FD3 A;  2OE1 A;  2VM1 A;  3QR6 A;  4GSN A;  2X8C A;  5IO2 A;  1PN0 A;  1ZYP A;  2H19 A;  3I43 A;  2DSA A;  4N10 A;  3A5W A;  3RPP A;  3D22 A;  5J41 A;  3VUR A;  4TW5 A;  3BOA A;  1T3B A;  2VO4 A;  4D73 A;  2IFQ B;  2VCT A;  4KH7 A;  2ES7 A;  1GSY A;  5EY6 A;  5D9W A;  1GH2 A;  3L9S A;  4V2M A;  3MAK A;  4DVC A;  3FR3 A;  5FT3 A;  4NPB A;  1TRW A;  2R3X A;  1VGL A;  2OE3 A;  3IK9 A;  3HA9 A;  5EL8 A;  4KSO A;  1ZL9 A;  3ERW A;  2PVQ A;  4IVF A;  4K6X A;  2C3Q A;  2MZC A;  1GTI A;  1O8X A;  1G7O A;  2TIR A;  2FUG 2;  3RHC A;  3LQ7 A;  4Q5N A;  1PSQ A;  3VFI A;  1MDI A;  1NHY A;  3DIE A;  4KDY A;  4EVM A;  1BG5 A;  1Y25 A;  3IK7 A;  3KZQ A;  2BJX A;  1XCC A;  3DYR A;  1PA3 A;  2YP6 A;  2C8U A;  1N8J A;  1G6W A;  1N2A A;  5L71 A;  3TJK A;  5ECI B;  3DRN A;  4EO3 A;  1SYX A;  5CO3 A;  1EEJ A;  1T8E B;  4HUA A;  1GL8 A;  5GAP D;  2VIM A;  3H4K A;  3TKS A;  2VLT A;  1A0R P;  2BTO T;  4LLR A;  3TCO A;  5ENU A;  5F05 A;  4F03 A;  2DIZ A;  1WMJ A;  2LJR A;  6GSY A;  2VL2 C;  3A2W A;  3ZYW A;  3IHQ A;  4TR0 A;  3HJM A;  3TKR A;  4TXO A;  2L5L A;  3KIJ A;  3I69 A;  2B5E A;  4WET A;  2WRT A;  4FIW A;  3ZRE A;  3FZ9 A;  4I97 A;  2NPB A;  4YKG A;  1XBS A;  4FH8 A;  1A0F A;  3GH6 A;  4PQH A;  4ZB9 A;  2LQO A;  3BBY A;  4IW9 A;  1A2L A;  3C71 A;  3U6V A;  2X8G A;  1TK8 B;  2YN1 A;  4V1A p;  2R37 A;  5IOW A;  4ECC A;  4F9Z A;  3ERF A;  2YZU A;  3EU4 A;  3IDV A;  4KAE A;  3F6F A;  2KP2 A;  2RM6 A;  2JU5 A;  3TDG A;  1K0C A;  3GST A;  1NSW A;  4LL4 B;  3SBC A;  2GT6 A;  1B8X A;  5KN0 A;  2CVB A;  1RQM A;  3QAW A;  5HR2 A;  5ECH B;  1FVJ A;  4JZQ A;  1T00 A;  6GST A;  2FA4 A;  1ZYE A;  2EIO A;  2H30 A;  4GRF A;  2LKU A;  4YQM A;  1XVW A;  4YQU A;  4NHW A;  3CRT A;  4Z2R A;  3OR5 A;  3TJB A;  3PR8 A;  1F9M A;  3F3R A;  1UN2 A;  3GX8 A;  4L8E A;  1A2M A;  4POM A;  1F3A A;  2F51 A;  1XOA A;  2CX3 A;  1OVN A;  4GF0 A;  2ZCT A;  3GUR A;  3GA4 A;  1U6T A;  1V57 A;  4OD7 A;  1VF1 A;  4EIP A;  4PNF A;  4YAP A;  3KD0 A;  1ERV A;  4KX4 A;  2VCZ A;  4XS4 B;  5BMU A;  3FZ5 A;  4I5Q A;  4OCE A;  1SKS B;  2XPE A;  4K5R A;  4L5O A;  3TUE A;  1XWB A;  14GS A;  3EYT A;  2C0G A;  4WBR D;  2F3M A;  4Q5Q A;  3FYG A;  4MNN A;  4IEL A;  2WZ9 A;  2DKI A;  3W6G A;  4GTU A;  2GQM A;  4K2X A;  1U87 A;  2VL9 A;  3R3E A;  3TKS E;  3KJY A;  1WOU A;  2BMX A;  1ERU A;  1EEM A;  2FCH A;  3GHA A;  4ZIJ A;  1RW1 A;  1R5A A;  4MZC A;  2RII A;  4GXZ A;  3DEX A;  2A4H A;  2C0E A;  3GH9 A;  2GS3 A;  2ON5 A;  1O73 A;  4MA9 A;  1DE1 A;  2TRC P;  2DLX A;  4J56 E;  3GRX A;  1FG4 A;  2VAF A;  2PVO C;  2WGR A;  3LYP A;  4NWY A;  3J7Y b;  1WRY A;  2C3T A;  1ERW A;  4V1A g;  3WYW A;  4DSR A;  2I1U A;  2E7P A;  2L6C A;  2OA7 A;  2GZY A;  2VCV A;  3FK8 A;  1DBY A;  1TDI A;  5IMZ A;  3ZML A;  3W8S A;  3WGX A;  3N9J A;  4AJ8 A;  2H0H A;  2GGT A;  1PGT A;  1TU7 A;  2OKA A;  1A2J A;  3UJ1 A;  3O76 A;  1T7P B;  17GS A;  3O6T A;  3HHV A;  2YOI A;  3HCZ A;  2B1K A;  3HVX A;  1M2B A;  1X0R A;  1XIY A;  4E8H A;  2PMT A;  3EMP A;  3TRX A;  1EP7 A;  1SEN A;  4K8M A;  5ELG A;  1A8L A;  4KCE A;  1SJI A;  4L0U A;  1OC3 A;  2GT5 A;  5E59 A;  2H66 A;  4MPG A;  2JAD A;  1TXX A;  2HT9 A;  4Z7X A;  2V41 A;  3SWL A;  1LU4 A;  2DJ2 A;  2WCI A;  3UL3 A;  4ML6 A;  4XIH A;  2D2Z A;  4PNG A;  1H4O A;  4TN8 A;  2DC5 A;  3VWU A;  5JCW A;  4MPF A;  1M0U A;  2M72 A;  3L0H A;  1W89 A;  3GL5 A;  3KTB A;  2OAC A;  2YWM A;  4EIQ A;  3E9J B;  1HNA A;  1G6Y A;  5HFG A;  3HDC A;  4N0Z A;  2C4J A;  1X9M B;  1K0A A;  4OFM A;  4RI6 A;  12GS A;  1F2E A;  5G31 A;  4IQA A;  1GNE A;  5D8I A;  3MNG A;  1TJD A;  2QA2 A;  3LGC A;  4QL7 A;  4CW9 A;  2GLR A;  2H73 A;  3TJG A;  1DSB A;  1MDK A;  3ZTL A;  2F8F A;  2MBS A;  4HJM A;  1XW6 A;  5CRD A;  2XBQ A;  3F0I A;  4BL7 A;  2CVK A;  2GQK A;  1U3I A;  5F07 A;  4HJ2 A;  2HRN A;  2HZE B;  3F6D A;  3G7I A;  2PN8 A;  4ECB A;  3A2V A;  5CRG A;  4KGI A;  4MJB A;  6GSX A;  3IOS A;  5AN1 A;  4RI7 A;  2JSY A;  2LNT A;  4MLY A;  2PGT A;  3GV1 A;  4BVY A;  4MJE A;  4EC0 A;  1X9S B;  4K5S A;  3FMW A;  4USS A;  1AAZ A;  1TRU A;  4V2N A;  2AYT A;  5HR1 A;  4O5Q A;  2VD0 A;  3AY8 A;  3VPT A;  3DWV A;  3VLN A;  3IAM 2;  3UEM A;  4GWR A;  1RK4 A;  4L0W A;  5J5N A;  2E2M A;  1PKW A;  2E2G A;  5FWG A;  3KXO A;  4K2D A;  1OKD A;  3CSI A;  2B3S A;  22GS A;  3GKN A;  3QPM A;  4KF9 A;  1WWJ A;  2QC7 A;  1MD3 A;  1KNG A;  4BWQ A;  3RPN A;  2MMN A;  4G2E A;  4JRR A;  4XS6 A;  1KEB A;  1SU9 A;  5IMF A;  1EGO A;  4XTS A;  2XC2 A;  4ZL8 A;  1ZMA A;  4NAX A;  2VLV A;  3ZVJ A;  3C1R A;  1XWC A;  2Z9S A;  1CQG A;  2O89 A;  3IR4 A;  3C73 A;  2NTO A;  3UAR A;  1X5C A;  3CMI A;  4RQX A;  5ECN B;  2PBJ A;  1XOB A;  1Z7R A;  2CAQ A;  3UAP A;  3KMO A;  4AJ7 A;  3V1W A;  4TRX A;  2IMD A;  5AIX A;  3IV4 A;  3VI5 A;  2X8H A;  3ZL5 A;  3H8Q A;  3GTU A;  4KB3 A;  1JLW A;  1ZOF A;  3P7X A;  4ZB6 A;  3PIN A;  3LEF A;  2HFD A;  3PH9 A;  2G0F A;  5A4V A;  5DAK A;  2IJY A;  2I4A A;  2DMM A;  2J23 A;  2J9H A;  1J0F A;  3APQ A;  1TI1 A;  3IAS 2;  4FQU A;  1JHB A;  2YZH A;  4HDE A;  3ZRD A;  5DQS A;  4GQC A;  1I5G A;  5J4U A;  3CTF A;  3I9V 2;  4IN0 A;  4NMU A;  1XW9 A;  2VCQ A;  4HEA 2;  1UVZ A;  4HZ4 A;  2IFQ A;  1SD9 A;  1M9A A;  3UVH A;  1F6M C;  1NW2 A;  1YEX A;  2R4V A;  2L5O A;  1PX6 A;  2TRX A;  1ZCP A;  3Q18 A;  4N30 A;  1K0D A;  1VF2 A;  3ZIT A;  2JAC A;  3F4R A;  2H72 A;  2KUC A;  3ZIJ A;  3EU3 A;  1SKR B;  3EWL A;  5ECP B;  4OFT A;  1BX9 A;  3Q6O A;  5ECQ B;  1AUC A;  3VWV A;  2LRN A;  4BVX A;  3LYK A;  3D4M A;  3D4T A;  1YEP A;  3FY7 A;  5HQP A;  2HNL A;  2KHP A;  3M1G A;  1MD4 A;  2PU9 C;  1OC9 A;  4G0K A;  5IMA A;  3IC8 A;  2H74 A;  1WJK A;  1TKD B;  3QOU A;  6GSV A;  3W8J A;  3D21 A;  3G7J A;  1K0B A;  3FR6 A;  1JZD A;  3GKX A;  4DSQ A;  3HVS A;  5D9X A;  3GN3 A;  4ISD A;  5CYY A;  3CTG A;  3F4S A;  1AQX A;  5KN2 A;  5E4W A;  1BYE A;  4TXO B;  4JU5 A;  4NV2 A;  4AJ6 A;  5LCZ A;  1SK2 A;  5CRW A;  2RUE A;  1THO A;  1UA5 A;  5IMC A;  5AIS A;  1GP1 A;  4XCS A;  5B8B A;  1S3D A;  4O7H A;  1PMT A;  3EMX A;  2IIY A;  4LA1 A;  5JWO B;  4Q5R A;  2H8L A;  2RM5 A;  1GTB A;  4IS0 A;  3QMX A;  2B1L A;  4KSM A;  1HNC A;  1GSS A;  2X99 A;  3BJ5 A;  2PUK C;  1QK8 A;  2A2R A;  4ZXG A;  5DCH A;  1PD2 1;  5DQY A;  4EE0 A;  5EVO A;  5DJL A;  2JSZ A;  1TRS A;  1O85 A;  2L4C A;  5KEJ A;  4G19 A;  2V6O A;  3TKS C;  2GDR A;  4GQF A;  1A23 A;  2EIR A;  4V2L A;  3BCI A;  1EV4 A;  2N5B A;  1V98 A;  2XHF A;  3Q74 A;  5B6N A;  4AF2 A;  2FWF A;  5G1L A;  4MP4 A;  4G0L A;  1HYU A;  1GRX A;  4DEJ A;  2B7K A;  3WT1 A;  4NXI A;  1YDK A;  2I9H A;  1URM A;  4RUV A;  5J9B A;  4ZBA A;  2C80 A;  5A4W A;  2H1D A;  1OYJ A;  3ME8 A;  3KH7 A;  2IPA A;  2XBI A;  4PQI A;  2ZNM A;  1GTA A;  1BAY A;  2H1G A;  5CRH A;  3KM6 A;  1GSD A;  5J9C A;  1SL0 B;  1SL2 B;  2HLS A;  2GZZ A;  4IJ3 A;  5HR3 A;  1YF1 A;  2CAI A;  3VWX A;  5J3R A;  3RDW A;  2QA1 A;  2VCX A;  2AUV A;  4TXV A;  3ED3 A;  3EVI A;  5GSS A;  4MH2 A;  3GYK A;  8GSS A;  5D73 A;  5EPF A;  4IQ1 A;  3A2X A;  3F3Q A;  3H79 A;  5ECK B;  2M80 A;  5AIV A;  1XXU A;  2H75 A;  3TJJ A;  3HVV A;  1Z6N A;  1EZK A;  1O81 A;  1U3A A;  3MYD A;  3D5J A;  3LW9 A;  4LMW A;  2LJK A;  1VRS D;  5HFK A;  2OBI A;  3ZFL A;  2REM A;  4I8B A;  1T1V A;  2FWH A;  2GZP A;  1PQN A;  1O8W A;  2O87 A;  4POB A;  3M9K A;  3Q19 A;  3GL3 A;  2LUS A;  2KP1 A;  4XRD A;  3WD6 A;  3TRP A;  11GS A;  2ZUP A;  4XS4 A;  3PGT A;  3QCP A;  2FA8 A;  1R4W A;  1GUK A;  2CX4 A;  1ABA A;  1B4Q A;  4XS1 A;  5F0G A;  3S9F A;  4MMM A;  5D9T A;  2KOK A;  1G7E A;  1AIU A;  2K6V A;  2A4V A;  2B5X A;  1EGR A;  1Q98 A;  3L9V A;  1FO5 A;  1K3L A;  3DML A;  2KLX A;  3QDN A;  4OWY A;  5C00 A;  3LFL A;  1GUH A;  3GFK A;  4DSS B;  3LXZ A;  3IXR A;  2AAW A;  1TU8 A;  2B6M A;  3TOT A;  4WR4 A;  4EKZ A;  6GSW A;  3H93 A;  4JE1 A;  1PL2 A;  2JZR A;  2L59 A;  4IGJ A;  2HYX A;  4J57 E;  5D9V A;  2OBK A;  4RQR A;  1GTU A;  3TRQ A;  4PUR A;  2P31 A;  4H86 A;  3ZFB A;  1USB A;  5GST A;  4WKW A;  2PWJ A;  2DJJ A;  2A2P A;  4OMV A;  3C7M A;  4KCA A;  3GNJ A;  1ILO A;  3FR9 A;  5B7C A;  2H0I A;  1KTE A;  2IWT A;  1GWC A;  3KMN A;  4HQZ A;  2RLI A;  4I2U A;  3IC4 A;  4GST A;  1R26 A;  4KDU A;  3HKR A;  2N5F A;  1BED A;  2LRT A;  2P0G A;  1F3B A;  2LNS A;  1O7U A;  5IM9 A;  4ML1 A;  2E0Q A;  5INY A;  1J9B A;  2R5G A;  4IP6 A;  2EIQ A;  4YQV A;  4HS1 A;  1Y6E A;  1OKT A;  1AC1 A;  1AXD A;  4KUN A;  4TR1 B;  4TVE A;  2HRK A;  2VUP A;  1EP8 A;  4MAB A;  1MDJ A;  5JWR B;  5ID2 B;  3DKS A;  4JED A;  2DJK A;  3J7Y k;  4CHS A;  3PPU A;  2FWG A;  2R0C A;  1Z9H A;  4ZBB A;  4EXJ A;  3I6A A;  3CSJ A;  1U88 A;  3NIV A;  3F4T A;  4MJC A;  2N5A A;  1Q4J A;  3MSZ A;  1J08 A;  1M2A A;  4F2I A;  3GUS A;  5B8A A;  1YJ6 A;  4O5R A;  3MIX A;  2CV4 A;  3LG6 A;  2H6Y A;  4NHZ A;  2GSS A;  5H5Q A;  1DE2 A;  4QL9 A;  3G9B A;  4TKY A;  2B5Y A;  1ZYQ B;  2IL3 A;  4L5L A;  3MDK A;  5A4U A;  3UMA A;  1FB6 A;  4A5P A;  3HXS A;  1ZYN A;  2LTK A;  3VWW A;  4ZB8 A;  4BVY B;  5DAL B;  2VCW A;  3FRC A;  5JCG A;  4MK3 A;  5ABR A;  1B9X C;  1XPV A;  1CQH A;  1TW9 A;  5D96 A;  4HI7 A;  2FLS A;  3ZLP A;  5LD0 A;  1R7H A;  2CZ3 A;  3G7Y A;  2O8V B;  3RAZ A;  1A8Y A;  2IMF A;  1YY7 A;  2R2J A;  3WGD A;  5DJM A;  1SL1 B;  3TKQ A;  6GSU A;  4FYB A;  3MWH A;  3HJO A;  2F8A A;  2YJ7 A;  1GSU A;  2NDO A;  1NHO A;  4HQS A;  4POK A;  4PGT A;  3IHG A;  2GQL A;  3LOR A;  4MZW A;  4LL1 B;  5IMD A;  5D93 A;  3E0U A;  4K7I A;  5ECL B;  4F0B A;  2YJH A;  3C1S A;  3NOF A;  1SK0 A;  5DCG A;  1LJR A;  4MDC A;  5C04 A;  1PKZ A;  2GSR A;  3CRU A;  2ON7 A;  2NBS A;  3EUR A;  4ACS A;  1PRX A;  1TOF A;  5IOX A;  4IKH A;  4D73 B;  1XFL A;  2EC4 A;  1XWG A;  1QQ2 A;  3CYN A;  3EC3 A;  1SD8 A;  3BD2 A;  4ECJ A;  4TR3 A;  5CP1 A;  5FHI A;  2GVP A;  4EL1 A;  1GSE A;  2CT6 A;  2H6X A;  2O7K A;  1AQW A;  1VF4 A;  1GLQ A;  1M7T A;  4IBP A;  4LMV A;  3TB2 A;  2C3N A;  5IPH A;  1VF3 A;  2AB6 A;  2L4Q A;  3HJP A;  4OO5 A;  3F63 A;  4X1U A;  1OAZ A;  4OO4 A;  2H0G A;  3QD9 A;  5DBQ A;  1O6J A;  1FVK A;  5IPG A;  1AW9 A;  5HR0 A;  3CSH A;  3D6I A;  3UVT A;  1YF0 A;  2YCD A;  4MF7 A;  1ST9 A;  4X4J A;  1V2A A;  2YWN A;  3IA1 A;  1TI3 A;  3VI7 A;  3DD3 A;  2WB9 A;  3LWA A;  3L78 A;  2F9S A;  2VL2 A;  4MZB A;  1M9B A;  3UBK A;  1M2D A;  4BVX B;  3FHK A;  3HD5 A;  3WT2 A;  4KDX A;  4WF5 A;  2YNX A;  3RHB A;  1PL1 A;  2IN3 A;  4G10 A;  4TR4 A;  1OC9 B;  1W4V A;  3DGQ A;  1FHE A;  2DKH A;  3P2A A;  2IMK A;  4EDY A;  4OFN A;  2HRF A;  4GLT A;  1JZO A;  3E3E A;  1R5P A;  3GKM A;  2FHE A;  2LS5 A;  4GCI A;  4K1F A;  2CQ9 A;  3UOM A;  3QAG A;  3P8W A;  2DJ0 A;  2MMA A;  4CY8 A;  5H5R A;  4K7N A;  2O85 A;  3R2Q A;  2H76 A;  1EWX A;  2VD1 A;  4CY6 A;  2JZS A;  1SJZ A;  4J2F A;  3TGZ A;  3DVW A;  3HYP A;  3O3T A;  4FYC A;  5KOX A;  5B6M A;  2JZT A;  1M99 A;  2DJ1 A;  3K8N A;  1V58 A;  19GS A;  3US3 A;  2HRA A;  5IQY A;  2DBC A;  1FB0 A;  1ZZY A;  2HZF A;  2R0G A;  1FW1 A;  2JL4 A;  3APO A;  1ML6 A;  3QFA C;  4G0I A;  1DUG A;  3HZ4 A;  3FKF A;  2HSY A;  1Z7P A;  2H6Z A;  2UZ8 A;  5G2Z A;  2M46 A;  1OC8 A;  1XWK A;  2QGV A;  4XHM A;  1T4Z A;  2CZ2 A;  4MH3 A;  3A5I A;  2LST A;  1X5E A;  2H70 A;  2V2G A;  3UBL A;  2FWE A;  2V32 A;  1GUL A;  2DIY A;  1K3O A;  4XRA A;  4Z2T A;  4IP1 A;  1HNB A;  2LRC A;  2FGX A;  1ACV A;  1TK0 B;  3APS A;  5A5K A;  2HSH A;  3C8E A;  1WE0 A;  4MF6 A;  2HI7 A;  1I9D A;  3HY2 A;  3M9J A;  4QQ7 A;  18GS A;  1K0O A;  4HOJ A;  2VL3 A;  4PUF C;  2DJ3 A;  4CDO A;  2XPD A;  2H01 A;  4I6X A;  4IJI A;  1S3C A;  1V40 A;  3EIN A;  4BPY A;  2WS2 A;  3BCK A;  1Z5Y E;  3IRA A;  3NZN A;  3LSZ A;  1QFN A;  2H1B A;  3GMF A;  1GLP A;  3GIX A;  3CBU A;  5BRT A;  1JFU A;  1OE8 A;  3DXB A;  1Z3E A;  4I2T A;  1YKA A;  20GS A;  1A24 A;  1IYI A;  4Q5F A;  2IMI A;  1JLV A;  2QSI A;  1XWA A;  3TJF A;  1X5D A;  3ISO A;  2OAD A;  3KP8 A;  1TP9 A;  3QAV A;  3GSS A;  4X43 A;  4PUA A;  4JR4 A;  1GUM A;  2WJU A;  1Z6M A;  4TOP A;  3IE3 A;  2HSM A;  1SYR A;  5ELA A;  1BQ7 A;  2ALB A;  1GSF A;  4K7O A;  3FEU A;  1EOH A;  1PN9 A;  2DML A;  1K3Y A;  1XW5 A;  5COH A;  5KOW A;  3M0F A;  2X64 A;  2X49 A;  2QKE A;  1LBK A;  1ON4 A;  5IMV A;  5JCU A;  4BWS A;  1UC7 A;  2VOC A;  3GKK A;  1F37 A;  4PXO A;  3KP9 A;  2CA8 A;  2MMZ A;  4JBB A;  1IYH A;  1OE7 A;  1SK1 A;  2WUL A;  9GSS A;  1YKC A;  1FAA A;  5DVB A;  2LEG A;  3ERG A;  3IPZ A;  3CXG A;  1ERT A;  1H75 A;  4EUY A;  4YH2 A;  3P90 A;  2MBT A;  2A2S A;  3H1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...