2KP6A

Solution nmr structure of protein cv0237 from chromobacterium violaceum. northeast structural genomics consortium (nesg) target cvt1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
MDTSNHLLPGLFRQLGLEDEPAAIRAFIDSHPLPPRVPLPEAPFWTPAQAAFLRQALECDAEWSEAADGLAVLLQQGEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution structure of protein CV0237 from Chromobacterium violaceum
rcsb
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
total genus 21
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10982 DUF2789 Protein of unknown function (DUF2789)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1130 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kp6A00
2KP6A
chains in the Genus database with same CATH superfamily
4E7ZA 4ZYGA 3B02A 4HSTA 2FMYA 3EYYA 2F5CA 1JT0A 1G2HA 3RCOA 3LOCA 5JLWA 2B9SA 1W1WE 3ECHA 1VZ0A 4Y52J 1G3WA 2ZJQF 1FBQA 4M71A 4CYCB 3OY9A 1K61A 3TOAA 1IGNA 3PM1A 4G12A 5HODA 4PSWA 2DFHA 3FWEA 4N9HA 1EH6A 1EF4A 4LFUA 1LDKB 4EGYA 4AIJA 4BJ6C 4JOMA 2BY3A 4IQ4A 2XASA 2KQRA 5F0FA 3OSGA 2XRNA 4RLQA 2BY0A 3ML6A 2O0YA 3HZJA 4KN4X 3HRSA 4A69C 4DNCA 4CYCA 2VQHA 2X1EA 1BJAA 2IS2A 4FTHA 2NVUB 4EM2A 1FEXA 2LY9A 1TW3A 3KEQA 4BHCA 2ZCWA 4BE0A 2DJNA 3IH3A 4DZJA 2L54A 3VSKA 4ESBA 2RNJA 1QRYA 4G6DA 2DOAA 2WAQN 4RDUA 3AAFA 3DU6A 2L9VA 3K69A 4U0VA 4GYIA 1X3WB 2DA2A 1ETWA 2GAUA 3KFWX 2DDBA 4A3JJ 3LSIA 3QYBA 1IDYA 1ETOA 2LH9A 4FCYA 4HX4A 4UHTA 2JMWA 4Y33A 5DYMA 4E7KA 1PYVA 3V7CA 2V79A 1YE9A 1OCPA 1RR8C 1D8JA 2M7BA 2HOEA 1X1BA 2W57A 3BR5A 1PJRA 4N4OB 2X6XA 4I02A 1N25A 1S7EA 1N78A 4A93J 3MKWB 1K7AA 3PSIA 1QNTA 1X4PA 5CJ9A 2LP0A 2BE5F 2K4JA 5ICGA 1POGA 1TQIA 2X48A 2CS3A 1YITI 3BTCA 3F22A 3KP7A 2DI3A 2DTZA 1N75A 2L9SA 1NG7A 3DTKA 4R8HA 3VYRB 4NNJA 4BJ5C 3I4NJ 3K7AJ 4B4CA 2HOSA 2IT0A 3U2RA 3HDDA 2GA1A 3E97A 4PUSA 1FIAA 2JN6A 4U7BA 2WTEA 2PJPA 2F4MB 3LSHA 2Y9YA 1JXSA 3HOUJ 3PUBA 3BR0A 1W4MA 2XF7A 3EUKL 4RGSA 4MTEA 1IRFA 2Z99A 2IA2A 1U8RA 2I10A 3ZGKA 4W97A 4A3KJ 5EJCA 1F1ZA 5EEGA 4ESFA 4LD5A 1H9TA 5IPAA 4S04A 2CW8A 4U0YA 5K5QA 3J81K 4G7HF 3CCYA 2UXXA 3K0LA 3PFIA 4ZH4F 4AIKA 3I3LA 2HQRA 2E36A 2HDDA 4FETA 2R93J 4UB6C 2L7FP 1ETXA 1IC8A 5E17F 4N4NB 2PBIA 2MH9A 3FMSA 4G94A 2AHQA 3OSFA 3PFYA 1SVOA 4UVBA 3WGIA 4LGWA 3WTWC 1R58A 5D8KB 4DYCA 2VL8A 3JRAA 4PFPA 3P5JA 4I98B 2HYGD 4WWCA 3H9GA 4ASNA 3AG4H 5J8CA 2NS0A 2HOAA 3F6VA 2Y2ZA 2A05A 3S15J 2OD5A 2E2IJ 2OA4A 4EMSA 3A02A 2VJ5A 5GAGJ 1OYIA 3ZQFA 3F8MA 1QGPA 4IX7A 5HDNA 2OCEA 1DP3A 2OC6A 4I01A 2IS4A 1W7PB 3HYIA 3FXLA 4YRVA 3RI4A 1BN5A 1ON2A 2XRLA 3FXRA 1B9MA 4W1UA 4A0ZA 2R5ZB 1RPWA 2H1KA 1XX5A 1VI0A 2Y0SN 1VQ4I 1YLFA 2DMTA 4A3IJ 2Z33A 5GTIC 2DU9A 3E6BA 2WBMA 2OPTA 1LDJA 3RTRA 4PCQA 2CQ7A 2L9NA 2NXNB 4M6YA 2VOPA 3H36A 1OR7A 1B6AA 1W7PA 3GEZA 1PP8F 3ABUA 5F0HA 3SQNA 2PMZA 2D1VA 2QYOA 1WZ2A 1S6LA 2ZBKA 2CQXA 2CSOA 2R5ZA 4IHXA 2CFOA 1BR4A 4IQJA 5GPCA 1WKMA 1IG7A 4LJZF 2XAQA 1ITYA 3TEDA 1C0WA 2FQ3A 2QVOA 2DA6A 5CVRA 5F08A 2O9LA 1ETYA 2RREA 4G9YA 4WXHA 2HI3A 2LLKA 4HF2A 1D8KA 1R1TA 2KZGA 5C3EJ 3C3WA 3BR6A 4I0BA 2KFDA 1YQAA 2ZSIB 3ZQ7A 4BQAA 2O3FA 3MCZA 4FX0A 2MC3A 1X1PA 1XTAA 1SFOJ 2F48A 3LL7A 2JSCA 1VQKI 2KIQA 1XGMA 3ZQIA 2A69F 2FBHA 3TO9A 3ERMA 5E8IA 3G6EI 3JTGA 2O6GE 2EINH 2BEOA 3GTGJ 2FA5A 3BJOA 2ZC2A 2L0KA 2JRTA 3W2WA 1JHHA 2KP6A 1T08B 1OFCX 2L01A 4NQWB 3A03A 4F52A 4HNUA 3J7AY 3LSGA 2OJED 2GXGA 2IXSA 3H9QA 4A3GJ 2STWA 3L2RA 4XOPA 3OV8A 2F5FA 2DA3A 1HCRA 2A5YB 1HSJA 2ESHA 3QRFF 1UHSA 2HDWA 3QPHA 1ZG1A 5BPDA 1AHDP 3EETA 1U5TC 2X6OA 1HDDC 4WXDA 5DCMB 2HEOA 2BZTA 3KX2A 5DM7F 5E3NA 4EJVA 2F5DA 3KP3A 4ZYAA 1R1UA 2K40A 3W2VA 2EA4A 2E7WA 2EWNA 4NQWA 5D5WB 2ID6A 2KMUA 3G1LA 5DM6F 4OINF 4BE2A 5E20A 2KRFA 3N97A 2W4SA 1G59A 3EQLF 3GMEA 1DUXC 2CGPA 2LOOA 3ABMH 2A6EF 3G1MA 3WTXC 2OCCH 1JGGA 5DCMA 2IS6A 1FTZA 1LE8B 4WK8F 4HDUA 2BXZA 4WF2A 2DAOA 4KN7X 1J59A 2O61A 1G6NA 3FHNA 2ISZA 2ZJ2A 1RKWA 3G2BA 1KYZA 3LAPA 3AL0C 2AO9A 2EILH 3HRUA 2KHMA 4EV0A 4RAZA 4HLYA 1UB9A 4E4HA 2VJIA 3GBGA 4IXAA 3S32A 1SC7A 2HS5A 4GYGA 3ASNH 2KZVA 2VKEA 2P7CB 5HVQC 4CCLA 1P7IA 2VT2A 4AC0A 3TDZC 2FF4A 2MBFA 4PGGA 1UHWA 2R7DA 3V8JA 1OYWA 4LOCA 3PNYA 4AVPA 3HSEA 5GAHJ 4HAMA 2M0MA 2A07F 2Q2EB 2K86A 4P55A 4LB5A 1T6SA 2V6CA 3MFKA 4IHSA 2JA2A 2DMUA 3SJMA 1YHQI 1Z6TA 4BKXA 2EJRA 2W25A 3H3UA 3FF5A 3PQKA 2IW5A 3SYTA 4IRIA 4AM3A 2HZDA 3D0SA 1ETKA 2K7LA 1RKTA 1UJ8A 1ZQ3P 3A01B 1BW5A 4EATA 2DPUA 1TZLA 2DQLA 4HOBA 3F72A 2D2WA 1RZ4A 2Q2EA 4NBQA 5D4SA 1JUPA 1Y8QB 3CLQA 4Y17A 4YIIA 3GTPJ 2RVCA 3B73A 3Q0UA 1WJ5A 5FD6A 3VYSB 5FRMA 1LEAA 2VKDA 1GUUA 3OOPA 1ZRDA 4O3MA 3CMMA 2EPFA 1V55H 3WTYC 1XC5A 1SEUA 2X1CA 4XLNF 3BJAA 4CA0A 1YI2I 3NARA 2OV7A 5BS6A 1YJWI 3NEUA 2I5UA 1NK3P 1R49A 3H0DA 4QIWN 3A01A 5FKKA 5JVTA 1X4OA 4E7JA 2G7UA 1ZGAA 1Y1WJ 2DMQA 3W3CA 1NTCA 2XAFA 3BCBA 1YW8A 2LY1A 4E7IA 1LVKA 2R5YB 3V8KA 5D5XB 2PMZN 2STTA 5KAIC 4AYBN 3MZ8A 1TWGJ 2HNHA 3B6AA 4I7HA 2K9SA 2KJCA 3BCAA 4KDPA 1U3EM 3IKTA 2QBYB 4ZDLA 3FIWA 4RGXA 3HIFA 4CUGA 2V9KA 1FOXA 4C3IJ 4B47A 4B3AA 4YFXF 1SD6A 1ZTRA 1S7AA 4RB3C 3PIOF 1JKQC 5CYVA 2JA7J 2OU2A 1X2MA 4IHVA 4A3LJ 3IWZA 3H35A 1B59A 4IHTA 3HSFA 4G7OF 2R5YA 2CV0A 5EEHA 3H1CA 4AUXA 4BXUA 3ABKH 3PIPF 2CW0F 1T95A 1TLHB 4XKWA 4FE4A 4KIGA 4RGRA 3ZRGA 1T8IA 2YUSA 4XRSG 1KQ0A 4XQFA 1O4XA 1U9OA 5JI6A 5HNFA 2QBYA 1XSVA 3QU6A 4OMYA 3C18A 3GFLA 3K70D 1V4RA 1IN4A 4LLLA 2XPWA 3ZMZA 5B3SH 4OIQF 1GLNA 3KE2A 3RQIA 1PVEA 1WWXA 3H5RA 3R4KA 3HRMA 1K6OA 2PI0A 3K4KA 3LA2A 4HRIA 2ELHA 1W7PD 1MNEA 1Q1HA 2MG4A 1YOVB 1E17A 4CZCA 2L3DA 2DMPA 4V19K 4DIQA 3E7LA 5F1RA 3BJ6A 3CDIA 2UXNA 3F3XA 3Q0WA 4DBQA 1SD5A 1FYMA 4IRHA 3JRBA 5J4YA 4EM0B 4HZFA 5DDGA 2PEXA 2E1MB 3CCQI 1IJWC 1H88C 1WHUA 4BQQA 1UG0A 2CO5A 3GCMA 2XSDC 5EG0B 4XLHA 2MLGA 3G1OA 1UFMA 2O8XA 4F7ZA 5C4XJ 3DBRB 5FLXZ 5K7ZA 4XNFA 3KCCA 5IT9K 2F6CA 1ON1A 1SMTA 3IAS2 4BEHB 2WB1A 1HA8A 4HQMA 3CJQB 2FMLA 1TQMA 2DT6A 2EFWA 4KIBA 3TDUC 3TQNA 1T56A 5EG0A 1ONVA 3C2BA 2R3SA 4XSXF 4RAFA 2F5VA 2WADA 1QPIA 1MNDA 3OYBA 1W0TA 2L2OA 3OYNA 5HDKA 2ELJA 1QQIA 1BI0A 5KVRA 3LAJA 2EA2A 1X19A 1XGNA 5CLSA 1IRXA 1SAXA 3ZN1A 3GO5A 1LFPA 5CVVA 4PGHA 1AU7A 2DCEA 2BGCA 3K2AA 5EZGA 1GDTA 2M1BA 4XBFA 2PN6A 3G3ZA 1QBJA 3L2WA 2XC7A 2EFPA 2HDCA 1T0FC 1AWCA 1LJ9A 2DLLA 1TC3C 2E60A 2OTJI 4KMFA 5J6XA 3OYKA 3MWMA 2COMA 1MW7A 5IT3A 2JJ7A 2QUFA 3AFHA 3PO3J 4BXFA 4J01A 3BP8A 3GTKJ 3MEXA 3HOVJ 2GOMA 2EIKH 4MLOA 2XPVA 4R79A 1UG2A 3J7ZI 4XONA 3HHGA 3EUAA 4NB5A 3K70C 3C1DA 1XCVA 1B72B 2DA7A 1YRNB 1D1BA 4R1HA 1Z0XA 3TP3A 2VBZA 1R36A 3BR3A 2K4BA 1S29A 3CF2A 5F0CA 3K2ZA 3I58A 3KP5A 2UV1A 1P2FA 4M9XA 4YIFA 2N8GA 4XMYA 1OR7C 1VNDA 2MYSA 3SXYA 2W84A 5B1AH 2P7VB 1ZH5A 2GIVA 2CFXA 2NYXA 1JJ8C 1FYLA 1HW2A 2ZO4A 1S7OA 5E18F 5A2QZ 1JI8A 2CRGA 4KUMA 1I3QJ 2LYCA 1YRNA 3HGGA 2UZKA 5FD5A 4RB2C 2FBKA 5K7HA 4IL6C 3LMMA 2PX9A 3GTOJ 5ICFA 1B1BA 2TCTA 1QA6A 3TOBA 1K83J 2COBA 1ZLJA 4BAYA 1AOYA 1SFEA 2YX4A 4NC8A 4XICA 2E1CA 2NS7A 2VN2A 3KZYA 1SD7A 2NVTJ 1X58A 3BG7A 2QWWA 2FOWA 3OYLA 1F43A 1FBSA 3WHBA 4QSHA 4ENNA 3K4JA 5J4VA 4RBOA 2R7XA 2PMUA 4EVIA 5GAEJ 1YTYA 2QA4I 1LKXA 1SFKA 2XPUA 5DD8A 2IP2A 2W7NA 3CCVI 5FKLA 4C3JJ 2V1UA 1Z21A 4WX9A 1DQUA 1HSTA 1VFCA 3JRHA 2G7HA 4FE7A 1WGXA 2X6YA 4Q48A 2M30A 2GIZA 2ZB9A 3M8JA 3GW2A 4XLCA 3D5RC 2XROA 1ERDA 2X51A 1XN7A 2E35A 5K7FA 4M3EA 1KU3A 3I64A 2E34A 2VJ4A 2EIMH 5L3DA 1D0XA 2H6CA 1ZREA 4OMZA 4Y15A 4BDYA 5M5XJ 4P5OA 2B0LA 3DU5A 1S9HA 3I0TA 1RIOH 4L0YB 3CCUI 3HC7A 3DP7A 2JA8J 4IO9F 5J47A 1KZHA 3DQVC 2JRMA 2F5EA 1FTTA 2HQAA 3AKZA 4N0BA 1QVTA 2R7TA 3GZ6A 3BR2A 3GLLA 1HQCA 1ZAOA 3E6CC 1SFUA 1MIJA 4C9YA 3IRRA 1U78A 1KQ8A 2V1DA 4AIDA 5HS8A 1MMDA 4D7MA 1W36D 1I1GA 4FHTA 1Y0NA 3O6BB 5CKTA 2ELKA 5FKOA 1OISA 5K5OA 3IAM2 1R6RA 1DPRA 3F8NA 4YELA 1SFXA 2GWRA 1GV2A 2WB1N 4KT5C 5E1XA 3ZMSA 3M7GA 5FFZA 1J75A 3ZP5A 2R0QC 2EK5A 2HR3A 4L9VA 2BBYA 3UKGA 4ABZA 4EJWA 2ME6A 3MKLA 2KDOA 3QOEA 4GFBA 1SANA 1AA7A 4U87A 4LK0F 2QSHX 3IHUA 4XIDA 1O7FA 2R7QA 2QGUA 1MMNA 1Z7UA 3HL2A 1MJAA 3CJTB 2YS9A 4A3CJ 2PQ8A 3MQ0A 3Q9SA 2VPLA 1T2KA 2BV6A 2HXIA 2NVXJ 1HOMA 1GV5A 2HQ5A 1VQPI 5IYBJ 1MD0A 2O7OA 3F8FA 1Y6IA 3EPZA 2VUMJ 5BOXA 3F8CA 2IVMA 3HKZN 2ACJA 3EDPA 1TWAJ 5LRRA 2BVMA 2E7XA 3K4CA 3F23A 1S3JA 3JSPA 3HHHA 4XLPF 1YJ9I 1FMVA 2M2EA 3L2QA 2Y0MA 3E6MA 4UV8A 4ITVA 1ACIA 2PJRB 3OYAA 3HUGB 4RGUA 1QZYA 2M45A 3DWLE 4J19A 3CCLI 3JRCA 2LBFB 2VLAA 3Q0VA 1A5JA 1ZG3A 4UY8I 2V1NA 2J5OA 3F0CA 1MMSA 2EFOA 1KU2A 2X0LA 2M8EA 4B3XA 1IV6A 2LFBA 4MGRA 4G8XA 2MD5A 3MD2A 2BOLA 5D5UB 1T98A 5FLMJ 1OJLA 2M9HA 4I09A 1WSUA 1O7LA 3K1NA 3WG9A 2PJRA 3F8BA 4DGWB 3HUGA 3DPLC 4D5FA 2DDAA 2NNNA 3CQZJ 3JTHA 4OAYA 2LBFA 1BR2A 2A68F 4H0EA 4I99C 5HDGA 2JT1A 2AXLA 2M3AA 2XGDA 3T1BA 3KYLA 3F21A 2AQFA 3SFZA 4HLXA 2PFBA 1O3QA 2WAEA 4NC6A 3ZPLA 2JPBA 4PJLA 1ZR4A 4M73A 3RKQA 1IDZA 2XF5A 4ENMA 5LHHA 5KCMA 3HOWJ 3I5UA 4HF0A 3IH2A 2IGOA 1WH5A 5J8FA 1OPCA 3LFKA 3DEEA 4E70A 3WTUC 3PUFA 1PDNC 3J7AO 3JCUC 3V8LA 4M6XA 4ZYHA 1RRJA 3GF2A 4UVCA 4XL9A 3VEPA 1W36C 3M1EA 2E5NA 2VE8A 3LSPA 5CQEA 1K4SA 2XAJA 3H92A 5F04A 5F1JA 3L09A 2GXAA 2DOFA 3BQZA 3H5AA 3ZQGA 3LSKA 3U21A 3RSNA 2BXYA 1QPMA 2K3FA 2Y69H 2HVQA 1LPQA 3J7YJ 1OYYA 3FK7A 2Z16A 2AS5F 3L2VA 4C30A 1P6RA 2ZFUA 3S2WA 1Z91A 2XIGA 3GTQJ 3LNQA 2GOXB 3WODF 2CUEA 3LQQA 2DQRA 3C7JA 3HRTA 3HM5A 2FD5A 1W5TA 4A2UA 1Y39A 1TBXA 2JZYA 1XS9A 3VWBA 2M7AA 2VT3A 3GTLJ 2NVQJ 5ICEA 3A4CA 3KEOA 4OOIA 5KHDA 3DPTA 1WVRA 1H8AC 2G9WA 3KP2A 3IKVA 2E5ZA 2ZXWH 3ISPA 3W6JB 2FQ4A 2HPMA 1A31A 1V5FA 2ZFWA 4FASD 3A0BC 4L5JA 3LSTA 3OYHA 1T39A 4LK1F 4EM1A 4Y7NJ 2VE9A 3S14J 2Q1ZB 3M4OJ 3CZ6A 2ZJPF 1WH7A 2CUJA 1IN8A 2L7MP 3RKXA 2Z1DA 2R7ZJ 2RV8A 4HYEA 1FNNA 3FBNB 2R7FA 3O8HA 5IOZA 4G7ZF 1I27A 5L3EA 5JFRA 2XKPA 2W00A 1VQMI 4HEA2 5E79C 1BOAA 1FC3A 3ZXSA 2ECCA 4UUSB 3DFGA 2K85A 1YS7A 1WRJA 2DYRH 4NC7A 3CD6I 2E1MC 1MBHA 2MLKA 3U1KA 1DPUA 1YW9A 3S3MA 2HTJA 1ZK8A 4UNOA 2R7OA 3HPHA 1XGOA 1SVMA 1FZPB 4U0WA 3OS1A 1GXPA 1XB4A 2XHKA 2ME0A 1I5ZA 2FNAA 2L7ZA 1FOKA 2OF7A 2CYYA 2JSPA 2OTLI 4DW6A 1IXSB 2RKHA 3KYCB 4A0YA 1P7JA 1ZRFA 5F64A 2LF7A 1JTYA 4UUSA 4B1RA 1TNSA 4OIPF 1IUFA 1FYKA 3S8PA 2P5KA 4IKFA 1O3TA 5F6FA 3PSFA 2ZXIA 2FNPA 1WCMJ 1Z05A 2EZKA 4GO1A 4DJAA 4M3BA 3L7WA 1TWCJ 3SDBA 5IY5H 4XR6A 3BPXA 1VTNC 1MDMB 3OMYA 3W6KB 4A3FJ 5BPIA 2QENA 3FX3A 4JX6A 1WFXA 4Q4ZF 4HX8A 2D5VA 2K02A 1LQ1A 2YX7A 4XOTA 2I8DA 2DFEA 2FOKA 3RYPA 2VC0A 1OCZH 4FX4A 2HVSA 2R4GA 1KA8A 3TW6A 5L3CA 4M9ZA 3ESWB 3TL4X 1I3AA 5DEQA 1KYWA 3TO6A 5DS9A 3AG1H 1MDMA 2R7SA 5FKNA 3RYRA 3HOSA 1R5HA 3HBLA 1MMGA 3JRGA 2XGCA 5HLTA 3GZ5A 1H89C 5H6RA 5J1UA 4HNVA 3HG9A 5A2QK 1GT0C 2EFQA 1LE8A 4NHJA 1D0ZA 1FSEA 5EDNA 4OIOF 2KLOA 5ILUA 3S16J 1WJEA 4CZZA 5LEKA 3CDHA 3FBIB 3BY6A 3M9AA 2RDPA 4YFKF 4IEJA 5DUKA 1ETQA 3OYFA 1X1DA 4Q5SF 1HKQA 4UV9A 5FFXA 1DGRM 2LF8A 2VI6A 3QAHA 2LSOA 3RZOJ 5E1WA 4X0GA 4EJTA 2L5QA 3JRFA 4IOAF 3S1NJ 2KIFA 1R7JA 3OYMA 3O2PE 1ENHA 4KA4A 3HJEA 1V3FA 1YS6A 2XAGA 3E6DA 2V6EA 1Z67A 3SFIA 4IF4A 1CF7B 1R1VA 1HW1A 1JTXA 2IA0A 1XD7A 1K79A 1R23A 4Q47A 4ON0A 4CDGA 2IAIA 4BXXJ 3VOEA 2ZSHB 3ERED 2G0EA 3KPHA 4XK4A 1JHFA 1FT9A 1MJ9A 2NVYJ 3IUOA 3H9JA 3MMYB 3TW7A 2JUCA 3PQJA 1XMKA 2Z9OA 3BZKA 2IA1A 1H0MA 4B43A 1OCOH 2DJIA 2DMNA 1G3SA 1IAWA 1HDPA 2A6HF 3CO7C 5B1BH 1CF7A 4JQFA 4FQGA 1FOWA 4ZZDA 3FKJA 1KQ9A 3FMRA 4XLAA 3ULQB 4JX4A 3MZYA 4D7NA 4L9JA 2E19A 2H94A 1UZCA 2PG4A 2ZNYA 2H1LA 4BS9A 3BR1A 2NAZA 4HNTA 1F36A 2KJBA 5K5RA 4XRFA 3J81Z 5ERIA 4BY7J 4CHUA 4HF1A 2CW7A 4RAGA 2PLYA 2KISA 4C3HJ 3V7SA 1JJ6C 3ONQA 2EBIA 2PMHA 4YIRX 1O3SA 3GTMJ 3M07A 3X2QH 2XDVA 2DO7A 3CMAI 1IN6A 3OIQA 1IRGA 3H5NA 2VQGA 1K78B 4ZTJA 3QU3A 2LREA 3RZDJ 3IH4A 3PL8A 2FX0A 5FO5A 2DOEA 3S17J 1MMAA 3QYFA 1GVJA 4MIMA 2BW3B 1JE8A 1TTYA 2QQ8A 2GZWA 2WY7Q 2WV0A 5LFAA 1BC8C 5FLVA 2CQKA 4J00A 3K9TA 1FBUA 1USTA 2CV2A 2Q0OA 1K78A 3KZIC 1I1SA 2YR2A 1RUOA 4IOCF 1OCCH 1R22A 2AXTC 2KL4A 3QWLA 2P0WA 1FOYA 2BW3A 5FGMA 5H2FC 4MTDA 2V1XA 3FDYA 1BBYA 5HOOA 4U88A 5J1RA 5LRSA 3GFJA 3ZMVA 1AKHB 4BY1J 1TNTA 3WTZA 1Z77A 4E7LA 3DLAA 4A3DJ 1X2NA 2LR8A 5ICCA 4A6DA 2WA0A 3CF5F 2VPRA 1MGTA 2OQGA 5EZHA 2DA5A 5LHIA 3RPUA 2R7UA 3M8EA 2MABA 3SEQA 3BC8A 2HWVA 2DT7B 4Y4RA 1TP4A 3IWFA 1G4DA 3P7NA 1FMWA 5LHGA 2CQNA 1ULYA 3SZPA 1JKOC 1IN5A 3HTUA 1J9IA 2HPIA 5HS9A 5CVIA 1F9NA 1I50J 3DBHB 2ID3A 3BZ6A 5LGNA 3T8TA 2HVRA 1WJAA 4A3MJ 3R6SA 1AKHA 2H8WA 1SVLA 4IJAA 2R7VA 4EEFG 2VJJA 3PO2J 1ZN2A 3GFMA 3RKYA 2P4WA 1WJCA 3BZCA 2P5VA 3QPSA 4CO8A 3LSRA 3DV8A 2TDXA 5DUIA 3GTJJ 6PAXA 3CCRI 2Y31A 2LMDA 2RN7A 1MBEA 4LLGF 2R7RA 2V9VA 3E1SA 3U9GA 2XAUA 4E7HA 1VQ7I 2QQBA 3RIRA 3DCFA 1IF1A 1B4AA 3D1NI 2YU9J 3D5LA 4RM2A 4M6VA 5GADJ 5HLIA 1S5LC 5LGUA 3ZR8X 1K4TA 1ZGWA 5GPAA 4BEHA 3HEFA 2VQCA 2LD5A 1LB2A 2HXOA 4DYRA 1BIAA 2L7KA 4CICA 1XMAA 3LWFA 5CVJA 2WWYA 1FP1D 4CCJA 4P9UA 1TL8A 2DK5A 2BYVE 3I54A 4HA8A 4PJMA 1WJFA 1XDUA 5EGOB 4MNUA 5FKMA 5B66C 3NQOA 5EF6A 4ESJA 4MHGA 1JUSA 1P92A 1LEBA 3R61A 2P8TA 1NH3A 1SAUA 1WI3A 2NOJB 5DCFA 1ZR2A 2CJJA 1A6IA 3ZMTA 3BPVA 4I6ZA 2QKLB 4UB8C 2IPQX 2VBYA 3HOXJ 5C44J 1GHCA 3NWTA 1Z7LA 4HV6A 3QYEA 4V2GA 2XGXA 3HGYA 5EGOA 4IPAA 4XLFA 3BWGA 3IV5A 3CUQB 3CC7I 1EJ9A 4EJOA 3F9KA 5H6QA 1ORKA 4CH7A 4F93B 2A3SA 3K4LA 2KRCA 4XKVA 4Z2YA 2NOGA 3WU0A 2OBPA 4BH9A 3E0JB 5E3MA 4UUVA 5HLGA 4L18B 1XDSA 1R4NB 1WJDA 2JK3A 2VC1A 4CSWA 4M3GA 2B7EA 3GVAA 2KPMA 1L3LA 4PJ0C 4B09A 2GXBA 3G73A 3I9V2 1B72A 2DFIA 4A0XA 4D0PA 2RQQA 4H4KC 1HLVA 3SHFA 2VKVA 3CUQA 1O3RA 2O5RA 1A04A 4Y13A 2IJLA 3LFUA 2HGCA 3DPUA 1DGWY 5ED4A 5D4RA 1IZ1A 2MW8A 4PK4A 4XLEA 1E2XA 4WCGA 3TBIA 3S1QJ 1EH7A 2QSFX 3I59B 4S0HB 3M8FA 5HNHA 4E6KG 3L2UA 3TKYA 2HYJA 1S8NA 1YO5C 3IP4B 2E1OA 2L4AA 4LITA 3TO7A 2HZTA 1GVDA 3WTTC 4II2A 2EZLA 3BQYA 1S72I 4CGZA 3ZQLA 4AIHA 4IRGA 2HYFA 4JYKA 3V4GA 1XPXA 3QODA 4GCVA 1J2XA 5D6EA 4A6EA 3I59A 4UXNA 2CG4A 5D5VB 2Y0SA 4LIUA 1ZRCA 1P4XA 4A3EJ 1YG2A 2M87A 2RNGA 4ZDPA 1YX5A 2CWEA 4ETSA 4RA2A 2Y48A 1YIOA 4BQOA 2EZHA 2FEZA 3FXKA 3ZMUA 4AD9A 5HS7A 3ABTA 3OYCA 3OIOA 4PDKA 2P6TA 1KONA 4L5EA 1RR7A 2FXAA 4V2FA 3K1MA 2K9LA 5M5YJ 2H09A 2HFHA 1APLC 2X6WA 2HKOA 1LFUP 2DXIA 4XKBA 3EUHA 1Z3YA 2ZXHA 4FISA 3PNTA 3RDIA 2XB0X 3CTAA 4CYDA 3IL2A 2TRTA 1J5YA 1Y56A 2KIUA 3V42A 2RQPA 2LK2A 1R5ID 4C2TA 3AG2H 1MZBA 4ZYEA 5LEJA 1LVAA 4N9IA 1QZZA 2Q8KA 2VOOA 1X1AA 4M72A 3RPQA 4DBRA 3MZHA 5E3OA 4OAZA 1F4KA 4BU2A 4Y3OA 1PUEE 1V54H 1LUJB 2IGNA 4XSZF 2VBXA 2UWMA 2A61A 2XF6A 3GFIA 5TJJA 1TWFJ 2DYSH 2R92J 2VODA 1QU3A 2K9NA 4LMYA 4MQ9F 3T0YA 4C2UA 2QKMB 1TWHJ 3K4MA 3FXQA 4B44A 3JSOA 4BHBA 4IHYA 5BNGA 4HPQA 4BBRJ 4L9TA 3K4BA 4YG2F 3ZQQA 2UUZA 4DZPA 2LNBA 4QPQA 4ANJA 2NNYA 3L9FA 1MBJA 1FLIA 3I4PA 3W6VA 4KJZA 2R7WA 3E5QA 4LB6B 3KLOA 2X9DA 4MO7A 2L02A 2HTSA 3RPUD 5K1YA 1JUMA 4BJTA 5HLHA 4HDVA 1PUFB 4BHPA 2FJ1A 2XUBA 3OWTA 3A0HC 3S3NA 3DTEA 1UAAA 3CCEI 4C2MJ 1OQYA 2VASA 2WV1A 4KMUX 3ZQHA 2M8GX 3QP5A 1E3HA 4LLNA 4RB1A 2Z2SB 4ENKA 3K10A 2GA2A 3BLYA 5JVGF 2IRFG 5L3BA 2JA5J 4A3BJ 9ANTA 4XN3A 4CCOA 3VFZA 1I6XA 2GM4A 1NK2P 2JTVA 4HBLA 2FSWA 2DT5A 2V7FA 3TGNA 4ZYDA 4F92B 3BDDA 4OWRB 1PUFA 2C6YA 3DLLF 5D6FA 2JA6J 4MEXF 4UVAA 3S2HJ 4O6JA 4Z6YA 2YSRA 3RQ4A 3GWZA 3G4SI 1VQ8I 4K2EA 3BG6A 1W0UA 1FP2A 3DEWA 4M3FA 2M34A 5IP9J 3OS0A 3HTSB 3VSLA 4G6TB 3N4MA 3OS2A 3VYTB 1ZLKA 3FXMA 5FRNA 3FMQA 4FT8A 3ZCOA 5IT9Z 1VF9A 4KYWA 3NAUA 4G6QA 2B63J 4L9NA 3UR3C 5EEAA 4PFOA 3BG5A 3A1YA 2F4IA 2GQQA 5LD2C 2VIXA 1D3YA 4JK1X 1DU6A 3RKWA 1BC7C 4CCNA 5E8GA 2EV0A 3S3OA 2IS1A 1X3UA 2K3PA 3NRVA 1U2WA 2ZMEB 1V5GA 2EV6A 4RMNA 5AIPA 4EJUA 3OYJA 3MKYB 1F5TA 2HU9A 3CMEI 4ZTFA 1IXRC 1D1CA 3DKYA 4S05A 1A6QA 2EFNA 1G3TA 3R60A 2O03A 4AU7A 1T0FA 4L0ZB 1K6YA 3S93A 1ZYRF 2EB7A 1KU7A 4XM3A 1D5YA 2Z3YA 1MSFC 4YFNF 1A35A 3OOUA 5E1ZB 5F27A 4HW0A 2Y30A 4P96A 4EGZA 1DP7P 3JAMZ 2W1OA 1Z3XA 4E7SA 1MH3A 2ZMEA 2XB5A 1HBXG 1CQTA 3FK6A 1W5SA 1Z1DA 3VODA 2O8KA 5L3GA 3OYEA 3M1CA 1RC9A 1VQ9I 2JVHA 3U1DA 2V26A 4OIRF 2ADUA 5M3FJ 5DD4A 1MBGA 2EIJH 2KIMA 2XGEA 4D9JA 3ECOA 3KIOA 3WE3A 3R0JA 4KITB 2RGVA 1V5EA 3C2HA 4F55A 4ZZLA 3CCJI 1TT5B 1SMYF 3PNVA 2VB6A 3REOA 3HOTA 2BHZA 3H3ZA 1YJNI 4HV5A 1DU0A 3OL3A 2EV5A 1VQ6I 3FXOA 4AYBA 1X1CA 1LNWA 3HB9A 3V7RA 2CUFA 5FLXK 3EYIA 2D1HA 1VQOI 1VQ5I 2LY2A 1UCRA 2YU3A 3MAJA 2DN0A 3BTIA 1BA5A 2NS8A 4CCKA 3CMYA 2KDZA 1XSDA 1R4MB 2W24A 4BNCA 3KP6A 1QZEA 2DTRA 2WC2A 4BQNA 1I6HJ 2RC4A 4XRMA 1BOBA 3OIPA 1E3OC 2MD0A 1T38A 3CP8A 3W2AA 1MJBA 1YYVA 5BQTA 3JR9A 1UHMA 2J5PA 5FROA 2EH3A 3L2CA 1FJLA 1BI3A 1HC8A 2XVCA 3KLNA 1E3PA 2FUG2 3H3VK 4QWQA 1J09A 3QP6A 4M74A 5ILSA 4BBSJ 1BJZA 4AWXB 3KZZA 2ZNZA 3J80Z 2IGKA 2JQ7A 1IXCA 1LDDA 2DW4A 2EQRA 4P9FA 1TW2A 1G3YA 2CV1A 2K9QA 3R0AA 3DKWA 4BUPA 3T8RA 1FIPA 1HF0A 3ROUA 1TT0A 2OZ6A 1LFBA 2QM3A 2E1NA 4X1EA 2KRHA 3DF8A 3FKIJ 4D5CA 3WHCA 2DA1A 4BE1A 1KU9A 4X6AJ 2LRDA 1NG6A 4II3A 3CJNA 1OCRH 2BY1A 2H27A 5ILVA 4AVZA 4GDFA 4I2OA 3VYUB 1B8IB 4XN0A 2DK8A 4DYQA 2CMPA 2M4GA 3GZNB 5AONA 1HXDA 1XSXA 2LKPA 3F6OA 3VPRA 3HPGA 2OQRA 3LA3A 2HKXA 1VQNI 2IBDA 1B9NA 2ETHA 1CGPA 2QQAA 5JHFA 4JBAA 2D45A 3CP2A 3CJRB 4BL0B 1ZG5A 3IRQA 4MFDA 5IYDJ 4BACA 3GLXA 3SZGA 1YW7A 3OR1C 2ISYA 4QTRA 5LGTA 1OLTA 1FPQA 1B8IA 2OAZA 2IEKA 1PP7U 4UUTA 1ZHFA 2QZ8A 2P81A 3FXUA 5LBQA 5M3MJ 1MNMC 3DTIA 1ETVA 4M3DA 1QO0D 3OR2C 1MKMA 1ZKGA 2X1DA 4IZZA 2JUGA 1BI1A 2BVLA 4GGGA 4ZC3A 4QLCU 2A5WA 1IUYA 2ECBA 3CUQC 3KYDB 2XKOA 4LG3A 2CUZA 2ZKZA 4U7DA 1U9NA 3SZTA 4NDLA 3BT9A 2LVSA 3WGGA 4F91B 3BG9A 5B5EC 1RI7A 4D1QA 4KNYA 5IP6A 3WE2A 1E0EA 3Q9VA 5TRDA 2P5LC 4OU0A 5JR3A 4I76A 1JT6A 1T33A 1GXQA 1BM9A 2EZIA 3FZVA 2WAFA 4PJJA 4BYYA 1BI2A 1BIBA 4CXFA 5CVUA 2M5WA 3JRIA 5KAFC 2VONA 3TMOA 2QSGX 4PJNA 2XAHA 3LSJA 2Y75A 4KICA 1A36A 3E5XA 2LC2A 2OZUA 3NWSA 3OYIA 1MSEC 5DTDA 4IHWA 1REPC 2X85A 1WPKA 1WI9A 4O5VA 1RESA 2E2HJ 1G8XA 1JKRC 3JRDA 3JREA 4ZDOA 3MVPA 2DPDA 2FE3A 2VKHA 4HG2A 3WU2C 4NUBA 3ZQCA 4ZJZA 5GTHC 3CESA 1TQPA 3WTVC 2WY8Q 1EV7A 1RUNA 5FJ8J 4JX5A 1EKEA 3BROA 4KFCA 2L4MA 4M9SA 2MGQA 4B48A 3L1PA 1HKTA 1Z6RA 2M4KA 3COAC 5LLQA 2K5CA 1VQLI 2ZJRF 2FRHA 4KISA 1JKPC 2HOTA 3VDXA 3K6GA 2XSJC 2V4JC 3EUHC 3ZOBA 3VB2A 1R00A 5EYRA 2GBYA 3BG3A 2BHYA 3GX4X 4DOZA 3K4NA 3UNGC 2W85A 2DBBA 4JP0A 1N77A 5JLXA 3CO6C 1P9QC 3AG3H 1U6GA 5TGTA 3DBLB 2CH0A 2VBWA 2GLOA 2E2JJ 2FU4A 3QOPA 5JHUA 3BTLA 1DDNA 2DA4A 2ZXJA 3BOQA 3IC7A 3P9IA 2F4OB 1UELB 1FY7A 3WU1B 4F3QA 1USSA 3S2DJ 1M1EB 4BDZA 4LIVA 5CPRB 3E3VA 3CLOA 1WQ2A 3G71I 2KT0A 2XV4S 2ESNA 2QF7A 3FISA 1H9GA 1P4AA 2JPCA 2CU7A 1X3ZB 4L5IA 3CDLA 3WG7H 3OYGA 3M3YJ 2QQ9A 3CCMI 1FWZA 3MN2A 2LG4A 1QHGA 4P1WA 3DEUA 5AIQA 5J1YA 1BW6A 1P4WA 5E3LA 3OYDA 3GUDA 3CCSI 3P9KA 1U8BA 2A6TA 3T5XA 2MSYA 3MKZA 2V9PA 3P9CA 3HOYJ 3LA7A 3KP4A 3ZMDA 1RETA 3FHZA 5C4JJ 2LTPA 2MA3A 5H20A 1Y8RB 1J7KA 1XCBA 2VXDA 4A5NA 4TV7A 4WXCA 2E71A 2FBIA 2JVGA 5IYCJ 2VXZA 2WAQA 1UMQA 3I56I 1J0RA 4B8XA 1ZGJA 2BY2A 4LG0B 2AQEA 1D0YA 3S1RJ 1XG1A 3ASOH 3FXJA 4PZJA 2Z5UA 3I71A 3SDGA 3PJRA 1IV8A 1U5TB 2F2EA 2W82A 1R5GA 1MBFA 2W48A 4XRSA 1FX7A 3ABLH 2QCOA 4XORA 5M5WJ 3L00A 4ENJA 3HXLA 3ZN0A 1XMXA 1YX3A 1FSHA 4EQQA 4LG0A 2Y9ZA 3GYHX 3O3KA 1IW7F 2P6SA 1IN7A 1Z9CA 2DODA 1L0OC 3D5SC 4A5MA 1U5TA 2QLZA 1IO2A 3LSMA 2H6BA 3DKXA 3KETA 3S1MJ 4QPOA 4I0AA 5TISC 3E5UA 1I39A 4GRIA 4HX7A 1QVUA 3HKZA 1YFHA 3QQAA 1NHAA 1YIJI 1MH4A 3AL0B 3FM3A 2HQNA 4KIFA 2NRAC 1JGSA 5CQGA 1Y0UA 4RLFA 3WTSC 3JAMK 4YEJA 3CC2I 5FB2A 5DV5A 2H8RA 1Q1VA 3SEZA 5KNLA 1XGSA 2VQLA 5IOYA 3A2KA 1W5CC 2X4HA 2ZMEC 2L9RA 3QPLA 3RJPA 4HSRA 3Q3SA 1SD4A 2MFZA 1ODDA 1HW5A 2JWTA 1HKSA 3I53A 4XKCA 2DFFA 1QHHD 3CUOA 1MBKA 4RB0A 4CCMA 2ICWG 1D1AA 1BR1A 1KGSA 4RAYA 3CC4I 1R9TJ 4IVNA 1OMIA 5J3LA 3GXOA 1EA3A 2IGMA 4MFEA 4PSXA 4BGDA 3LQRA 1WJBA 2MC4A 3TP0A 1O57A 2LKSA 4RS8A 1OCTC 1RNLA 3H0GJ 2KKOA 3QPTA 4HQEA 3I4MJ 1IRZA 2K9MA 4GXOA 3DXJF 5KK1A 5J40A 2K27A 3B6CA 2RAEA 1D5VA 1EH8A 1ZARA 4KT6A 1R71A 3Q5FA 1OKRA 4MEYF 1Y1VJ 3C2GA 2CQQA 2LDUA 2YPRA 1U0JA 5D8LB 2QEXI 4A12A 2LKXA 3KEYA 5GP9A 3I55I 2M0CA 3HSRA 2MH2A 5BMZA 1ZELA 3OL4A 3HOZJ 2OUMA 4MQVA 1STZA 3BTJA 3ELKA 5L3FA 1BL0A 3O8GA 4DQ2A 3FM5A 3N05A 3WGHA 5IP7J 3J80K 3JW4A 3K1PA 4RM3A
chains in the Genus database with same CATH topology
3TL4X 4E7ZA 2VIXA 4DBQA 4HSTA 2R7SA 3RCOA 4CCNA 3HOSA 2E1MB 3S3OA 1MMGA 2IS1A 4BQQA 2K3PA 1UG0A 1V5GA 4RMNA 5HLTA 3MKYB 3OYJA 1VZ0A 3HG9A 2HU9A 4ZTFA 1D0ZA 1D1CA 3DKYA 2KLOA 4XLHA 1WJEA 4AU7A 3OY9A 1K6YA 3S93A 3FBIB 4XM3A 3OYFA 1X1DA 4PSWA 3OOUA 4XNFA 1DGRM 2F6CA 3IAS2 1LDKB 4BEHB 4BJ6C 2W1OA 1Z3XA 2WB1A 1HA8A 4JOMA 4E7SA 4X0GA 4IQ4A 2L5QA 3CJQB 2KQRA 2DT6A 4RLQA 3OYEA 3M1CA 3OYMA 2JVHA 2V26A 2F5VA 2VQHA 2V6EA 2X1EA 2WADA 2IS2A 4D9JA 4BE0A 1MNDA 3OYBA 4KITB 1V5EA 2L2OA 3C2HA 2ELJA 3VSKA 4F55A 3OYNA 1X19A 3PNVA 1IRXA 2DOAA 2VB6A 3HOTA 1LFPA 3OL3A 2DCEA 2ZSHB 3DU6A 4AYBA 1X1CA 3IUOA 3H9JA 3L2WA 2XC7A 3MMYB 2LY2A 3LSIA 3QYBA 1T0FC 2LH9A 4CCKA 4B43A 2E60A 2DJIA 4Y33A 4E7KA 3OYKA 1PYVA 4JQFA 4BQNA 1YE9A 2M7BA 1MW7A 3FKJA 1X1BA 4XLAA 1BOBA 1PJRA 3OIPA 3AFHA 4N4OB 2X6XA 2MD0A 4BXFA 4J01A 3W2AA 3CP8A 1N78A 4BS9A 3MKWB 2GOMA 3PSIA 5FROA 4MLOA 4R79A 4HNTA 1X4PA 4XONA 3EUAA 3K70C 2CW7A 2CS3A 2FUG2 1D1BA 1J09A 1N75A 3CF2A 2L9SA 1NG7A 3DTKA 3ONQA 2IGKA 2UV1A 3VYRB 4NNJA 4BJ5C 2XDVA 3OIQA 4XMYA 1OR7C 3H5NA 2VQGA 4PUSA 4ZTJA 2LREA 2MYSA 4U7BA 2CV1A 3LSHA 4BUPA 3PL8A 1TT0A 1MMAA 3PUBA 3QYFA 2XF7A 3EUKL 1JI8A 2BW3B 2KRHA 2LYCA 3ZGKA 4BE1A 2LRDA 1NG6A 4II3A 2WY7Q 5LFAA 4AVZA 3VYUB 3LMMA 4XN0A 2CW8A 4J00A 2CMPA 2M4GA 3HPGA 2CV2A 3I3LA 5JHFA 3CP2A 4NC8A 3CJRB 4FETA 4BL0B 2KL4A 4N4NB 2P0WA 3BG7A 2BW3A 3OYLA 3K4JA 3FDYA 4BACA 5HOOA 3SZGA 2R7XA 3OR1C 3PFYA 4E7LA 3DLAA 1LKXA 1SFKA 1OLTA 2VL8A 2WA0A 4PFPA 2W7NA 3H9GA 1Z21A 1DQUA 2R7UA 2MABA 3SEQA 3BC8A 4Y4RA 2DT7B 3DTIA 1FMWA 2X6YA 3OR2C 3M8JA 4XLCA 2HPIA 2X1DA 3D5RC 1ERDA 2X51A 2JUGA 2VJ5A 4IZZA 2BVLA 4ZC3A 2A5WA 4IX7A 2HVRA 2VJ4A 1WJAA 1DP3A 4LG3A 1D0XA 2CUZA 2OC6A 2IS4A 4F91B 4YRVA 2R7VA 2VJJA 4BDYA 4P5OA 4D1QA 3DU5A 1S9HA 1WJCA 1E0EA 3HC7A 2R7RA 3DQVC 3E1SA 4PJJA 2WAFA 2XAUA 4E7HA 2HQAA 3AKZA 2R7TA 3D5LA 2WBMA 4RM2A 3RTRA 2L9NA 3ZR8X 4BEHA 2VQCA 3TMOA 4PJNA 2L7KA 2PMZA 4C9YA 2LC2A 3NWSA 3OYIA 1MMDA 1W36D 4CCJA 4PJMA 5CKTA 1WJFA 2CFOA 3IAM2 1BR4A 2X85A 4IQJA 1R6RA 4YELA 1G8XA 4ZDOA 1SAUA 2NOJB 2RREA 2VKHA 4HG2A 4NUBA 2KDOA 3QOEA 1AA7A 4U87A 4ZJZA 2QKLB 3NWTA 3CESA 1Z7LA 2R7QA 2ZSIB 3QYEA 2WY8Q 1MMNA 3HL2A 4B48A 4XLFA 2M4KA 2VPLA 2K5CA 3LL7A 4KISA 3F9KA 1Y6IA 4CH7A 3EPZA 3VDXA 3K6GA 4F93B 2XSJC 2V4JC 3EUHC 3K4LA 2KRCA 4XKVA 3W2WA 2KP6A 3E0JB 2BVMA 4DOZA 3K4NA 3UNGC 1WJDA 3K4CA 4CSWA 4NQWB 1FMVA 1N77A 3L2QA 1P9QC 2KPMA 4F52A 4HNUA 3J7AY 3LSGA 2IXSA 3H9QA 4ITVA 2PJRB 3I9V2 3L2RA 5TGTA 4XOPA 3OYAA 3HUGB 3DWLE 2CH0A 2RQQA 4H4KC 2HDWA 2LBFB 2VLAA 2V1NA 2O5RA 3KX2A 3LFUA 1UELB 1DGWY 3DPUA 4B3XA 4F3QA 4ZYAA 3MD2A 4BDZA 3W2VA 2BOLA 4PK4A 4XLEA 4LIVA 5CPRB 2KMUA 3TBIA 2PJRA 4DGWB 3DPLC 4BE2A 5HNHA 2W4SA 4OAYA 3OYGA 1G59A 2LBFA 1BR2A 4E6KG 3L2UA 2LOOA 2LG4A 2IS6A 1QHGA 2M3AA 3KYLA 4P1WA 3IP4B 2AQFA 4LITA 2WAEA 4II2A 3OYDA 4PJLA 3FHNA 3G2BA 2XF5A 2A6TA 5KCMA 3MKZA 3AL0C 3QODA 2KHMA 2IGOA 4E4HA 2VJIA 2Y0SA 3GBGA 3S32A 4LIUA 3DEEA 2KZVA 2RNGA 2VXDA 4ZDPA 5HVQC 4CCLA 1YX5A 4XL9A 2JVGA 2VXZA 4BQOA 1W36C 2WAQA 2E5NA 3PNYA 5CQEA 3OYCA 2AQEA 1D0YA 2M0MA 1KONA 2Q2EB 3H5AA 3LSKA 3U21A 3RSNA 3PJRA 2K9LA 2HVQA 2JA2A 2W82A 2Z16A 2X6WA 4C30A 3L2VA 2ZFUA 2DXIA 4XKBA 1Z3YA 2ZXHA 4XORA 3PNTA 2GOXB 3HXLA 3SYTA 2HZDA 1Y56A 3V42A 4EATA 3VWBA 2M7AA 1YX3A 4C2TA 1TZLA 3A4CA 5KHDA 3DPTA 1X1AA 4DBRA 3D5SC 1WJ5A 2E5ZA 3VYSB 2HPMA 2VKDA 3LSMA 4OAZA 5FRMA 1V5FA 4BU2A 4FASD 3CMMA 3DKXA 4Y3OA 3OYHA 2IGNA 2X1CA 4QPOA 2UWMA 4GRIA 2XF6A 2Q1ZB 4CA0A 1QU3A 3CZ6A 2OV7A 3HKZA 2CUJA 4C2UA 2QKMB 3H0DA 3AL0B 3K4MA 4B44A 2Z1DA 1X4OA 3FBNB 4HPQA 4E7JA 3K4BA 5CQGA 3W3CA 2W00A 4RLFA 4HEA2 3BCBA 3ZQQA 2UUZA 2LY1A 4YEJA 1LVKA 3ZXSA 4E7IA 4QPQA 4ANJA 2HNHA 4NC7A 3SEZA 5KNLA 4KJZA 2E1MC 2VQLA 2R7WA 3A2KA 3BCAA 3S3MA 3RPUD 4ZDLA 4BJTA 4CUGA 2R7OA 2V9KA 3HPHA 4HSRA 4B47A 3OS1A 3OWTA 3S3NA 3DTEA 1UAAA 2MFZA 2VASA 2JSPA 4XKCA 3H35A 1QHHD 4CCMA 1D1AA 2Z2SB 1BR1A 3K10A 2CV0A 3BLYA 1EA3A 1T95A 2IGMA 4XKWA 4XN3A 4PSXA 3S8PA 3ZRGA 4CCOA 4IKFA 4BGDA 4XQFA 1WJBA 2V7FA 2MC4A 5HNFA 3PSFA 2ZXIA 4OWRB 4F92B 2K9MA 4DJAA 3K70D 3SDBA 4KT6A 3RQ4A 4XR6A 1GLNA 3OMYA 3BG6A 3C2GA 1U0JA 1WFXA 3OS0A 3H5RA 3KEYA 3VSLA 4G6TB 1ZELA 3OS2A 3K4KA 4XOTA 2I8DA 3OL4A 3VYTB 4HRIA 2OUMA 1MNEA 3ZCOA 5FRNA 2HVSA 2R4GA 3UR3C 4PFOA 4CZCA 3N05A 3A1YA 2F4IA 4DIQA 5LD2C 4RM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KP6 A; 
#chains in the Genus database with same CATH topology
 4E7Z A;  4ZYG A;  3B02 A;  4HST A;  2FMY A;  3EYY A;  2F5C A;  1JT0 A;  1G2H A;  3RCO A;  3LOC A;  5JLW A;  2B9S A;  1W1W E;  3ECH A;  1VZ0 A;  4Y52 J;  1G3W A;  2ZJQ F;  1FBQ A;  4M71 A;  4CYC B;  3OY9 A;  1K61 A;  3TOA A;  1IGN A;  3PM1 A;  4G12 A;  5HOD A;  4PSW A;  2DFH A;  3FWE A;  4N9H A;  1EH6 A;  1EF4 A;  4LFU A;  1LDK B;  4EGY A;  4AIJ A;  4BJ6 C;  4JOM A;  2BY3 A;  4IQ4 A;  2XAS A;  2KQR A;  5F0F A;  3OSG A;  2XRN A;  4RLQ A;  2BY0 A;  3ML6 A;  2O0Y A;  3HZJ A;  4KN4 X;  3HRS A;  4A69 C;  4DNC A;  4CYC A;  2VQH A;  2X1E A;  1BJA A;  2IS2 A;  4FTH A;  2NVU B;  4EM2 A;  1FEX A;  2LY9 A;  1TW3 A;  3KEQ A;  4BHC A;  2ZCW A;  4BE0 A;  2DJN A;  3IH3 A;  4DZJ A;  2L54 A;  3VSK A;  4ESB A;  2RNJ A;  1QRY A;  4G6D A;  2DOA A;  2WAQ N;  4RDU A;  3AAF A;  3DU6 A;  2L9V A;  3K69 A;  4U0V A;  4GYI A;  1X3W B;  2DA2 A;  1ETW A;  2GAU A;  3KFW X;  2DDB A;  4A3J J;  3LSI A;  3QYB A;  1IDY A;  1ETO A;  2LH9 A;  4FCY A;  4HX4 A;  4UHT A;  2JMW A;  4Y33 A;  5DYM A;  4E7K A;  1PYV A;  3V7C A;  2V79 A;  1YE9 A;  1OCP A;  1RR8 C;  1D8J A;  2M7B A;  2HOE A;  1X1B A;  2W57 A;  3BR5 A;  1PJR A;  4N4O B;  2X6X A;  4I02 A;  1N25 A;  1S7E A;  1N78 A;  4A93 J;  3MKW B;  1K7A A;  3PSI A;  1QNT A;  1X4P A;  5CJ9 A;  2LP0 A;  2BE5 F;  2K4J A;  5ICG A;  1POG A;  1TQI A;  2X48 A;  2CS3 A;  1YIT I;  3BTC A;  3F22 A;  3KP7 A;  2DI3 A;  2DTZ A;  1N75 A;  2L9S A;  1NG7 A;  3DTK A;  4R8H A;  3VYR B;  4NNJ A;  4BJ5 C;  3I4N J;  3K7A J;  4B4C A;  2HOS A;  2IT0 A;  3U2R A;  3HDD A;  2GA1 A;  3E97 A;  4PUS A;  1FIA A;  2JN6 A;  4U7B A;  2WTE A;  2PJP A;  2F4M B;  3LSH A;  2Y9Y A;  1JXS A;  3HOU J;  3PUB A;  3BR0 A;  1W4M A;  2XF7 A;  3EUK L;  4RGS A;  4MTE A;  1IRF A;  2Z99 A;  2IA2 A;  1U8R A;  2I10 A;  3ZGK A;  4W97 A;  4A3K J;  5EJC A;  1F1Z A;  5EEG A;  4ESF A;  4LD5 A;  1H9T A;  5IPA A;  4S04 A;  2CW8 A;  4U0Y A;  5K5Q A;  3J81 K;  4G7H F;  3CCY A;  2UXX A;  3K0L A;  3PFI A;  4ZH4 F;  4AIK A;  3I3L A;  2HQR A;  2E36 A;  2HDD A;  4FET A;  2R93 J;  4UB6 C;  2L7F P;  1ETX A;  1IC8 A;  5E17 F;  4N4N B;  2PBI A;  2MH9 A;  3FMS A;  4G94 A;  2AHQ A;  3OSF A;  3PFY A;  1SVO A;  4UVB A;  3WGI A;  4LGW A;  3WTW C;  1R58 A;  5D8K B;  4DYC A;  2VL8 A;  3JRA A;  4PFP A;  3P5J A;  4I98 B;  2HYG D;  4WWC A;  3H9G A;  4ASN A;  3AG4 H;  5J8C A;  2NS0 A;  2HOA A;  3F6V A;  2Y2Z A;  2A05 A;  3S15 J;  2OD5 A;  2E2I J;  2OA4 A;  4EMS A;  3A02 A;  2VJ5 A;  5GAG J;  1OYI A;  3ZQF A;  3F8M A;  1QGP A;  4IX7 A;  5HDN A;  2OCE A;  1DP3 A;  2OC6 A;  4I01 A;  2IS4 A;  1W7P B;  3HYI A;  3FXL A;  4YRV A;  3RI4 A;  1BN5 A;  1ON2 A;  2XRL A;  3FXR A;  1B9M A;  4W1U A;  4A0Z A;  2R5Z B;  1RPW A;  2H1K A;  1XX5 A;  1VI0 A;  2Y0S N;  1VQ4 I;  1YLF A;  2DMT A;  4A3I J;  2Z33 A;  5GTI C;  2DU9 A;  3E6B A;  2WBM A;  2OPT A;  1LDJ A;  3RTR A;  4PCQ A;  2CQ7 A;  2L9N A;  2NXN B;  4M6Y A;  2VOP A;  3H36 A;  1OR7 A;  1B6A A;  1W7P A;  3GEZ A;  1PP8 F;  3ABU A;  5F0H A;  3SQN A;  2PMZ A;  2D1V A;  2QYO A;  1WZ2 A;  1S6L A;  2ZBK A;  2CQX A;  2CSO A;  2R5Z A;  4IHX A;  2CFO A;  1BR4 A;  4IQJ A;  5GPC A;  1WKM A;  1IG7 A;  4LJZ F;  2XAQ A;  1ITY A;  3TED A;  1C0W A;  2FQ3 A;  2QVO A;  2DA6 A;  5CVR A;  5F08 A;  2O9L A;  1ETY A;  2RRE A;  4G9Y A;  4WXH A;  2HI3 A;  2LLK A;  4HF2 A;  1D8K A;  1R1T A;  2KZG A;  5C3E J;  3C3W A;  3BR6 A;  4I0B A;  2KFD A;  1YQA A;  2ZSI B;  3ZQ7 A;  4BQA A;  2O3F A;  3MCZ A;  4FX0 A;  2MC3 A;  1X1P A;  1XTA A;  1SFO J;  2F48 A;  3LL7 A;  2JSC A;  1VQK I;  2KIQ A;  1XGM A;  3ZQI A;  2A69 F;  2FBH A;  3TO9 A;  3ERM A;  5E8I A;  3G6E I;  3JTG A;  2O6G E;  2EIN H;  2BEO A;  3GTG J;  2FA5 A;  3BJO A;  2ZC2 A;  2L0K A;  2JRT A;  3W2W A;  1JHH A;  2KP6 A;  1T08 B;  1OFC X;  2L01 A;  4NQW B;  3A03 A;  4F52 A;  4HNU A;  3J7A Y;  3LSG A;  2OJE D;  2GXG A;  2IXS A;  3H9Q A;  4A3G J;  2STW A;  3L2R A;  4XOP A;  3OV8 A;  2F5F A;  2DA3 A;  1HCR A;  2A5Y B;  1HSJ A;  2ESH A;  3QRF F;  1UHS A;  2HDW A;  3QPH A;  1ZG1 A;  5BPD A;  1AHD P;  3EET A;  1U5T C;  2X6O A;  1HDD C;  4WXD A;  5DCM B;  2HEO A;  2BZT A;  3KX2 A;  5DM7 F;  5E3N A;  4EJV A;  2F5D A;  3KP3 A;  4ZYA A;  1R1U A;  2K40 A;  3W2V A;  2EA4 A;  2E7W A;  2EWN A;  4NQW A;  5D5W B;  2ID6 A;  2KMU A;  3G1L A;  5DM6 F;  4OIN F;  4BE2 A;  5E20 A;  2KRF A;  3N97 A;  2W4S A;  1G59 A;  3EQL F;  3GME A;  1DUX C;  2CGP A;  2LOO A;  3ABM H;  2A6E F;  3G1M A;  3WTX C;  2OCC H;  1JGG A;  5DCM A;  2IS6 A;  1FTZ A;  1LE8 B;  4WK8 F;  4HDU A;  2BXZ A;  4WF2 A;  2DAO A;  4KN7 X;  1J59 A;  2O61 A;  1G6N A;  3FHN A;  2ISZ A;  2ZJ2 A;  1RKW A;  3G2B A;  1KYZ A;  3LAP A;  3AL0 C;  2AO9 A;  2EIL H;  3HRU A;  2KHM A;  4EV0 A;  4RAZ A;  4HLY A;  1UB9 A;  4E4H A;  2VJI A;  3GBG A;  4IXA A;  3S32 A;  1SC7 A;  2HS5 A;  4GYG A;  3ASN H;  2KZV A;  2VKE A;  2P7C B;  5HVQ C;  4CCL A;  1P7I A;  2VT2 A;  4AC0 A;  3TDZ C;  2FF4 A;  2MBF A;  4PGG A;  1UHW A;  2R7D A;  3V8J A;  1OYW A;  4LOC A;  3PNY A;  4AVP A;  3HSE A;  5GAH J;  4HAM A;  2M0M A;  2A07 F;  2Q2E B;  2K86 A;  4P55 A;  4LB5 A;  1T6S A;  2V6C A;  3MFK A;  4IHS A;  2JA2 A;  2DMU A;  3SJM A;  1YHQ I;  1Z6T A;  4BKX A;  2EJR A;  2W25 A;  3H3U A;  3FF5 A;  3PQK A;  2IW5 A;  3SYT A;  4IRI A;  4AM3 A;  2HZD A;  3D0S A;  1ETK A;  2K7L A;  1RKT A;  1UJ8 A;  1ZQ3 P;  3A01 B;  1BW5 A;  4EAT A;  2DPU A;  1TZL A;  2DQL A;  4HOB A;  3F72 A;  2D2W A;  1RZ4 A;  2Q2E A;  4NBQ A;  5D4S A;  1JUP A;  1Y8Q B;  3CLQ A;  4Y17 A;  4YII A;  3GTP J;  2RVC A;  3B73 A;  3Q0U A;  1WJ5 A;  5FD6 A;  3VYS B;  5FRM A;  1LEA A;  2VKD A;  1GUU A;  3OOP A;  1ZRD A;  4O3M A;  3CMM A;  2EPF A;  1V55 H;  3WTY C;  1XC5 A;  1SEU A;  2X1C A;  4XLN F;  3BJA A;  4CA0 A;  1YI2 I;  3NAR A;  2OV7 A;  5BS6 A;  1YJW I;  3NEU A;  2I5U A;  1NK3 P;  1R49 A;  3H0D A;  4QIW N;  3A01 A;  5FKK A;  5JVT A;  1X4O A;  4E7J A;  2G7U A;  1ZGA A;  1Y1W J;  2DMQ A;  3W3C A;  1NTC A;  2XAF A;  3BCB A;  1YW8 A;  2LY1 A;  4E7I A;  1LVK A;  2R5Y B;  3V8K A;  5D5X B;  2PMZ N;  2STT A;  5KAI C;  4AYB N;  3MZ8 A;  1TWG J;  2HNH A;  3B6A A;  4I7H A;  2K9S A;  2KJC A;  3BCA A;  4KDP A;  1U3E M;  3IKT A;  2QBY B;  4ZDL A;  3FIW A;  4RGX A;  3HIF A;  4CUG A;  2V9K A;  1FOX A;  4C3I J;  4B47 A;  4B3A A;  4YFX F;  1SD6 A;  1ZTR A;  1S7A A;  4RB3 C;  3PIO F;  1JKQ C;  5CYV A;  2JA7 J;  2OU2 A;  1X2M A;  4IHV A;  4A3L J;  3IWZ A;  3H35 A;  1B59 A;  4IHT A;  3HSF A;  4G7O F;  2R5Y A;  2CV0 A;  5EEH A;  3H1C A;  4AUX A;  4BXU A;  3ABK H;  3PIP F;  2CW0 F;  1T95 A;  1TLH B;  4XKW A;  4FE4 A;  4KIG A;  4RGR A;  3ZRG A;  1T8I A;  2YUS A;  4XRS G;  1KQ0 A;  4XQF A;  1O4X A;  1U9O A;  5JI6 A;  5HNF A;  2QBY A;  1XSV A;  3QU6 A;  4OMY A;  3C18 A;  3GFL A;  3K70 D;  1V4R A;  1IN4 A;  4LLL A;  2XPW A;  3ZMZ A;  5B3S H;  4OIQ F;  1GLN A;  3KE2 A;  3RQI A;  1PVE A;  1WWX A;  3H5R A;  3R4K A;  3HRM A;  1K6O A;  2PI0 A;  3K4K A;  3LA2 A;  4HRI A;  2ELH A;  1W7P D;  1MNE A;  1Q1H A;  2MG4 A;  1YOV B;  1E17 A;  4CZC A;  2L3D A;  2DMP A;  4V19 K;  4DIQ A;  3E7L A;  5F1R A;  3BJ6 A;  3CDI A;  2UXN A;  3F3X A;  3Q0W A;  4DBQ A;  1SD5 A;  1FYM A;  4IRH A;  3JRB A;  5J4Y A;  4EM0 B;  4HZF A;  5DDG A;  2PEX A;  2E1M B;  3CCQ I;  1IJW C;  1H88 C;  1WHU A;  4BQQ A;  1UG0 A;  2CO5 A;  3GCM A;  2XSD C;  5EG0 B;  4XLH A;  2MLG A;  3G1O A;  1UFM A;  2O8X A;  4F7Z A;  5C4X J;  3DBR B;  5FLX Z;  5K7Z A;  4XNF A;  3KCC A;  5IT9 K;  2F6C A;  1ON1 A;  1SMT A;  3IAS 2;  4BEH B;  2WB1 A;  1HA8 A;  4HQM A;  3CJQ B;  2FML A;  1TQM A;  2DT6 A;  2EFW A;  4KIB A;  3TDU C;  3TQN A;  1T56 A;  5EG0 A;  1ONV A;  3C2B A;  2R3S A;  4XSX F;  4RAF A;  2F5V A;  2WAD A;  1QPI A;  1MND A;  3OYB A;  1W0T A;  2L2O A;  3OYN A;  5HDK A;  2ELJ A;  1QQI A;  1BI0 A;  5KVR A;  3LAJ A;  2EA2 A;  1X19 A;  1XGN A;  5CLS A;  1IRX A;  1SAX A;  3ZN1 A;  3GO5 A;  1LFP A;  5CVV A;  4PGH A;  1AU7 A;  2DCE A;  2BGC A;  3K2A A;  5EZG A;  1GDT A;  2M1B A;  4XBF A;  2PN6 A;  3G3Z A;  1QBJ A;  3L2W A;  2XC7 A;  2EFP A;  2HDC A;  1T0F C;  1AWC A;  1LJ9 A;  2DLL A;  1TC3 C;  2E60 A;  2OTJ I;  4KMF A;  5J6X A;  3OYK A;  3MWM A;  2COM A;  1MW7 A;  5IT3 A;  2JJ7 A;  2QUF A;  3AFH A;  3PO3 J;  4BXF A;  4J01 A;  3BP8 A;  3GTK J;  3MEX A;  3HOV J;  2GOM A;  2EIK H;  4MLO A;  2XPV A;  4R79 A;  1UG2 A;  3J7Z I;  4XON A;  3HHG A;  3EUA A;  4NB5 A;  3K70 C;  3C1D A;  1XCV A;  1B72 B;  2DA7 A;  1YRN B;  1D1B A;  4R1H A;  1Z0X A;  3TP3 A;  2VBZ A;  1R36 A;  3BR3 A;  2K4B A;  1S29 A;  3CF2 A;  5F0C A;  3K2Z A;  3I58 A;  3KP5 A;  2UV1 A;  1P2F A;  4M9X A;  4YIF A;  2N8G A;  4XMY A;  1OR7 C;  1VND A;  2MYS A;  3SXY A;  2W84 A;  5B1A H;  2P7V B;  1ZH5 A;  2GIV A;  2CFX A;  2NYX A;  1JJ8 C;  1FYL A;  1HW2 A;  2ZO4 A;  1S7O A;  5E18 F;  5A2Q Z;  1JI8 A;  2CRG A;  4KUM A;  1I3Q J;  2LYC A;  1YRN A;  3HGG A;  2UZK A;  5FD5 A;  4RB2 C;  2FBK A;  5K7H A;  4IL6 C;  3LMM A;  2PX9 A;  3GTO J;  5ICF A;  1B1B A;  2TCT A;  1QA6 A;  3TOB A;  1K83 J;  2COB A;  1ZLJ A;  4BAY A;  1AOY A;  1SFE A;  2YX4 A;  4NC8 A;  4XIC A;  2E1C A;  2NS7 A;  2VN2 A;  3KZY A;  1SD7 A;  2NVT J;  1X58 A;  3BG7 A;  2QWW A;  2FOW A;  3OYL A;  1F43 A;  1FBS A;  3WHB A;  4QSH A;  4ENN A;  3K4J A;  5J4V A;  4RBO A;  2R7X A;  2PMU A;  4EVI A;  5GAE J;  1YTY A;  2QA4 I;  1LKX A;  1SFK A;  2XPU A;  5DD8 A;  2IP2 A;  2W7N A;  3CCV I;  5FKL A;  4C3J J;  2V1U A;  1Z21 A;  4WX9 A;  1DQU A;  1HST A;  1VFC A;  3JRH A;  2G7H A;  4FE7 A;  1WGX A;  2X6Y A;  4Q48 A;  2M30 A;  2GIZ A;  2ZB9 A;  3M8J A;  3GW2 A;  4XLC A;  3D5R C;  2XRO A;  1ERD A;  2X51 A;  1XN7 A;  2E35 A;  5K7F A;  4M3E A;  1KU3 A;  3I64 A;  2E34 A;  2VJ4 A;  2EIM H;  5L3D A;  1D0X A;  2H6C A;  1ZRE A;  4OMZ A;  4Y15 A;  4BDY A;  5M5X J;  4P5O A;  2B0L A;  3DU5 A;  1S9H A;  3I0T A;  1RIO H;  4L0Y B;  3CCU I;  3HC7 A;  3DP7 A;  2JA8 J;  4IO9 F;  5J47 A;  1KZH A;  3DQV C;  2JRM A;  2F5E A;  1FTT A;  2HQA A;  3AKZ A;  4N0B A;  1QVT A;  2R7T A;  3GZ6 A;  3BR2 A;  3GLL A;  1HQC A;  1ZAO A;  3E6C C;  1SFU A;  1MIJ A;  4C9Y A;  3IRR A;  1U78 A;  1KQ8 A;  2V1D A;  4AID A;  5HS8 A;  1MMD A;  4D7M A;  1W36 D;  1I1G A;  4FHT A;  1Y0N A;  3O6B B;  5CKT A;  2ELK A;  5FKO A;  1OIS A;  5K5O A;  3IAM 2;  1R6R A;  1DPR A;  3F8N A;  4YEL A;  1SFX A;  2GWR A;  1GV2 A;  2WB1 N;  4KT5 C;  5E1X A;  3ZMS A;  3M7G A;  5FFZ A;  1J75 A;  3ZP5 A;  2R0Q C;  2EK5 A;  2HR3 A;  4L9V A;  2BBY A;  3UKG A;  4ABZ A;  4EJW A;  2ME6 A;  3MKL A;  2KDO A;  3QOE A;  4GFB A;  1SAN A;  1AA7 A;  4U87 A;  4LK0 F;  2QSH X;  3IHU A;  4XID A;  1O7F A;  2R7Q A;  2QGU A;  1MMN A;  1Z7U A;  3HL2 A;  1MJA A;  3CJT B;  2YS9 A;  4A3C J;  2PQ8 A;  3MQ0 A;  3Q9S A;  2VPL A;  1T2K A;  2BV6 A;  2HXI A;  2NVX J;  1HOM A;  1GV5 A;  2HQ5 A;  1VQP I;  5IYB J;  1MD0 A;  2O7O A;  3F8F A;  1Y6I A;  3EPZ A;  2VUM J;  5BOX A;  3F8C A;  2IVM A;  3HKZ N;  2ACJ A;  3EDP A;  1TWA J;  5LRR A;  2BVM A;  2E7X A;  3K4C A;  3F23 A;  1S3J A;  3JSP A;  3HHH A;  4XLP F;  1YJ9 I;  1FMV A;  2M2E A;  3L2Q A;  2Y0M A;  3E6M A;  4UV8 A;  4ITV A;  1ACI A;  2PJR B;  3OYA A;  3HUG B;  4RGU A;  1QZY A;  2M45 A;  3DWL E;  4J19 A;  3CCL I;  3JRC A;  2LBF B;  2VLA A;  3Q0V A;  1A5J A;  1ZG3 A;  4UY8 I;  2V1N A;  2J5O A;  3F0C A;  1MMS A;  2EFO A;  1KU2 A;  2X0L A;  2M8E A;  4B3X A;  1IV6 A;  2LFB A;  4MGR A;  4G8X A;  2MD5 A;  3MD2 A;  2BOL A;  5D5U B;  1T98 A;  5FLM J;  1OJL A;  2M9H A;  4I09 A;  1WSU A;  1O7L A;  3K1N A;  3WG9 A;  2PJR A;  3F8B A;  4DGW B;  3HUG A;  3DPL C;  4D5F A;  2DDA A;  2NNN A;  3CQZ J;  3JTH A;  4OAY A;  2LBF A;  1BR2 A;  2A68 F;  4H0E A;  4I99 C;  5HDG A;  2JT1 A;  2AXL A;  2M3A A;  2XGD A;  3T1B A;  3KYL A;  3F21 A;  2AQF A;  3SFZ A;  4HLX A;  2PFB A;  1O3Q A;  2WAE A;  4NC6 A;  3ZPL A;  2JPB A;  4PJL A;  1ZR4 A;  4M73 A;  3RKQ A;  1IDZ A;  2XF5 A;  4ENM A;  5LHH A;  5KCM A;  3HOW J;  3I5U A;  4HF0 A;  3IH2 A;  2IGO A;  1WH5 A;  5J8F A;  1OPC A;  3LFK A;  3DEE A;  4E70 A;  3WTU C;  3PUF A;  1PDN C;  3J7A O;  3JCU C;  3V8L A;  4M6X A;  4ZYH A;  1RRJ A;  3GF2 A;  4UVC A;  4XL9 A;  3VEP A;  1W36 C;  3M1E A;  2E5N A;  2VE8 A;  3LSP A;  5CQE A;  1K4S A;  2XAJ A;  3H92 A;  5F04 A;  5F1J A;  3L09 A;  2GXA A;  2DOF A;  3BQZ A;  3H5A A;  3ZQG A;  3LSK A;  3U21 A;  3RSN A;  2BXY A;  1QPM A;  2K3F A;  2Y69 H;  2HVQ A;  1LPQ A;  3J7Y J;  1OYY A;  3FK7 A;  2Z16 A;  2AS5 F;  3L2V A;  4C30 A;  1P6R A;  2ZFU A;  3S2W A;  1Z91 A;  2XIG A;  3GTQ J;  3LNQ A;  2GOX B;  3WOD F;  2CUE A;  3LQQ A;  2DQR A;  3C7J A;  3HRT A;  3HM5 A;  2FD5 A;  1W5T A;  4A2U A;  1Y39 A;  1TBX A;  2JZY A;  1XS9 A;  3VWB A;  2M7A A;  2VT3 A;  3GTL J;  2NVQ J;  5ICE A;  3A4C A;  3KEO A;  4OOI A;  5KHD A;  3DPT A;  1WVR A;  1H8A C;  2G9W A;  3KP2 A;  3IKV A;  2E5Z A;  2ZXW H;  3ISP A;  3W6J B;  2FQ4 A;  2HPM A;  1A31 A;  1V5F A;  2ZFW A;  4FAS D;  3A0B C;  4L5J A;  3LST A;  3OYH A;  1T39 A;  4LK1 F;  4EM1 A;  4Y7N J;  2VE9 A;  3S14 J;  2Q1Z B;  3M4O J;  3CZ6 A;  2ZJP F;  1WH7 A;  2CUJ A;  1IN8 A;  2L7M P;  3RKX A;  2Z1D A;  2R7Z J;  2RV8 A;  4HYE A;  1FNN A;  3FBN B;  2R7F A;  3O8H A;  5IOZ A;  4G7Z F;  1I27 A;  5L3E A;  5JFR A;  2XKP A;  2W00 A;  1VQM I;  4HEA 2;  5E79 C;  1BOA A;  1FC3 A;  3ZXS A;  2ECC A;  4UUS B;  3DFG A;  2K85 A;  1YS7 A;  1WRJ A;  2DYR H;  4NC7 A;  3CD6 I;  2E1M C;  1MBH A;  2MLK A;  3U1K A;  1DPU A;  1YW9 A;  3S3M A;  2HTJ A;  1ZK8 A;  4UNO A;  2R7O A;  3HPH A;  1XGO A;  1SVM A;  1FZP B;  4U0W A;  3OS1 A;  1GXP A;  1XB4 A;  2XHK A;  2ME0 A;  1I5Z A;  2FNA A;  2L7Z A;  1FOK A;  2OF7 A;  2CYY A;  2JSP A;  2OTL I;  4DW6 A;  1IXS B;  2RKH A;  3KYC B;  4A0Y A;  1P7J A;  1ZRF A;  5F64 A;  2LF7 A;  1JTY A;  4UUS A;  4B1R A;  1TNS A;  4OIP F;  1IUF A;  1FYK A;  3S8P A;  2P5K A;  4IKF A;  1O3T A;  5F6F A;  3PSF A;  2ZXI A;  2FNP A;  1WCM J;  1Z05 A;  2EZK A;  4GO1 A;  4DJA A;  4M3B A;  3L7W A;  1TWC J;  3SDB A;  5IY5 H;  4XR6 A;  3BPX A;  1VTN C;  1MDM B;  3OMY A;  3W6K B;  4A3F J;  5BPI A;  2QEN A;  3FX3 A;  4JX6 A;  1WFX A;  4Q4Z F;  4HX8 A;  2D5V A;  2K02 A;  1LQ1 A;  2YX7 A;  4XOT A;  2I8D A;  2DFE A;  2FOK A;  3RYP A;  2VC0 A;  1OCZ H;  4FX4 A;  2HVS A;  2R4G A;  1KA8 A;  3TW6 A;  5L3C A;  4M9Z A;  3ESW B;  3TL4 X;  1I3A A;  5DEQ A;  1KYW A;  3TO6 A;  5DS9 A;  3AG1 H;  1MDM A;  2R7S A;  5FKN A;  3RYR A;  3HOS A;  1R5H A;  3HBL A;  1MMG A;  3JRG A;  2XGC A;  5HLT A;  3GZ5 A;  1H89 C;  5H6R A;  5J1U A;  4HNV A;  3HG9 A;  5A2Q K;  1GT0 C;  2EFQ A;  1LE8 A;  4NHJ A;  1D0Z A;  1FSE A;  5EDN A;  4OIO F;  2KLO A;  5ILU A;  3S16 J;  1WJE A;  4CZZ A;  5LEK A;  3CDH A;  3FBI B;  3BY6 A;  3M9A A;  2RDP A;  4YFK F;  4IEJ A;  5DUK A;  1ETQ A;  3OYF A;  1X1D A;  4Q5S F;  1HKQ A;  4UV9 A;  5FFX A;  1DGR M;  2LF8 A;  2VI6 A;  3QAH A;  2LSO A;  3RZO J;  5E1W A;  4X0G A;  4EJT A;  2L5Q A;  3JRF A;  4IOA F;  3S1N J;  2KIF A;  1R7J A;  3OYM A;  3O2P E;  1ENH A;  4KA4 A;  3HJE A;  1V3F A;  1YS6 A;  2XAG A;  3E6D A;  2V6E A;  1Z67 A;  3SFI A;  4IF4 A;  1CF7 B;  1R1V A;  1HW1 A;  1JTX A;  2IA0 A;  1XD7 A;  1K79 A;  1R23 A;  4Q47 A;  4ON0 A;  4CDG A;  2IAI A;  4BXX J;  3VOE A;  2ZSH B;  3ERE D;  2G0E A;  3KPH A;  4XK4 A;  1JHF A;  1FT9 A;  1MJ9 A;  2NVY J;  3IUO A;  3H9J A;  3MMY B;  3TW7 A;  2JUC A;  3PQJ A;  1XMK A;  2Z9O A;  3BZK A;  2IA1 A;  1H0M A;  4B43 A;  1OCO H;  2DJI A;  2DMN A;  1G3S A;  1IAW A;  1HDP A;  2A6H F;  3CO7 C;  5B1B H;  1CF7 A;  4JQF A;  4FQG A;  1FOW A;  4ZZD A;  3FKJ A;  1KQ9 A;  3FMR A;  4XLA A;  3ULQ B;  4JX4 A;  3MZY A;  4D7N A;  4L9J A;  2E19 A;  2H94 A;  1UZC A;  2PG4 A;  2ZNY A;  2H1L A;  4BS9 A;  3BR1 A;  2NAZ A;  4HNT A;  1F36 A;  2KJB A;  5K5R A;  4XRF A;  3J81 Z;  5ERI A;  4BY7 J;  4CHU A;  4HF1 A;  2CW7 A;  4RAG A;  2PLY A;  2KIS A;  4C3H J;  3V7S A;  1JJ6 C;  3ONQ A;  2EBI A;  2PMH A;  4YIR X;  1O3S A;  3GTM J;  3M07 A;  3X2Q H;  2XDV A;  2DO7 A;  3CMA I;  1IN6 A;  3OIQ A;  1IRG A;  3H5N A;  2VQG A;  1K78 B;  4ZTJ A;  3QU3 A;  2LRE A;  3RZD J;  3IH4 A;  3PL8 A;  2FX0 A;  5FO5 A;  2DOE A;  3S17 J;  1MMA A;  3QYF A;  1GVJ A;  4MIM A;  2BW3 B;  1JE8 A;  1TTY A;  2QQ8 A;  2GZW A;  2WY7 Q;  2WV0 A;  5LFA A;  1BC8 C;  5FLV A;  2CQK A;  4J00 A;  3K9T A;  1FBU A;  1UST A;  2CV2 A;  2Q0O A;  1K78 A;  3KZI C;  1I1S A;  2YR2 A;  1RUO A;  4IOC F;  1OCC H;  1R22 A;  2AXT C;  2KL4 A;  3QWL A;  2P0W A;  1FOY A;  2BW3 A;  5FGM A;  5H2F C;  4MTD A;  2V1X A;  3FDY A;  1BBY A;  5HOO A;  4U88 A;  5J1R A;  5LRS A;  3GFJ A;  3ZMV A;  1AKH B;  4BY1 J;  1TNT A;  3WTZ A;  1Z77 A;  4E7L A;  3DLA A;  4A3D J;  1X2N A;  2LR8 A;  5ICC A;  4A6D A;  2WA0 A;  3CF5 F;  2VPR A;  1MGT A;  2OQG A;  5EZH A;  2DA5 A;  5LHI A;  3RPU A;  2R7U A;  3M8E A;  2MAB A;  3SEQ A;  3BC8 A;  2HWV A;  2DT7 B;  4Y4R A;  1TP4 A;  3IWF A;  1G4D A;  3P7N A;  1FMW A;  5LHG A;  2CQN A;  1ULY A;  3SZP A;  1JKO C;  1IN5 A;  3HTU A;  1J9I A;  2HPI A;  5HS9 A;  5CVI A;  1F9N A;  1I50 J;  3DBH B;  2ID3 A;  3BZ6 A;  5LGN A;  3T8T A;  2HVR A;  1WJA A;  4A3M J;  3R6S A;  1AKH A;  2H8W A;  1SVL A;  4IJA A;  2R7V A;  4EEF G;  2VJJ A;  3PO2 J;  1ZN2 A;  3GFM A;  3RKY A;  2P4W A;  1WJC A;  3BZC A;  2P5V A;  3QPS A;  4CO8 A;  3LSR A;  3DV8 A;  2TDX A;  5DUI A;  3GTJ J;  6PAX A;  3CCR I;  2Y31 A;  2LMD A;  2RN7 A;  1MBE A;  4LLG F;  2R7R A;  2V9V A;  3E1S A;  3U9G A;  2XAU A;  4E7H A;  1VQ7 I;  2QQB A;  3RIR A;  3DCF A;  1IF1 A;  1B4A A;  3D1N I;  2YU9 J;  3D5L A;  4RM2 A;  4M6V A;  5GAD J;  5HLI A;  1S5L C;  5LGU A;  3ZR8 X;  1K4T A;  1ZGW A;  5GPA A;  4BEH A;  3HEF A;  2VQC A;  2LD5 A;  1LB2 A;  2HXO A;  4DYR A;  1BIA A;  2L7K A;  4CIC A;  1XMA A;  3LWF A;  5CVJ A;  2WWY A;  1FP1 D;  4CCJ A;  4P9U A;  1TL8 A;  2DK5 A;  2BYV E;  3I54 A;  4HA8 A;  4PJM A;  1WJF A;  1XDU A;  5EGO B;  4MNU A;  5FKM A;  5B66 C;  3NQO A;  5EF6 A;  4ESJ A;  4MHG A;  1JUS A;  1P92 A;  1LEB A;  3R61 A;  2P8T A;  1NH3 A;  1SAU A;  1WI3 A;  2NOJ B;  5DCF A;  1ZR2 A;  2CJJ A;  1A6I A;  3ZMT A;  3BPV A;  4I6Z A;  2QKL B;  4UB8 C;  2IPQ X;  2VBY A;  3HOX J;  5C44 J;  1GHC A;  3NWT A;  1Z7L A;  4HV6 A;  3QYE A;  4V2G A;  2XGX A;  3HGY A;  5EGO A;  4IPA A;  4XLF A;  3BWG A;  3IV5 A;  3CUQ B;  3CC7 I;  1EJ9 A;  4EJO A;  3F9K A;  5H6Q A;  1ORK A;  4CH7 A;  4F93 B;  2A3S A;  3K4L A;  2KRC A;  4XKV A;  4Z2Y A;  2NOG A;  3WU0 A;  2OBP A;  4BH9 A;  3E0J B;  5E3M A;  4UUV A;  5HLG A;  4L18 B;  1XDS A;  1R4N B;  1WJD A;  2JK3 A;  2VC1 A;  4CSW A;  4M3G A;  2B7E A;  3GVA A;  2KPM A;  1L3L A;  4PJ0 C;  4B09 A;  2GXB A;  3G73 A;  3I9V 2;  1B72 A;  2DFI A;  4A0X A;  4D0P A;  2RQQ A;  4H4K C;  1HLV A;  3SHF A;  2VKV A;  3CUQ A;  1O3R A;  2O5R A;  1A04 A;  4Y13 A;  2IJL A;  3LFU A;  2HGC A;  3DPU A;  1DGW Y;  5ED4 A;  5D4R A;  1IZ1 A;  2MW8 A;  4PK4 A;  4XLE A;  1E2X A;  4WCG A;  3TBI A;  3S1Q J;  1EH7 A;  2QSF X;  3I59 B;  4S0H B;  3M8F A;  5HNH A;  4E6K G;  3L2U A;  3TKY A;  2HYJ A;  1S8N A;  1YO5 C;  3IP4 B;  2E1O A;  2L4A A;  4LIT A;  3TO7 A;  2HZT A;  1GVD A;  3WTT C;  4II2 A;  2EZL A;  3BQY A;  1S72 I;  4CGZ A;  3ZQL A;  4AIH A;  4IRG A;  2HYF A;  4JYK A;  3V4G A;  1XPX A;  3QOD A;  4GCV A;  1J2X A;  5D6E A;  4A6E A;  3I59 A;  4UXN A;  2CG4 A;  5D5V B;  2Y0S A;  4LIU A;  1ZRC A;  1P4X A;  4A3E J;  1YG2 A;  2M87 A;  2RNG A;  4ZDP A;  1YX5 A;  2CWE A;  4ETS A;  4RA2 A;  2Y48 A;  1YIO A;  4BQO A;  2EZH A;  2FEZ A;  3FXK A;  3ZMU A;  4AD9 A;  5HS7 A;  3ABT A;  3OYC A;  3OIO A;  4PDK A;  2P6T A;  1KON A;  4L5E A;  1RR7 A;  2FXA A;  4V2F A;  3K1M A;  2K9L A;  5M5Y J;  2H09 A;  2HFH A;  1APL C;  2X6W A;  2HKO A;  1LFU P;  2DXI A;  4XKB A;  3EUH A;  1Z3Y A;  2ZXH A;  4FIS A;  3PNT A;  3RDI A;  2XB0 X;  3CTA A;  4CYD A;  3IL2 A;  2TRT A;  1J5Y A;  1Y56 A;  2KIU A;  3V42 A;  2RQP A;  2LK2 A;  1R5I D;  4C2T A;  3AG2 H;  1MZB A;  4ZYE A;  5LEJ A;  1LVA A;  4N9I A;  1QZZ A;  2Q8K A;  2VOO A;  1X1A A;  4M72 A;  3RPQ A;  4DBR A;  3MZH A;  5E3O A;  4OAZ A;  1F4K A;  4BU2 A;  4Y3O A;  1PUE E;  1V54 H;  1LUJ B;  2IGN A;  4XSZ F;  2VBX A;  2UWM A;  2A61 A;  2XF6 A;  3GFI A;  5TJJ A;  1TWF J;  2DYS H;  2R92 J;  2VOD A;  1QU3 A;  2K9N A;  4LMY A;  4MQ9 F;  3T0Y A;  4C2U A;  2QKM B;  1TWH J;  3K4M A;  3FXQ A;  4B44 A;  3JSO A;  4BHB A;  4IHY A;  5BNG A;  4HPQ A;  4BBR J;  4L9T A;  3K4B A;  4YG2 F;  3ZQQ A;  2UUZ A;  4DZP A;  2LNB A;  4QPQ A;  4ANJ A;  2NNY A;  3L9F A;  1MBJ A;  1FLI A;  3I4P A;  3W6V A;  4KJZ A;  2R7W A;  3E5Q A;  4LB6 B;  3KLO A;  2X9D A;  4MO7 A;  2L02 A;  2HTS A;  3RPU D;  5K1Y A;  1JUM A;  4BJT A;  5HLH A;  4HDV A;  1PUF B;  4BHP A;  2FJ1 A;  2XUB A;  3OWT A;  3A0H C;  3S3N A;  3DTE A;  1UAA A;  3CCE I;  4C2M J;  1OQY A;  2VAS A;  2WV1 A;  4KMU X;  3ZQH A;  2M8G X;  3QP5 A;  1E3H A;  4LLN A;  4RB1 A;  2Z2S B;  4ENK A;  3K10 A;  2GA2 A;  3BLY A;  5JVG F;  2IRF G;  5L3B A;  2JA5 J;  4A3B J;  9ANT A;  4XN3 A;  4CCO A;  3VFZ A;  1I6X A;  2GM4 A;  1NK2 P;  2JTV A;  4HBL A;  2FSW A;  2DT5 A;  2V7F A;  3TGN A;  4ZYD A;  4F92 B;  3BDD A;  4OWR B;  1PUF A;  2C6Y A;  3DLL F;  5D6F A;  2JA6 J;  4MEX F;  4UVA A;  3S2H J;  4O6J A;  4Z6Y A;  2YSR A;  3RQ4 A;  3GWZ A;  3G4S I;  1VQ8 I;  4K2E A;  3BG6 A;  1W0U A;  1FP2 A;  3DEW A;  4M3F A;  2M34 A;  5IP9 J;  3OS0 A;  3HTS B;  3VSL A;  4G6T B;  3N4M A;  3OS2 A;  3VYT B;  1ZLK A;  3FXM A;  5FRN A;  3FMQ A;  4FT8 A;  3ZCO A;  5IT9 Z;  1VF9 A;  4KYW A;  3NAU A;  4G6Q A;  2B63 J;  4L9N A;  3UR3 C;  5EEA A;  4PFO A;  3BG5 A;  3A1Y A;  2F4I A;  2GQQ A;  5LD2 C;  2VIX A;  1D3Y A;  4JK1 X;  1DU6 A;  3RKW A;  1BC7 C;  4CCN A;  5E8G A;  2EV0 A;  3S3O A;  2IS1 A;  1X3U A;  2K3P A;  3NRV A;  1U2W A;  2ZME B;  1V5G A;  2EV6 A;  4RMN A;  5AIP A;  4EJU A;  3OYJ A;  3MKY B;  1F5T A;  2HU9 A;  3CME I;  4ZTF A;  1IXR C;  1D1C A;  3DKY A;  4S05 A;  1A6Q A;  2EFN A;  1G3T A;  3R60 A;  2O03 A;  4AU7 A;  1T0F A;  4L0Z B;  1K6Y A;  3S93 A;  1ZYR F;  2EB7 A;  1KU7 A;  4XM3 A;  1D5Y A;  2Z3Y A;  1MSF C;  4YFN F;  1A35 A;  3OOU A;  5E1Z B;  5F27 A;  4HW0 A;  2Y30 A;  4P96 A;  4EGZ A;  1DP7 P;  3JAM Z;  2W1O A;  1Z3X A;  4E7S A;  1MH3 A;  2ZME A;  2XB5 A;  1HBX G;  1CQT A;  3FK6 A;  1W5S A;  1Z1D A;  3VOD A;  2O8K A;  5L3G A;  3OYE A;  3M1C A;  1RC9 A;  1VQ9 I;  2JVH A;  3U1D A;  2V26 A;  4OIR F;  2ADU A;  5M3F J;  5DD4 A;  1MBG A;  2EIJ H;  2KIM A;  2XGE A;  4D9J A;  3ECO A;  3KIO A;  3WE3 A;  3R0J A;  4KIT B;  2RGV A;  1V5E A;  3C2H A;  4F55 A;  4ZZL A;  3CCJ I;  1TT5 B;  1SMY F;  3PNV A;  2VB6 A;  3REO A;  3HOT A;  2BHZ A;  3H3Z A;  1YJN I;  4HV5 A;  1DU0 A;  3OL3 A;  2EV5 A;  1VQ6 I;  3FXO A;  4AYB A;  1X1C A;  1LNW A;  3HB9 A;  3V7R A;  2CUF A;  5FLX K;  3EYI A;  2D1H A;  1VQO I;  1VQ5 I;  2LY2 A;  1UCR A;  2YU3 A;  3MAJ A;  2DN0 A;  3BTI A;  1BA5 A;  2NS8 A;  4CCK A;  3CMY A;  2KDZ A;  1XSD A;  1R4M B;  2W24 A;  4BNC A;  3KP6 A;  1QZE A;  2DTR A;  2WC2 A;  4BQN A;  1I6H J;  2RC4 A;  4XRM A;  1BOB A;  3OIP A;  1E3O C;  2MD0 A;  1T38 A;  3CP8 A;  3W2A A;  1MJB A;  1YYV A;  5BQT A;  3JR9 A;  1UHM A;  2J5P A;  5FRO A;  2EH3 A;  3L2C A;  1FJL A;  1BI3 A;  1HC8 A;  2XVC A;  3KLN A;  1E3P A;  2FUG 2;  3H3V K;  4QWQ A;  1J09 A;  3QP6 A;  4M74 A;  5ILS A;  4BBS J;  1BJZ A;  4AWX B;  3KZZ A;  2ZNZ A;  3J80 Z;  2IGK A;  2JQ7 A;  1IXC A;  1LDD A;  2DW4 A;  2EQR A;  4P9F A;  1TW2 A;  1G3Y A;  2CV1 A;  2K9Q A;  3R0A A;  3DKW A;  4BUP A;  3T8R A;  1FIP A;  1HF0 A;  3ROU A;  1TT0 A;  2OZ6 A;  1LFB A;  2QM3 A;  2E1N A;  4X1E A;  2KRH A;  3DF8 A;  3FKI J;  4D5C A;  3WHC A;  2DA1 A;  4BE1 A;  1KU9 A;  4X6A J;  2LRD A;  1NG6 A;  4II3 A;  3CJN A;  1OCR H;  2BY1 A;  2H27 A;  5ILV A;  4AVZ A;  4GDF A;  4I2O A;  3VYU B;  1B8I B;  4XN0 A;  2DK8 A;  4DYQ A;  2CMP A;  2M4G A;  3GZN B;  5AON A;  1HXD A;  1XSX A;  2LKP A;  3F6O A;  3VPR A;  3HPG A;  2OQR A;  3LA3 A;  2HKX A;  1VQN I;  2IBD A;  1B9N A;  2ETH A;  1CGP A;  2QQA A;  5JHF A;  4JBA A;  2D45 A;  3CP2 A;  3CJR B;  4BL0 B;  1ZG5 A;  3IRQ A;  4MFD A;  5IYD J;  4BAC A;  3GLX A;  3SZG A;  1YW7 A;  3OR1 C;  2ISY A;  4QTR A;  5LGT A;  1OLT A;  1FPQ A;  1B8I A;  2OAZ A;  2IEK A;  1PP7 U;  4UUT A;  1ZHF A;  2QZ8 A;  2P81 A;  3FXU A;  5LBQ A;  5M3M J;  1MNM C;  3DTI A;  1ETV A;  4M3D A;  1QO0 D;  3OR2 C;  1MKM A;  1ZKG A;  2X1D A;  4IZZ A;  2JUG A;  1BI1 A;  2BVL A;  4GGG A;  4ZC3 A;  4QLC U;  2A5W A;  1IUY A;  2ECB A;  3CUQ C;  3KYD B;  2XKO A;  4LG3 A;  2CUZ A;  2ZKZ A;  4U7D A;  1U9N A;  3SZT A;  4NDL A;  3BT9 A;  2LVS A;  3WGG A;  4F91 B;  3BG9 A;  5B5E C;  1RI7 A;  4D1Q A;  4KNY A;  5IP6 A;  3WE2 A;  1E0E A;  3Q9V A;  5TRD A;  2P5L C;  4OU0 A;  5JR3 A;  4I76 A;  1JT6 A;  1T33 A;  1GXQ A;  1BM9 A;  2EZI A;  3FZV A;  2WAF A;  4PJJ A;  4BYY A;  1BI2 A;  1BIB A;  4CXF A;  5CVU A;  2M5W A;  3JRI A;  5KAF C;  2VON A;  3TMO A;  2QSG X;  4PJN A;  2XAH A;  3LSJ A;  2Y75 A;  4KIC A;  1A36 A;  3E5X A;  2LC2 A;  2OZU A;  3NWS A;  3OYI A;  1MSE C;  5DTD A;  4IHW A;  1REP C;  2X85 A;  1WPK A;  1WI9 A;  4O5V A;  1RES A;  2E2H J;  1G8X A;  1JKR C;  3JRD A;  3JRE A;  4ZDO A;  3MVP A;  2DPD A;  2FE3 A;  2VKH A;  4HG2 A;  3WU2 C;  4NUB A;  3ZQC A;  4ZJZ A;  5GTH C;  3CES A;  1TQP A;  3WTV C;  2WY8 Q;  1EV7 A;  1RUN A;  5FJ8 J;  4JX5 A;  1EKE A;  3BRO A;  4KFC A;  2L4M A;  4M9S A;  2MGQ A;  4B48 A;  3L1P A;  1HKT A;  1Z6R A;  2M4K A;  3COA C;  5LLQ A;  2K5C A;  1VQL I;  2ZJR F;  2FRH A;  4KIS A;  1JKP C;  2HOT A;  3VDX A;  3K6G A;  2XSJ C;  2V4J C;  3EUH C;  3ZOB A;  3VB2 A;  1R00 A;  5EYR A;  2GBY A;  3BG3 A;  2BHY A;  3GX4 X;  4DOZ A;  3K4N A;  3UNG C;  2W85 A;  2DBB A;  4JP0 A;  1N77 A;  5JLX A;  3CO6 C;  1P9Q C;  3AG3 H;  1U6G A;  5TGT A;  3DBL B;  2CH0 A;  2VBW A;  2GLO A;  2E2J J;  2FU4 A;  3QOP A;  5JHU A;  3BTL A;  1DDN A;  2DA4 A;  2ZXJ A;  3BOQ A;  3IC7 A;  3P9I A;  2F4O B;  1UEL B;  1FY7 A;  3WU1 B;  4F3Q A;  1USS A;  3S2D J;  1M1E B;  4BDZ A;  4LIV A;  5CPR B;  3E3V A;  3CLO A;  1WQ2 A;  3G71 I;  2KT0 A;  2XV4 S;  2ESN A;  2QF7 A;  3FIS A;  1H9G A;  1P4A A;  2JPC A;  2CU7 A;  1X3Z B;  4L5I A;  3CDL A;  3WG7 H;  3OYG A;  3M3Y J;  2QQ9 A;  3CCM I;  1FWZ A;  3MN2 A;  2LG4 A;  1QHG A;  4P1W A;  3DEU A;  5AIQ A;  5J1Y A;  1BW6 A;  1P4W A;  5E3L A;  3OYD A;  3GUD A;  3CCS I;  3P9K A;  1U8B A;  2A6T A;  3T5X A;  2MSY A;  3MKZ A;  2V9P A;  3P9C A;  3HOY J;  3LA7 A;  3KP4 A;  3ZMD A;  1RET A;  3FHZ A;  5C4J J;  2LTP A;  2MA3 A;  5H20 A;  1Y8R B;  1J7K A;  1XCB A;  2VXD A;  4A5N A;  4TV7 A;  4WXC A;  2E71 A;  2FBI A;  2JVG A;  5IYC J;  2VXZ A;  2WAQ A;  1UMQ A;  3I56 I;  1J0R A;  4B8X A;  1ZGJ A;  2BY2 A;  4LG0 B;  2AQE A;  1D0Y A;  3S1R J;  1XG1 A;  3ASO H;  3FXJ A;  4PZJ A;  2Z5U A;  3I71 A;  3SDG A;  3PJR A;  1IV8 A;  1U5T B;  2F2E A;  2W82 A;  1R5G A;  1MBF A;  2W48 A;  4XRS A;  1FX7 A;  3ABL H;  2QCO A;  4XOR A;  5M5W J;  3L00 A;  4ENJ A;  3HXL A;  3ZN0 A;  1XMX A;  1YX3 A;  1FSH A;  4EQQ A;  4LG0 A;  2Y9Z A;  3GYH X;  3O3K A;  1IW7 F;  2P6S A;  1IN7 A;  1Z9C A;  2DOD A;  1L0O C;  3D5S C;  4A5M A;  1U5T A;  2QLZ A;  1IO2 A;  3LSM A;  2H6B A;  3DKX A;  3KET A;  3S1M J;  4QPO A;  4I0A A;  5TIS C;  3E5U A;  1I39 A;  4GRI A;  4HX7 A;  1QVU A;  3HKZ A;  1YFH A;  3QQA A;  1NHA A;  1YIJ I;  1MH4 A;  3AL0 B;  3FM3 A;  2HQN A;  4KIF A;  2NRA C;  1JGS A;  5CQG A;  1Y0U A;  4RLF A;  3WTS C;  3JAM K;  4YEJ A;  3CC2 I;  5FB2 A;  5DV5 A;  2H8R A;  1Q1V A;  3SEZ A;  5KNL A;  1XGS A;  2VQL A;  5IOY A;  3A2K A;  1W5C C;  2X4H A;  2ZME C;  2L9R A;  3QPL A;  3RJP A;  4HSR A;  3Q3S A;  1SD4 A;  2MFZ A;  1ODD A;  1HW5 A;  2JWT A;  1HKS A;  3I53 A;  4XKC A;  2DFF A;  1QHH D;  3CUO A;  1MBK A;  4RB0 A;  4CCM A;  2ICW G;  1D1A A;  1BR1 A;  1KGS A;  4RAY A;  3CC4 I;  1R9T J;  4IVN A;  1OMI A;  5J3L A;  3GXO A;  1EA3 A;  2IGM A;  4MFE A;  4PSX A;  4BGD A;  3LQR A;  1WJB A;  2MC4 A;  3TP0 A;  1O57 A;  2LKS A;  4RS8 A;  1OCT C;  1RNL A;  3H0G J;  2KKO A;  3QPT A;  4HQE A;  3I4M J;  1IRZ A;  2K9M A;  4GXO A;  3DXJ F;  5KK1 A;  5J40 A;  2K27 A;  3B6C A;  2RAE A;  1D5V A;  1EH8 A;  1ZAR A;  4KT6 A;  1R71 A;  3Q5F A;  1OKR A;  4MEY F;  1Y1V J;  3C2G A;  2CQQ A;  2LDU A;  2YPR A;  1U0J A;  5D8L B;  2QEX I;  4A12 A;  2LKX A;  3KEY A;  5GP9 A;  3I55 I;  2M0C A;  3HSR A;  2MH2 A;  5BMZ A;  1ZEL A;  3OL4 A;  3HOZ J;  2OUM A;  4MQV A;  1STZ A;  3BTJ A;  3ELK A;  5L3F A;  1BL0 A;  3O8G A;  4DQ2 A;  3FM5 A;  3N05 A;  3WGH A;  5IP7 J;  3J80 K;  3JW4 A;  3K1P A;  4RM3 A; 
#chains in the Genus database with same CATH homology
 3TL4 X;  4E7Z A;  2VIX A;  4DBQ A;  4HST A;  2R7S A;  3RCO A;  4CCN A;  3HOS A;  2E1M B;  3S3O A;  1MMG A;  2IS1 A;  4BQQ A;  2K3P A;  1UG0 A;  1V5G A;  4RMN A;  5HLT A;  3MKY B;  3OYJ A;  1VZ0 A;  3HG9 A;  2HU9 A;  4ZTF A;  1D0Z A;  1D1C A;  3DKY A;  2KLO A;  4XLH A;  1WJE A;  4AU7 A;  3OY9 A;  1K6Y A;  3S93 A;  3FBI B;  4XM3 A;  3OYF A;  1X1D A;  4PSW A;  3OOU A;  4XNF A;  1DGR M;  2F6C A;  3IAS 2;  1LDK B;  4BEH B;  4BJ6 C;  2W1O A;  1Z3X A;  2WB1 A;  1HA8 A;  4JOM A;  4E7S A;  4X0G A;  4IQ4 A;  2L5Q A;  3CJQ B;  2KQR A;  2DT6 A;  4RLQ A;  3OYE A;  3M1C A;  3OYM A;  2JVH A;  2V26 A;  2F5V A;  2VQH A;  2V6E A;  2X1E A;  2WAD A;  2IS2 A;  4D9J A;  4BE0 A;  1MND A;  3OYB A;  4KIT B;  1V5E A;  2L2O A;  3C2H A;  2ELJ A;  3VSK A;  4F55 A;  3OYN A;  1X19 A;  3PNV A;  1IRX A;  2DOA A;  2VB6 A;  3HOT A;  1LFP A;  3OL3 A;  2DCE A;  2ZSH B;  3DU6 A;  4AYB A;  1X1C A;  3IUO A;  3H9J A;  3L2W A;  2XC7 A;  3MMY B;  2LY2 A;  3LSI A;  3QYB A;  1T0F C;  2LH9 A;  4CCK A;  4B43 A;  2E60 A;  2DJI A;  4Y33 A;  4E7K A;  3OYK A;  1PYV A;  4JQF A;  4BQN A;  1YE9 A;  2M7B A;  1MW7 A;  3FKJ A;  1X1B A;  4XLA A;  1BOB A;  1PJR A;  3OIP A;  3AFH A;  4N4O B;  2X6X A;  2MD0 A;  4BXF A;  4J01 A;  3W2A A;  3CP8 A;  1N78 A;  4BS9 A;  3MKW B;  2GOM A;  3PSI A;  5FRO A;  4MLO A;  4R79 A;  4HNT A;  1X4P A;  4XON A;  3EUA A;  3K70 C;  2CW7 A;  2CS3 A;  2FUG 2;  1D1B A;  1J09 A;  1N75 A;  3CF2 A;  2L9S A;  1NG7 A;  3DTK A;  3ONQ A;  2IGK A;  2UV1 A;  3VYR B;  4NNJ A;  4BJ5 C;  2XDV A;  3OIQ A;  4XMY A;  1OR7 C;  3H5N A;  2VQG A;  4PUS A;  4ZTJ A;  2LRE A;  2MYS A;  4U7B A;  2CV1 A;  3LSH A;  4BUP A;  3PL8 A;  1TT0 A;  1MMA A;  3PUB A;  3QYF A;  2XF7 A;  3EUK L;  1JI8 A;  2BW3 B;  2KRH A;  2LYC A;  3ZGK A;  4BE1 A;  2LRD A;  1NG6 A;  4II3 A;  2WY7 Q;  5LFA A;  4AVZ A;  3VYU B;  3LMM A;  4XN0 A;  2CW8 A;  4J00 A;  2CMP A;  2M4G A;  3HPG A;  2CV2 A;  3I3L A;  5JHF A;  3CP2 A;  4NC8 A;  3CJR B;  4FET A;  4BL0 B;  2KL4 A;  4N4N B;  2P0W A;  3BG7 A;  2BW3 A;  3OYL A;  3K4J A;  3FDY A;  4BAC A;  5HOO A;  3SZG A;  2R7X A;  3OR1 C;  3PFY A;  4E7L A;  3DLA A;  1LKX A;  1SFK A;  1OLT A;  2VL8 A;  2WA0 A;  4PFP A;  2W7N A;  3H9G A;  1Z21 A;  1DQU A;  2R7U A;  2MAB A;  3SEQ A;  3BC8 A;  4Y4R A;  2DT7 B;  3DTI A;  1FMW A;  2X6Y A;  3OR2 C;  3M8J A;  4XLC A;  2HPI A;  2X1D A;  3D5R C;  1ERD A;  2X51 A;  2JUG A;  2VJ5 A;  4IZZ A;  2BVL A;  4ZC3 A;  2A5W A;  4IX7 A;  2HVR A;  2VJ4 A;  1WJA A;  1DP3 A;  4LG3 A;  1D0X A;  2CUZ A;  2OC6 A;  2IS4 A;  4F91 B;  4YRV A;  2R7V A;  2VJJ A;  4BDY A;  4P5O A;  4D1Q A;  3DU5 A;  1S9H A;  1WJC A;  1E0E A;  3HC7 A;  2R7R A;  3DQV C;  3E1S A;  4PJJ A;  2WAF A;  2XAU A;  4E7H A;  2HQA A;  3AKZ A;  2R7T A;  3D5L A;  2WBM A;  4RM2 A;  3RTR A;  2L9N A;  3ZR8 X;  4BEH A;  2VQC A;  3TMO A;  4PJN A;  2L7K A;  2PMZ A;  4C9Y A;  2LC2 A;  3NWS A;  3OYI A;  1MMD A;  1W36 D;  4CCJ A;  4PJM A;  5CKT A;  1WJF A;  2CFO A;  3IAM 2;  1BR4 A;  2X85 A;  4IQJ A;  1R6R A;  4YEL A;  1G8X A;  4ZDO A;  1SAU A;  2NOJ B;  2RRE A;  2VKH A;  4HG2 A;  4NUB A;  2KDO A;  3QOE A;  1AA7 A;  4U87 A;  4ZJZ A;  2QKL B;  3NWT A;  3CES A;  1Z7L A;  2R7Q A;  2ZSI B;  3QYE A;  2WY8 Q;  1MMN A;  3HL2 A;  4B48 A;  4XLF A;  2M4K A;  2VPL A;  2K5C A;  3LL7 A;  4KIS A;  3F9K A;  1Y6I A;  4CH7 A;  3EPZ A;  3VDX A;  3K6G A;  4F93 B;  2XSJ C;  2V4J C;  3EUH C;  3K4L A;  2KRC A;  4XKV A;  3W2W A;  2KP6 A;  3E0J B;  2BVM A;  4DOZ A;  3K4N A;  3UNG C;  1WJD A;  3K4C A;  4CSW A;  4NQW B;  1FMV A;  1N77 A;  3L2Q A;  1P9Q C;  2KPM A;  4F52 A;  4HNU A;  3J7A Y;  3LSG A;  2IXS A;  3H9Q A;  4ITV A;  2PJR B;  3I9V 2;  3L2R A;  5TGT A;  4XOP A;  3OYA A;  3HUG B;  3DWL E;  2CH0 A;  2RQQ A;  4H4K C;  2HDW A;  2LBF B;  2VLA A;  2V1N A;  2O5R A;  3KX2 A;  3LFU A;  1UEL B;  1DGW Y;  3DPU A;  4B3X A;  4F3Q A;  4ZYA A;  3MD2 A;  4BDZ A;  3W2V A;  2BOL A;  4PK4 A;  4XLE A;  4LIV A;  5CPR B;  2KMU A;  3TBI A;  2PJR A;  4DGW B;  3DPL C;  4BE2 A;  5HNH A;  2W4S A;  4OAY A;  3OYG A;  1G59 A;  2LBF A;  1BR2 A;  4E6K G;  3L2U A;  2LOO A;  2LG4 A;  2IS6 A;  1QHG A;  2M3A A;  3KYL A;  4P1W A;  3IP4 B;  2AQF A;  4LIT A;  2WAE A;  4II2 A;  3OYD A;  4PJL A;  3FHN A;  3G2B A;  2XF5 A;  2A6T A;  5KCM A;  3MKZ A;  3AL0 C;  3QOD A;  2KHM A;  2IGO A;  4E4H A;  2VJI A;  2Y0S A;  3GBG A;  3S32 A;  4LIU A;  3DEE A;  2KZV A;  2RNG A;  2VXD A;  4ZDP A;  5HVQ C;  4CCL A;  1YX5 A;  4XL9 A;  2JVG A;  2VXZ A;  4BQO A;  1W36 C;  2WAQ A;  2E5N A;  3PNY A;  5CQE A;  3OYC A;  2AQE A;  1D0Y A;  2M0M A;  1KON A;  2Q2E B;  3H5A A;  3LSK A;  3U21 A;  3RSN A;  3PJR A;  2K9L A;  2HVQ A;  2JA2 A;  2W82 A;  2Z16 A;  2X6W A;  4C30 A;  3L2V A;  2ZFU A;  2DXI A;  4XKB A;  1Z3Y A;  2ZXH A;  4XOR A;  3PNT A;  2GOX B;  3HXL A;  3SYT A;  2HZD A;  1Y56 A;  3V42 A;  4EAT A;  3VWB A;  2M7A A;  1YX3 A;  4C2T A;  1TZL A;  3A4C A;  5KHD A;  3DPT A;  1X1A A;  4DBR A;  3D5S C;  1WJ5 A;  2E5Z A;  3VYS B;  2HPM A;  2VKD A;  3LSM A;  4OAZ A;  5FRM A;  1V5F A;  4BU2 A;  4FAS D;  3CMM A;  3DKX A;  4Y3O A;  3OYH A;  2IGN A;  2X1C A;  4QPO A;  2UWM A;  4GRI A;  2XF6 A;  2Q1Z B;  4CA0 A;  1QU3 A;  3CZ6 A;  2OV7 A;  3HKZ A;  2CUJ A;  4C2U A;  2QKM B;  3H0D A;  3AL0 B;  3K4M A;  4B44 A;  2Z1D A;  1X4O A;  3FBN B;  4HPQ A;  4E7J A;  3K4B A;  5CQG A;  3W3C A;  2W00 A;  4RLF A;  4HEA 2;  3BCB A;  3ZQQ A;  2UUZ A;  2LY1 A;  4YEJ A;  1LVK A;  3ZXS A;  4E7I A;  4QPQ A;  4ANJ A;  2HNH A;  4NC7 A;  3SEZ A;  5KNL A;  4KJZ A;  2E1M C;  2VQL A;  2R7W A;  3A2K A;  3BCA A;  3S3M A;  3RPU D;  4ZDL A;  4BJT A;  4CUG A;  2R7O A;  2V9K A;  3HPH A;  4HSR A;  4B47 A;  3OS1 A;  3OWT A;  3S3N A;  3DTE A;  1UAA A;  2MFZ A;  2VAS A;  2JSP A;  4XKC A;  3H35 A;  1QHH D;  4CCM A;  1D1A A;  2Z2S B;  1BR1 A;  3K10 A;  2CV0 A;  3BLY A;  1EA3 A;  1T95 A;  2IGM A;  4XKW A;  4XN3 A;  4PSX A;  3S8P A;  3ZRG A;  4CCO A;  4IKF A;  4BGD A;  4XQF A;  1WJB A;  2V7F A;  2MC4 A;  5HNF A;  3PSF A;  2ZXI A;  4OWR B;  4F92 B;  2K9M A;  4DJA A;  3K70 D;  3SDB A;  4KT6 A;  3RQ4 A;  4XR6 A;  1GLN A;  3OMY A;  3BG6 A;  3C2G A;  1U0J A;  1WFX A;  3OS0 A;  3H5R A;  3KEY A;  3VSL A;  4G6T B;  1ZEL A;  3OS2 A;  3K4K A;  4XOT A;  2I8D A;  3OL4 A;  3VYT B;  4HRI A;  2OUM A;  1MNE A;  3ZCO A;  5FRN A;  2HVS A;  2R4G A;  3UR3 C;  4PFO A;  4CZC A;  3N05 A;  3A1Y A;  2F4I A;  4DIQ A;  5LD2 C;  4RM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...