2KP6A

Solution nmr structure of protein cv0237 from chromobacterium violaceum. northeast structural genomics consortium (nesg) target cvt1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
MDTSNHLLPGLFRQLGLEDEPAAIRAFIDSHPLPPRVPLPEAPFWTPAQAAFLRQALECDAEWSEAADGLAVLLQQGEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of protein CV0237 from Chromobacterium violaceum
rcsb
molecule keywords Uncharacterized protein
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
total genus 21
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10982 DUF2789 Protein of unknown function (DUF2789)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1130 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kp6A00
2KP6A
chains in the Genus database with same CATH superfamily
4RM3A 2LG4A 3EUHC 2FNAA 4HLXA 4AWXB 2OA4A 2TRTA 2FJ1A 5EG0B 3EETA 3GZ5A 2HXOA 5JLXA 1KONA 2LF8A 2Y0MA 1F43A 2W57A 2ISYA 4WWCA 1D1BA 4ZDLA 2GWRA 3BQYA 2XRLA 1HQCA 5LFAA 1Z21A 2WTEA 2DA7A 5ICCA 4GYGA 2EIKH 1R5GA 5LGUA 1JUPA 1BI1A 4V2FA 3S16J 4WF2A 1VQ6I 2OD5A 3ABKH 1PUEE 5B1BH 5IP9J 3VWBA 4UHTA 3V7SA 4DQ2A 4BXFA 3ZMUA 4I01A 4CCMA 1X3WB 2R7WA 2K86A 3I59B 5L3CA 5E3NA 3WG7H 3GUDA 2CW8A 5EGOA 4M74A 2BEOA 2AXTC 1BC7C 1XPXA 3BZKA 1MMDA 2AQFA 3CCSI 1X3UA 1R58A 1ZQ3P 1TT0A 1L3LA 2OZUA 1MMSA 3H5AA 3CLQA 1T8IA 2F5FA 4A5MA 2CUZA 4RAGA 2VI6A 1H9GA 1SMYF 4FX0A 3JRDA 2L9SA 3O2PE 3I64A 4EM0B 3G1LA 4P5OA 5LD2C 1RC9A 2Y0SA 4M72A 4UUVA 1P92A 2Q0OA 4PSWA 3TDZC 3M9AA 1Z1DA 1TWAJ 4WXDA 1J59A 3QOPA 3WE3A 4G12A 2WAEA 1JE8A 3KP2A 3ERED 3F21A 1SAXA 1J09A 4I0AA 2ELHA 6PAXA 3C3WA 2WB1N 2W4SA 2WWYA 3FHNA 2KQRA 2L9RA 1P4AA 1W0TA 4X1EA 3M8EA 2OJED 3AG3H 1LE8B 2XGCA 1R1VA 2F4IA 3FK7A 4RGSA 2K27A 4L9NA 5B5EC 2F5DA 3I5UA 2XF6A 3CESA 1VFCA 5GTIC 1T39A 1YO5C 5CQEA 3E6MA 1U2WA 2R92J 4GRIA 5E79C 3WE2A 2MC4A 4PJMA 4BJ5C 1P6RA 2EZHA 3I54A 2KRHA 1XGMA 2L0KA 5FKKA 3V42A 3OYKA 2STTA 4NUBA 2F5EA 3ABLH 1JXSA 2AHQA 2NOJB 1XGNA 2AO9A 2M34A 3WHCA 3DLAA 4M3BA 3WTVC 1XMXA 2Y75A 1EH7A 2JA6J 2OQRA 2DYRH 3SFZA 2AQEA 1JT6A 3RCOA 2QBYB 3ZQFA 1FOXA 3H5NA 2VIXA 1B59A 5CVUA 4HV6A 3JRHA 2DO7A 2KZVA 1GVDA 4G6QA 5GAHJ 1X1PA 5IYBJ 1HLVA 2R7SA 1TWFJ 4OIPF 2G0EA 1SAUA 2NVUB 1LEBA 1IC8A 2PLYA 3RPUA 3HOYJ 4IO9F 5L3DA 3HTUA 1UCRA 2QSGX 3OS2A 2R7DA 3DQVC 1SD4A 4EJTA 2QQBA 3SYTA 4CYDA 2N8GA 4LG3A 3D1NI 1Z7UA 3QP5A 1HCRA 3Q9VA 3K0LA 4OIRF 5D4SA 2FA5A 3J7ZI 3V8JA 1VQKI 2IPQX 1D5YA 1EJ9A 2XSJC 2A6HF 3J81K 3RKQA 4XLHA 4JP0A 1D0XA 1XX5A 1G8XA 2Z5UA 2BYVE 2RC4A 4XLAA 4XNFA 4AVZA 4EATA 4F7ZA 4D5FA 5HVQC 5LBQA 5D5UB 1SFUA 3SZGA 2LBFB 1TC3C 1BI0A 2UWMA 2DMTA 2M4KA 3OR2C 1I27A 1OISA 4BQQA 1I6HJ 1FMWA 2QENA 3UNGC 2VLAA 3O8HA 1A04A 1T56A 3ZMSA 4ZDPA 3GTGJ 2JA7J 2RGVA 2XAHA 4I2OA 2H94A 2WB1A 2DT6A 1Z6RA 4A3KJ 4FHTA 3ZOBA 3WU2C 1S8NA 2PFBA 1JKPC 1VQMI 2BY3A 2VBZA 1U8BA 2ESHA 2KL4A 2H1KA 3TP0A 4BBSJ 1ACIA 5ICGA 1QBJA 5TRDA 3KEQA 4MTEA 4F3QA 5DM6F 4R79A 2G9WA 1YRNB 2DLLA 1IRGA 3HOUJ 3S1QJ 3FK6A 3CCQI 2A5YB 2K4BA 3K4NA 2MH2A 2MG4A 4GYIA 1Y0NA 1LFBA 2B7EA 4Y4RA 3OYGA 4MEXF 3O3KA 3LL7A 4M9ZA 1S72I 1YIOA 2BV6A 3TP3A 4A3EJ 1DUXC 2NOGA 3WU1B 2K3FA 1YFHA 2P81A 1AU7A 3GCMA 3WG9A 2HEOA 4BYYA 2DA2A 2P6SA 2GOMA 3RSNA 1LJ9A 2NXNB 4Y3OA 4KDPA 3J81Z 4HAMA 4C2UA 3S1NJ 2XKOA 3SEZA 4MEYF 3K7AJ 2EWNA 4EM1A 3E7LA 2Z3YA 4XM3A 3T8RA 1RR8C 4Q5SF 4NB5A 2GOXB 3GTQJ 5ILVA 2NVTJ 2DFFA 3GYHX 1LUJB 4QSHA 3ZQ7A 2YU9J 3GZNB 4F93B 5EEAA 1QGPA 1DP7P 3QPSA 5CVVA 4BACA 3OMYA 2M1BA 2ID3A 2EV0A 1WJBA 5IOYA 2EFQA 2QF7A 1RI7A 3LAPA 2JT1A 4ENMA 4LB6B 2VC1A 1I50J 4HF0A 3HOXJ 3ZMTA 2L9VA 3N4MA 3SFIA 3FHZA 2IRFG 2TCTA 2ECBA 4B48A 2IS1A 3QRFF 1R4NB 3KZYA 3S17J 4LFUA 1IAWA 3CCUI 2V9PA 2KHMA 2MGQA 3MAJA 2FQ3A 2A5WA 4S05A 4XLPF 3A2KA 1TP4A 2QCOA 1YHQI 4ZTJA 4XN0A 4A5NA 2D1HA 2M3AA 2NVYJ 2Q1ZB 1USTA 2JPCA 2V9KA 3S8PA 4P9UA 2MSYA 1Q1VA 3CC7I 4A6DA 1V5FA 3KIOA 3OS0A 4IHYA 2BBYA 3GFMA 1G3TA 1WJAA 3E5QA 3GFIA 2ZJQF 1XS9A 2E35A 3DKWA 1QQIA 3F0CA 2QUFA 4M6VA 3FMRA 2R7ZJ 3GLXA 5EF6A 1E3OC 1I3QJ 1NH3A 3FMSA 5E8GA 3OYNA 5DCMB 3CC2I 4BAYA 1TWGJ 2KRFA 1OR7A 3A01B 3DTKA 4K2EA 4NC7A 4XORA 2Y9YA 1F36A 2DDAA 2D2WA 2O3FA 2DCEA 4D1QA 2X85A 3J80K 1R9TJ 1ITYA 3NAUA 1IG7A 2L7MP 2RQQA 2X6XA 2LC2A 3BPVA 3OIQA 3MWMA 4ZYDA 3KFWX 1RETA 2K9SA 2XDVA 3BCAA 1H88C 3HUGB 2ZMEA 2DA6A 3S1RJ 3H5RA 1ZK8A 2W84A 2K40A 1OQYA 2F4OB 3FZVA 3LSJA 2E2HJ 4IPAA 4IHXA 3GFLA 3P7NA 2Q8KA 4ENJA 3RIRA 2ELJA 4KIFA 4MGRA 4HF2A 2PEXA 2LKXA 4M3DA 1JJ8C 3HYIA 3MZHA 3S14J 1D1CA 1PUFB 3PO2J 3ELKA 2L7ZA 3BG3A 5ILSA 1KU3A 1TWHJ 2KZGA 2H6BA 3VSLA 1Y1VJ 3CP8A 4RGRA 1OCPA 3N97A 3W6KB 3BR1A 2X48A 4II3A 1D1AA 1BL0A 1WJCA 5EDNA 3ZN0A 1B4AA 3VPRA 1OCTC 5LLQA 4FETA 1OR7C 3L2CA 3W6JB 4IJAA 3FXRA 5IY5H 1Y39A 4KMFA 3C1DA 3BTJA 4EJOA 1YQAA 2FMYA 1LVKA 2HZDA 4XLFA 5ED4A 3OYLA 1DDNA 2QYOA 3BR6A 4XKWA 3HRUA 3L2QA 1Z3XA 4EGYA 1XC5A 1W7PB 2ZMEC 4IHTA 3RQ4A 3QPTA 5A2QK 2E2IJ 4IOCF 5DV5A 3HPGA 3FM5A 2E7XA 4E7KA 1YJWI 3JRCA 3IWFA 4HBLA 3GVAA 3VEPA 2TDXA 3J80Z 3CO7C 3L09A 3GFJA 2F4MB 5J8FA 1BW5A 2ESNA 3BOQA 4HNTA 2L7FP 1ZN2A 2OC6A 2AS5F 3HM5A 3K4BA 4CGZA 2XAQA 3KZZA 1DPUA 1LEAA 2G7HA 4B44A 1D5VA 2K85A 2M0MA 1NHAA 2ECCA 2Y9ZA 2EZLA 2L2OA 1U5TB 2F48A 2GAUA 3JSOA 3L1PA 3ZP5A 3CD6I 4UV9A 3IP4B 1I39A 1YX3A 1BR4A 2IGMA 3SXYA 1S7AA 5K7HA 5KAFC 4HOBA 3FBNB 5DD4A 3QP6A 3F6OA 3CCLI 2JUGA 1MKMA 3G73A 1HKQA 2VQHA 3KYCB 4M3FA 2KIUA 1U9OA 4LJZF 2KJCA 1WH5A 1POGA 2W00A 2W1OA 3H0DA 3E6DA 4HX4A 3ZQHA 1QZEA 5HS9A 2W7NA 3M3YJ 3E0JB 3AG2H 3UR3C 2FU4A 3H92A 3OYFA 1Z7LA 2E5ZA 3CCMI 3I53A 2H8RA 3HOVJ 1V3FA 3PFYA 1SD5A 1XDUA 1QU3A 4M3EA 2LY2A 4XR6A 1ZRDA 3L00A 1RNLA 2FMLA 2FXAA 1YITI 4PJNA 2Y31A 3QYBA 2L9NA 1K61A 2BZTA 3JSPA 3H1CA 1QVUA 1T0FA 5BMZA 3FWEA 2VUMJ 2ME6A 2KP6A 5A2QZ 2ETHA 1WI3A 5J4VA 4G8XA 4HA8A 4BL0B 3AL0B 4RGUA 5GTHC 1SANA 2HTJA 2XUBA 3FX3A 3JTGA 1QHGA 1Z6TA 1R5HA 2M2EA 4GFBA 2VJ4A 2IXSA 5KAIC 2PMHA 2YU3A 4PJ0C 4HPQA 1I6XA 3BR0A 4XSXF 1W5TA 2HYJA 4G9YA 3GMEA 1UJ8A 3WTSC 3TMOA 2RNJA 3FXOA 2K9NA 1UHWA 3K4JA 1X19A 3KE2A 5J47A 3S2DJ 1U5TC 1G2HA 4IRIA 4NC8A 4EVIA 5JVTA 4DOZA 3GTPJ 1IO2A 1K83J 1KQ9A 3K4MA 2E19A 1W36C 3P9CA 5FB2A 3JAMK 3K70D 1Z3YA 3FXMA 2HVRA 4OOIA 2HKXA 2VQGA 1Z77A 2H1LA 2DMNA 4BKXA 4I09A 4N0BA 3K9TA 2V4JC 2VQLA 1YS7A 1I3AA 3MKZA 1JHHA 2ZFUA 4ZYAA 1C0WA 1FIAA 2XV4S 2PI0A 5C44J 3DXJF 2XPWA 3DBRB 2XAGA 2UXNA 4J01A 1XSDA 1HW1A 3ASOH 5BPIA 1ZR4A 2Z9OA 1Y0UA 4HSTA 2DQLA 4XMYA 4XBFA 2L01A 3W3CA 2R7VA 4Y17A 2X0LA 1XCVA 3OYMA 2VXDA 2WV1A 1ZTRA 2EILH 1G3WA 2IS2A 3HKZN 2V6CA 3GEZA 5KCMA 1HDDC 3IKVA 1HF0A 5EZGA 3KCCA 4PSXA 2NS8A 4P9FA 3TOAA 3HHGA 2EFNA 2XRNA 4UVAA 1JTYA 3PNTA 2VL8A 3LA3A 3LSIA 1TNSA 3W6VA 2JSCA 4G7HF 2LH9A 1IXRC 1SFOJ 4OMZA 1Y8RB 3Q3SA 4I7HA 1JGSA 2DMQA 2DK5A 1FC3A 3F8CA 1YX5A 3FIWA 5DUKA 3UKGA 2O61A 2VN2A 1EA3A 2VASA 1X58A 2LYCA 1GXQA 3IH2A 3OOPA 1YJ9I 1XG1A 3BJAA 1VQ5I 2L4AA 5AIPA 4A3FJ 4ZC3A 5EEHA 2CH0A 3S3NA 3CF2A 5EZHA 5F0CA 3MKLA 3HL2A 3VYRB 4CCLA 2K9LA 3LSTA 2LDUA 2Y0SN 4KUMA 3IHUA 4HZFA 3JAMZ 4IZZA 1IV8A 2A69F 3D5SC 4FE7A 2BHYA 5KHDA 2QSHX 3B02A 4PCQA 5K1YA 4G6DA 1X1DA 4EMSA 1R71A 2E71A 2NAZA 3IAS2 2CRGA 3MKYB 3BCBA 4H0EA 2XHKA 3CDHA 4LLNA 4E4HA 1YG2A 3CMMA 5CVIA 1A36A 4R8HA 5HNFA 2HFHA 2OTLI 2I10A 1U9NA 1T08B 1JUMA 2E1CA 3C7JA 1MSFC 4B3XA 2VOOA 3GXOA 1WJDA 4N9HA 2X1EA 4ZZLA 1T6SA 4ANJA 3WODF 2DI3A 5IP6A 3WTWC 5HLGA 1K78A 1MBGA 2FQ4A 1APLC 3MFKA 4A69C 5DEQA 5E3OA 3JRBA 2Z1DA 3MD2A 5F64A 1IDZA 4Z6YA 1ETOA 2ZBKA 3BZ6A 2DDBA 3QWLA 1X1AA 4FQGA 1QRYA 2BW3A 2VBWA 3AG4H 5H6QA 5EGOB 1B1BA 4DJAA 2XKPA 3AKZA 2W85A 2OUMA 3HKZA 4D5CA 3HGGA 2UV1A 2CW7A 2YX7A 3I9V2 3OYBA 2WY8Q 4A93J 2CO5A 2F5CA 1QZYA 2ZFWA 1BOAA 2IAIA 3K1NA 2ACJA 1FTZA 3F6VA 1OKRA 3B73A 4PDKA 3C2GA 4F91B 5M3FJ 4EJWA 3L7WA 1NG6A 5IPAA 3CZ6A 3KYDB 5B66C 2R7UA 3FM3A 3LSRA 3QYFA 3C18A 4MO7A 1MGTA 3RDIA 1IJWC 4B4CA 1X4OA 4ZH4F 1W4MA 2IS6A 3ZQQA 3X2QH 3TDUC 1GXPA 4LITA 1MZBA 1NK3P 3IC7A 5EJCA 2ZB9A 3SEQA 1HSTA 4G6TB 4RB0A 4AVPA 4KNYA 4L5JA 4PFPA 2PJPA 2DTRA 3F23A 5C3EJ 5ICFA 4F55A 5K5OA 2DBBA 1UG0A 2FSWA 1CQTA 1VTNC 4D7NA 2VT2A 2V6EA 1B8IA 3ERMA 2Y30A 1VQ4I 3CQZJ 2FBIA 2L7KA 4EQQA 3QU3A 3P5JA 3M07A 4IQ4A 3CP2A 2X51A 2GZWA 3U2RA 3WTYC 3T0YA 4XLEA 2QM3A 2BOLA 4YFXF 3DCFA 4AD9A 4PJJA 1MJBA 1XDSA 1ZG5A 3ZQLA 3DEEA 3V8LA 1J75A 2XGXA 2KIFA 5JFRA 3S3OA 1BA5A 2V1NA 1W1WE 4A0YA 4GDFA 2F5VA 1LKXA 2DAOA 2X9DA 4A3GJ 2XAFA 4XN3A 2DPDA 4HNUA 1Z0XA 3ZN1A 5L3EA 4OINF 2A07F 2JJ7A 1FBUA 4S04A 1P4WA 2CU7A 2VPRA 1R49A 4NQWA 3D0SA 4CCJA 4EEFG 3DPTA 2RQPA 5B1AH 5LRSA 4A3DJ 1N25A 2V9VA 4N4OB 3A0HC 2A61A 4RB3C 1YIJI 3CMYA 4FE4A 2E36A 5M5YJ 5FLMJ 3HOZJ 3E97A 5FLVA 3VYTB 2BGCA 4N9IA 1U3EM 3ULQB 4AIHA 3WU0A 2M7AA 2RDPA 5CQGA 4QIWN 1KZHA 3R6SA 4NNJA 5DYMA 1WFXA 2EBIA 2W82A 4HEA2 5CVJA 1DPRA 4YEJA 1WJEA 2DFHA 4RS8A 4UY8I 1SMTA 1ZR2A 3OIOA 2BY2A 5F04A 2FEZA 1SVLA 4AM3A 1FIPA 2VBYA 4M3GA 3IH4A 1DGRM 1W5CC 4MQ9F 1IUFA 1QHHD 1EKEA 3NWSA 4CH7A 1GV2A 5BOXA 4KT6A 1HKSA 3I71A 4IL6C 3ONQA 4CUGA 4I98B 4M73A 1G6NA 2FNPA 2QSFX 1IF1A 5BNGA 1FBSA 4AUXA 1ETXA 2CQXA 1FLIA 3HRTA 2DA1A 5K5RA 2ZXJA 3P9KA 2VE9A 1I1GA 1PP7U 1JKQC 3R61A 1CGPA 5L3BA 1EH8A 3H9GA 3OYHA 1GLNA 5DCFA 3V4GA 3ZMZA 3F3XA 1H0MA 1FP2A 2K3PA 1H8AC 2DMPA 2FOWA 1DP3A 3R60A 3FKIJ 2CS3A 3DP7A 4V19K 1V5GA 3MN2A 4Q47A 4BQNA 2DT7B 1VQ7I 1AA7A 2STWA 2V1UA 1ZGWA 2ME0A 4ON0A 1IV6A 4RAFA 2Q2EA 4PGHA 3L2WA 1AOYA 1NG7A 2QA4I 3S2HJ 2EIJH 2X4HA 1SC7A 5J1UA 3ZQIA 3HB9A 5J6XA 2IA1A 4UNOA 2M9HA 4DYCA 2E2JJ 3CCEI 1N75A 1TW3A 3HOWJ 1UMQA 3DTEA 1A6IA 4JBAA 5FO5A 3G1OA 4DIQA 4CYCA 1LVAA 1SFXA 4NHJA 1JJ6C 3CJTB 1X1CA 1ETWA 3DKXA 2O8XA 5H2FC 4DBRA 2P0WA 2XF5A 3MQ0A 2YS9A 1ZHFA 2YUSA 3VODA 2MD0A 3HOTA 2XC7A 4Q4ZF 4RB1A 4U87A 5ILUA 5DDGA 3BR3A 3DFGA 2JRTA 3OOUA 1X4PA 1X3ZB 1SEUA 1O3QA 2GXBA 1GHCA 4KA4A 1KU7A 1SD7A 5K5QA 3PSIA 4IF4A 2Z33A 1MSEC 4BY1J 1LDDA 1XCBA 4KMUX 5E8IA 4Y13A 3CUOA 2HVQA 1MBHA 3U1KA 4D9JA 1T95A 1S3JA 1FYKA 1FP1D 2UZKA 2VT3A 5IT9K 2MD5A 4WXHA 2WBMA 3BLYA 2VC0A 5AIQA 3CDLA 2GA2A 2PQ8A 3ZQCA 2QQ8A 2EQRA 3BZCA 2K7LA 2RREA 2YPRA 1S29A 3LFKA 2KISA 2OTJI 2WAFA 2XGEA 1ZAOA 4QPQA 3KYLA 4E7IA 3HBLA 3OIPA 3F8BA 1FMVA 2JWTA 1PVEA 3K4KA 1ZRCA 1ZELA 3GZ6A 4U7BA 2Y69H 1R1TA 1T33A 2ZNYA 3CC4I 1JUSA 3S93A 1B72A 4CICA 3BP8A 1PP8F 2HU9A 4PFOA 1YW8A 2L54A 5GAGJ 4C30A 4D0PA 3IRRA 2F6CA 4U0WA 5CVRA 2QQAA 2M8EA 1J7KA 1R1UA 4MTDA 1KU9A 3JCUC 1P7IA 1GUUA 2Z2SB 1ETVA 3HXLA 4BEHA 2DTZA 1KYZA 3FMQA 1B6AA 1TT5B 3S2WA 2HDCA 2ID6A 1P4XA 2MYSA 4A3LJ 3GTKJ 1JKOC 2ZMEB 1OCZH 3PQKA 3HTSB 1VQ9I 2CV1A 2CQKA 2COBA 2K4JA 3FXLA 4M9SA 4RM2A 4CO8A 2FRHA 2VKVA 1PJRA 2DA4A 4DYQA 4YG2F 4JX5A 1FY7A 5HS8A 3FXUA 2ZSIB 3COAC 4IKFA 4LIVA 3I58A 2E34A 4E70A 3G2BA 3I0TA 1TTYA 5IT9Z 3W2VA 1FTTA 2IBDA 2P8TA 1OCRH 3HOSA 2HPMA 3E1SA 5D8LB 2FBKA 3IL2A 2ZXHA 3GF2A 1BI2A 2X6WA 4P96A 1IN8A 3B6CA 5DD8A 2EK5A 5J40A 4A3IJ 3BG5A 3VSKA 3LSGA 2Z99A 3IUOA 3M1CA 3HSEA 3WTTC 5FROA 1CF7A 1FOWA 1G3SA 2QQ9A 3DEUA 1UG2A 5HLHA 3ZRGA 1JGGA 2E1MC 1S6LA 4RAYA 1SFEA 2PBIA 2PMUA 2WC2A 4HDVA 3WTZA 3OYJA 2EA2A 4Z2YA 4XIDA 3S3MA 1FBQA 1MIJA 1X2MA 3GW2A 1ULYA 4QTRA 3CDIA 1K7AA 2QKMB 1FSEA 4HV5A 2DT5A 1BC8C 3RYPA 3NARA 3PIOF 4DBQA 1PYVA 5JR3A 3FXJA 2MABA 4HQMA 2LK2A 3BY6A 3JR9A 3A03A 2CWEA 1FZPB 2BVMA 3CMAI 1RIOH 2DFEA 2R7OA 3EQLF 3KZIC 3V8KA 2HOSA 3A0BC 5LHGA 2GQQA 2PJRA 1TNTA 1WWXA 3NEUA 3LWFA 2QLZA 4LMYA 3FXKA 3V7CA 3BQZA 4GXOA 4BGDA 3OS1A 1HXDA 2EJRA 3IRQA 4X6AJ 3CLOA 3MCZA 4G7ZF 5H6RA 1Y56A 3RI4A 5CKTA 3KP3A 3BG7A 3I4MJ 3DLLF 4ZDOA 4ZJZA 2KJBA 2P7CB 1S9HA 1VQLI 3REOA 3KLOA 3L9FA 4E7LA 5J3LA 2H8WA 1SFKA 4I76A 2GA1A 4BDYA 5FJ8J 3WTXC 1UZCA 1ETKA 2WA0A 5F6FA 4U0YA 2NRAC 2QVOA 3SJMA 1XGSA 1F4KA 3JTHA 1R4MB 3KETA 2R4GA 1W5SA 1IRFA 1IN6A 1MD0A 4MQVA 4Y52J 1D8JA 5D6EA 1WJFA 3LFUA 3OL3A 1BR2A 3GTLJ 1U78A 1DQUA 1FPQA 3WGHA 1ZARA 4RMNA 3SDGA 4AIKA 4UB8C 1MBEA 1Y8QB 3HPHA 3OWTA 1WJ5A 2BHZA 3OSFA 2ICWG 4UXNA 2MH9A 1A5JA 4YIIA 3NQOA 4L18B 5HODA 2V1DA 2VE8A 3CCVI 3S32A 4LK0F 1U6GA 2JUCA 3ESWB 3OYIA 1Z91A 4E7SA 3GTJJ 2HR3A 4KICA 4PJLA 4L5EA 5H20A 2BXZA 4BY7J 2OV7A 2CFXA 3ISPA 5LEJA 1MH3A 2IGOA 1YW9A 2VKHA 1ZGJA 2MBFA 2D1VA 3H36A 2R5ZB 4LG0A 2NNNA 1IGNA 1HA8A 2JVGA 1FWZA 1FSHA 5E3MA 5CPRB 3HDDA 2MA3A 1IW7F 3U21A 3DF8A 4R1HA 1WRJA 3P9IA 2NVQJ 1FOKA 2CQ7A 1WSUA 2DA3A 4W1UA 5LHHA 5LHIA 4HQEA 3PIPF 3H0GJ 3A1YA 2R5ZA 2P5VA 2HOEA 4O3MA 2W24A 5K7ZA 3JRFA 5GAEJ 1FOYA 4E7ZA 4JYKA 5D8KB 1Z05A 1H9TA 3EDPA 1VF9A 1S7EA 1ETYA 2JA5J 2MW8A 3GWZA 1ZKGA 2CGPA 3OR1C 2KPMA 3O6BB 2FE3A 3T1BA 3U1DA 5F1JA 1QPMA 2CSOA 2IA2A 3J7AY 4LK1F 2QZ8A 1M1EB 3FXQA 4CZCA 4BE1A 1J0RA 1T0FC 2CUFA 3DBHB 2K5CA 2CFOA 2LOOA 1R5ID 2HI3A 4HW0A 4XSZF 2LD5A 2XIGA 1MDMA 1TW2A 1QNTA 2JA2A 2XSDC 3SQNA 2P4WA 5IT3A 4X0GA 4C2TA 2WV0A 3DPUA 1F5TA 4BBRJ 5CYVA 4J19A 1QPIA 5HNHA 1J5YA 2RV8A 3KP5A 5FKOA 1O57A 1Q1HA 1OFCX 2IEKA 1IN4A 3QODA 4NC6A 1FYLA 2PG4A 1USSA 2R5YA 1L0OC 2J5OA 4EJVA 2O03A 5HDNA 2UUZA 1X1BA 3FBIB 3PM1A 3EPZA 1HOMA 3VDXA 4EJUA 1K4SA 3JREA 1VQ8I 4HX7A 4WXCA 3D5LA 1A35A 1J2XA 5FD5A 4Y33A 4CSWA 2LP0A 4RDUA 3H35A 1ZLKA 5IYDJ 2CMPA 1MMNA 3Q0WA 3PJRA 3A4CA 5DS9A 2DW4A 4A3MJ 4KT5C 2RN7A 3LMMA 2XF7A 4CZZA 4HNVA 3E5UA 5FLXK 2M7BA 5E20A 1WGXA 3K2ZA 5F0FA 3OYEA 2XVCA 1BJAA 1MBJA 3V7RA 4W97A 1RUOA 2BE5F 2HQ5A 1IRXA 1ON2A 3TOBA 3B6AA 1ZYRF 3VB2A 3RKYA 4GO1A 2P5KA 4AYBN 2HYGD 3E3VA 3PUFA 2JZYA 3G3ZA 3WHBA 4HSRA 4BNCA 1YTYA 2LLKA 4H4KC 1OJLA 1FNNA 1K6OA 3BTLA 5GADJ 3KEOA 1U8RA 3K1MA 3IH3A 3NRVA 4AIJA 1VQOI 3ROUA 4IHSA 4ZYHA 3DU5A 3LOCA 3M7GA 4YIFA 2FX0A 4B1RA 1HW2A 1WPKA 1K78B 2H6CA 5FGMA 3LNQA 5FRNA 2VKEA 3K4LA 2YX4A 4OIOF 2LY9A 1IUYA 2VODA 3CJRB 4UUTA 4UUSA 1BR1A 2M0CA 3R0AA 4RB2C 4M6YA 3JRGA 1OMIA 2DODA 4DW6A 1FEXA 2BW3B 5TJJA 4XICA 3CUQA 3HSRA 1QVTA 1TQMA 4ABZA 2DYSH 1HKTA 3T5XA 3SZPA 4II2A 5BQTA 4OIQF 3CTAA 3QOEA 1A6QA 4L0YB 2VBXA 3Q5FA 1Z67A 1LB2A 2K9QA 2VONA 3M1EA 4KISA 5DUIA 1OLTA 2HQAA 2XAUA 5FLXZ 1RRJA 1WZ2A 1AKHA 3CMEI 1IN5A 2XROA 1ON1A 5D5XB 4LD5A 1V4RA 3LSMA 2GIZA 4KIGA 4LIUA 2YR2A 2H27A 4MHGA 3RTRA 1WI9A 1MNEA 3I3LA 2Y2ZA 1ZRFA 1R6RA 5L3FA 3VFZA 1U0JA 1EV7A 4EV0A 1I5ZA 4BH9A 5EG0A 3DPLC 2VOPA 1F9NA 2IT0A 4M9XA 2OU2A 2IA0A 4B8XA 5JHFA 2CV2A 1VI0A 2JN6A 3CUQC 1WHUA 4BQOA 2HTSA 2LKSA 2E1NA 1MNDA 1B8IB 3IV5A 4IX7A 4QWQA 3L2VA 3RZDJ 2HOTA 1MJ9A 4PK4A 4AYBA 3OV8A 1UAAA 3ABMH 3BJ6A 1KYWA 2FUG2 4P1WA 4XRMA 4LB5A 2O0YA 4G94A 2ZKZA 4QLCU 2JVHA 1MH4A 3LQQA 3GO5A 3I59A 2NYXA 5E1WA 2HQRA 4J00A 2FF4A 3GLLA 1T38A 4RLFA 3L2RA 4BE0A 2XPVA 1MJAA 2DOAA 3WGGA 3CF5F 3OYDA 3PNVA 2NVXJ 1ERDA 4XQFA 4HX8A 4KN7X 1VQPI 3I56I 2JQ7A 3KP7A 4BXUA 1KU2A 2KIQA 2DOFA 1KQ8A 2GLOA 2LTPA 3MZYA 3T8TA 4NQWB 3K70C 2HOAA 2LVSA 3HZJA 4FISA 2X6YA 2CUEA 2LFBA 4U0VA 2M5WA 5M5XJ 3F8FA 5D6FA 1RR7A 3D5RC 1P7JA 4IHWA 4LOCA 1Z9CA 4MLOA 3IKTA 4ZYGA 1REPC 2ZSHB 1MW7A 2M87A 5CLSA 1R7JA 4U7DA 2EFPA 3S15J 4OAZA 3QPHA 3CO6C 3ZXSA 4RAZA 1QZZA 1OYIA 1LE8A 1UFMA 5HDGA 3TW7A 3OSGA 4I02A 2VJIA 1ZG3A 4JQFA 2DQRA 3F8MA 1PDNC 2RKHA 3BTCA 1R00A 1ODDA 4ESBA 1XSVA 3H9JA 4B3AA 4ENNA 3F72A 4S0HB 2V7FA 4PZJA 3W2AA 3BDDA 3DV8A 2GM4A 4IQJA 5CJ9A 4U88A 1XSXA 3ASNH 4CXFA 3FF5A 3FISA 2R7TA 1IN7A 2EINH 3HGYA 4ASNA 5TGTA 1BBYA 1FX7A 3J7AO 1NK2P 3SDBA 2BY0A 4YFNF 3H3ZA 1D3YA 2VJJA 4KJZA 1LDKB 4WX9A 1IXSB 5FD6A 2KDZA 3RJPA 3MKWB 1ZLJA 1SD6A 3PQJA 3A02A 3LSPA 2RNGA 2QBYA 4B09A 2X1CA 1O7FA 1Y1WJ 2KLOA 2ZCWA 2DMUA 2Q2EB 2NS0A 1BIAA 4RA2A 3EYIA 2I8DA 2CUJA 2B9SA 1BI3A 3KEYA 2P7VB 3ZMDA 3AAFA 3TO6A 4ZYEA 2FBHA 4LGWA 2EH3A 5JVGF 1J9IA 4BXXJ 2M8GX 1LPQA 9ANTA 4DZPA 3K6GA 4QPOA 1ONVA 3TQNA 2IJLA 3RZOJ 5HLTA 2HNHA 4CYCB 1AHDP 1BN5A 4XL9A 4YRVA 3TEDA 4HG2A 2HXIA 2ZXWH 1XD7A 3E6CC 5D4RA 2IGKA 3R4KA 4DGWB 1ZREA 1YE9A 2IVMA 4XKVA 3PFIA 4AU7A 4BHCA 3JW4A 2L3DA 2Z16A 5EEGA 3ZQGA 4ETSA 1E3HA 2LBFA 1WH7A 3SHFA 5F27A 3TW6A 3ECOA 3K2AA 1K6YA 4E6KG 3FDYA 3GTMJ 1HSJA 1BW6A 1E3PA 3GTOJ 2D45A 2XB0X 1R22A 1UHSA 2MFZA 2K02A 2ZXIA 2HPIA 3S1MJ 1D8KA 2DJIA 3HRMA 3OY9A 1YJNI 4YELA 2JK3A 5D5WB 4C9YA 2QKLB 1A31A 5HS7A 4PGGA 3W2WA 1RUNA 2HVSA 2AXLA 4XOPA 3WTUC 2OQGA 1UB9A 1JKRC 2R93J 4RGXA 5L3GA 1V54H 3BTIA 5E17F 4NDLA 4ZTFA 3DKYA 1HBXG 1UHMA 2KDOA 3CCRI 3OYCA 1XB4A 1YRNA 3TKYA 2NS7A 2MLKA 2Y48A 1TQPA 1LFUP 4KFCA 3N05A 2OPTA 3K1PA 1WCMJ 1RKTA 3Q0UA 3PUBA 1N78A 2UXXA 5FFZA 1FJLA 2LKPA 3G6EI 2GXGA 1LQ1A 2HDDA 2A05A 1B72B 5J4YA 4XONA 1FT9A 2HGCA 2EFWA 1HDPA 1W7PD 1T2KA 2RAEA 2M30A 3EUAA 1YYVA 3TO7A 4IRGA 3NWTA 3QAHA 2VXZA 2O6GE 1RESA 1RPWA 1LFPA 4L5IA 4A2UA 3ZGKA 1LDJA 4CCKA 5JI6A 2W48A 2GBYA 2CV0A 4CDGA 4F52A 1GDTA 2E1MB 4BEHB 3PNYA 1XMAA 3I55I 3BR5A 2LR8A 1ETQA 1OYWA 4ESFA 5F1RA 1BOBA 1ZG1A 1KQ0A 2XPUA 1K4TA 1XMKA 4LLGF 4WK8F 4OU0A 3F22A 2E7WA 4OWRB 5KK1A 3HSFA 2VQCA 3L2UA 2XAJA 2H09A 1MMAA 4FX4A 5IOZA 3BG6A 2KT0A 5JLWA 1NTCA 3DWLE 2EFOA 5EYRA 1W36D 3OYAA 5HLIA 3G1MA 4HYEA 3CCYA 2ADUA 1V5EA 2ISZA 4I99C 4BJ6C 3RQIA 2XB5A 3TO9A 1IDYA 3QPLA 4D7MA 2XASA 3K69A 4YFKF 3U9GA 4ENKA 4BHPA 2ZJPF 4G7OF 5E18F 1EF4A 2HKOA 1JHFA 2WAQN 4JK1X 3WGIA 2E60A 2KRCA 1IRZA 1MMGA 4IOAF 1W0UA 4A12A 4DNCA 1HW5A 1XGOA 3QYEA 4OAYA 4XK4A 4MFDA 1CF7B 1DU6A 4P55A 4ESJA 1ENHA 4KYWA 2OBPA 1SVOA 5J1RA 2QWWA 3ECHA 4JX6A 1GVJA 4BUPA 2VPLA 2OAZA 1E0EA 2EZKA 5AONA 2O9LA 4CHUA 3M8JA 5DCMA 5ICEA 2FD5A 3F8NA 2VB6A 3A01A 4MFEA 2OCCH 3MEXA 3K10A 2O5RA 3VOEA 4XRSA 3BG9A 4HDUA 4BQAA 4O5VA 5FKMA 5B3SH 4BDZA 2PJRB 3CJNA 2OZ6A 4L9TA 2IS4A 1G59A 3HUGA 2A68F 3ABUA 4V2GA 4JX4A 4C3IJ 1DGWY 3BT9A 4YIRX 5DTDA 1S5LC 5JHUA 3VYUB 4RBOA 2V79A 4UVBA 4C2MJ 5GPCA 4C3JJ 2PMZN 2MC3A 1JT0A 4IXAA 4B43A 4BS9A 1OPCA 1TZLA 3PL8A 4CA0A 1PUFA 4A0XA 2HS5A 5FRMA 3HRSA 4HRIA 2G7UA 3JRIA 1TL8A 4A3BJ 2O8KA 4N4NB 5K7FA 3BROA 3G71I 5D5VB 5FKLA 2R3SA 3BC8A 2M4GA 1TQIA 4O6JA 4E7JA 3EYYA 1AWCA 4CCNA 2NNYA 3TL4X 4M6XA 1O3RA 4TV7A 2WADA 2R7XA 4F92B 3R0JA 2EZIA 1UELB 1K79A 1BIBA 1BJZA 4Y15A 2ZJRF 2B63J 2WAQA 4XKCA 3ZMVA 1W7PA 1QO0D 4BJTA 2LNBA 3SZTA 2DA5A 1O3SA 4XKBA 2JPBA 4GGGA 4L9JA 1WQ2A 3DTIA 1P9QC 2DJNA 2IP2A 1YOVB 4DZJA 2B0LA 3CCJI 5DM7F 3J7YJ 4KIBA 3I4PA 1D0YA 3DEWA 2DFIA 1GT0C 1JI8A 3E5XA 4LG0B 4L9VA 5J8CA 5E1XA 4L0ZB 3JRAA 4FCYA 5HDKA 4Y7NJ 2HZTA 1U5TA 3G4SI 1WVRA 4A0ZA 3MZ8A 3OL4A 2C6YA 2DXIA 4XRSG 5TISC 3DBLB 3BPXA 2ELKA 2JRMA 5IP7J 1KGSA 2ZJ2A 3HG9A 2K9MA 2ZC2A 1OCOH 3HHHA 3H3VK 1E17A 2R7RA 3KP6A 4A3CJ 1G3YA 4HLYA 2E1OA 3M4OJ 1T98A 4WCGA 1ZH5A 1KA8A 2EA4A 1B9NA 4A3JJ 3VYSB 1VQNI 2DN0A 1ORKA 2GIVA 5LEKA 2PMZA 1OYYA 2CG4A 1YS6A 3H3UA 2R7FA 4B47A 1VZ0A 2IGNA 5GPAA 4LLLA 4I6ZA 2KKOA 2WY7Q 1YLFA 4IRHA 1B9MA 2X6OA 1R23A 3Q9SA 2FOKA 2OCEA 4JOMA 3LA2A 1MDMB 5F0HA 4XLNF 3AG1H 2P6TA 4DYRA 1N77A 3KX2A 4A6EA 2JMWA 2V1XA 4HF1A 2D5VA 3Q0VA 2MLGA 2HQNA 2DOEA 3C2HA 2DK8A 2EB7A 3ABTA 5KNLA 3I4NJ 3LSHA 2P5LC 2QEXI 2CJJA 4CCOA 5E1ZB 2KMUA 2LMDA 3AFHA 1MBFA 2R5YB 2GXAA 5C4XJ 2W25A 5BS6A 3TBIA 2EIMH 4IEJA 1JTXA 1F1ZA 2LRDA 3H9QA 4PUSA 3O8GA 5LRRA 4EM2A 3BWGA 1YI2I 1OCCH 1VNDA 3QU6A 1TWCJ 2A6EF 3LA7A 2DU9A 2JA8J 3PSFA 2PX9A 4Q48A 5FFXA 1IXCA 4NBQA 5LGTA 3GX4X 3ML6A 4EGZA 3TGNA 5M5WJ 1D0ZA 2DPUA 1SVMA 5M3MJ 1S7OA 4BU2A 5LGNA 3DU6A 2HWVA 2V26A 2R7QA 3EUKL 2ZO4A 3RKXA 4AC0A 1IZ1A 2BXYA 1O3TA 1MBKA 2EV6A 1TLHB 2CQQA 1V55H 3LSKA 2CW0F 1TBXA 3QQAA 1X2NA 2IW5A 4RLQA 1MNMC 2JTVA 5HOOA 2I5UA 3BJOA 3AL0C 2CYYA 4IHVA 2RVCA 1YW7A 3RPQA 1STZA 1XTAA 4ZZDA 3E6BA 1I1SA 3MVPA 3RYRA 1H89C 2R0QC 3C2BA 2KFDA 5IYCJ 2E5NA 2ZNZA 1ZGAA 2L4MA 4KN4X 2COMA 1QA6A 3GBGA 4IVNA 3IAM2 3BR2A 1BM9A 2X1DA 4UVCA 2OF7A 2F2EA 3EUHA 2LF7A 1RKWA 4E7HA 5FKNA 2HDWA 3HJEA 3KPHA 1E2XA 4UB6C 1G4DA 4UUSB 1Y6IA 5GP9A 1P2FA 2PN6A 3FKJA 2A3SA 3HEFA 2BY1A 3HIFA 2YSRA 2VJ5A 4M71A 2LREA 3CUQB 4BE2A 1FYMA 2L5QA 3M8FA 5KVRA 2LSOA 3F9KA 4MNUA 5F08A 5ERIA 2VKDA 3ZPLA 1GV5A 5C4JJ 2HYFA 3RKWA 2KIMA 3HC7A 5J1YA 4FTHA 4XRFA 5E3LA 4GCVA 1O7LA 1XN7A 4BHBA 2XGDA 1LNWA 3KLNA 5BPDA 2L02A 2M45A 3LQRA 4XOTA 3PO3J 1HC8A 4FASD 3KP4A 4MIMA 3LAJA 3ZR8X 3ZCOA 3CJQB 3K4CA 4OMYA 4KITB 2O7OA 3RPUD 1DU0A 2J5PA 1AKHB 2CQNA 4UV8A 4ITVA 2LY1A 4XLCA 2EPFA 3IWZA 4FT8A 4I0BA 2QGUA 1WKMA 3MMYB 2BVLA 1RZ4A 2EV5A 2JSPA 4AIDA 1EH6A 4C3HJ 2A6TA 1O4XA 1R36A
chains in the Genus database with same CATH topology
2CV1A 4RM3A 3AL0B 2I8DA 2CUJA 2LG4A 3EUHC 4RM2A 4BL0B 3KEYA 1PJRA 1QHGA 2VJ4A 2IXSA 4HPQA 1KONA 2ZSIB 4IKFA 4LIVA 1D1BA 4ZDLA 3G2BA 3W2VA 3TMOA 5LFAA 1Z21A 3K6GA 4QPOA 3K4JA 3HOSA 1X19A 2HPMA 5HLTA 3E1SA 2HNHA 2ZXHA 4XL9A 4YRVA 2X6WA 4HG2A 4NC8A 3VWBA 4DOZA 2IGKA 3VSKA 4BXFA 3K4MA 3LSGA 3M1CA 3IUOA 4DGWB 1YE9A 4XKVA 4AU7A 4CCMA 1W36C 2R7WA 3K70D 5FROA 1Z3YA 2Z16A 2HVRA 2LBFA 2CW8A 2VQGA 3ZRGA 2E1MC 4E6KG 1K6YA 3FDYA 3OYJA 2V4JC 2VQLA 2MFZA 1MMDA 2ZXIA 2HPIA 3MKZA 2AQFA 3S3MA 2ZFUA 2DJIA 4ZYAA 3OY9A 1TT0A 2QKMB 3H5AA 4YELA 2CUZA 4C9YA 4DBQA 4J01A 1PYVA 2QKLB 2MABA 4HSTA 2L9SA 4XMYA 3W2WA 2HVSA 3W3CA 2R7VA 2KP6A 4P5OA 4XOPA 5LD2C 3OYMA 2BVMA 2VXDA 2Y0SA 2IS2A 2R7OA 4PSWA 2PJRA 4ZTFA 3DKYA 5KCMA 4PSXA 2KDOA 3OYCA 2WAEA 4BGDA 1J09A 3OS1A 3PNTA 2VL8A 2W4SA 1Y56A 3FHNA 3LSIA 2KQRA 5CKTA 2LH9A 3BG7A 3N05A 4ZDOA 2F4IA 3PUBA 1N78A 4ZJZA 1YX5A 1S9HA 1EA3A 4XONA 2VASA 2LYCA 2XF6A 3CESA 4E7LA 3EUAA 5CQEA 1SFKA 3NWTA 4GRIA 2MC4A 2VXZA 4BDYA 4PJMA 2WA0A 4BJ5C 3V42A 2KRHA 4ZC3A 3OYKA 4NUBA 2CH0A 1LFPA 3S3NA 3CF2A 3ZGKA 4CCKA 2R4GA 2NOJB 3HL2A 3VYRB 4CCLA 2K9LA 4IZZA 2CV0A 4F52A 2E1MB 3DLAA 1WJFA 3LFUA 4BEHB 3D5SC 3OL3A 3PNYA 1BR2A 5KHDA 1DQUA 4RMNA 2AQEA 3HPHA 1X1DA 3RCOA 1BOBA 3OWTA 3IAS2 1WJ5A 3MKYB 3BCBA 3H5NA 2VIXA 4E4HA 3CMMA 4OWRB 2VQCA 3L2UA 2KZVA 3S32A 1MMAA 3OYIA 3BG6A 4E7SA 3DWLE 2R7SA 5HNFA 1W36D 3OYAA 4PJLA 1V5EA 4BJ6C 1SAUA 2OV7A 4B3XA 1WJDA 2IGOA 2VKHA 3OS2A 2X1EA 3DQVC 4ANJA 3SYTA 4LG3A 2E60A 2KRCA 1HA8A 2JVGA 1MMGA 5CPRB 2Z1DA 2XSJC 3MD2A 4XLHA 1D0XA 3U21A 1G8XA 3QYEA 4OAYA 4XLAA 4XNFA 4AVZA 4EATA 5HVQC 3SZGA 2LBFB 1X1AA 2UWMA 2BW3A 3A1YA 2M4KA 4DJAA 3AKZA 3OR2C 2OUMA 3HKZA 4BQQA 2UV1A 1FMWA 2CW7A 4E7ZA 4BUPA 2VPLA 3I9V2 3UNGC 2VLAA 3OYBA 2WY8Q 1E0EA 4ZDPA 3M8JA 2WB1A 2DT6A 3C2GA 2VB6A 3OR1C 2KPMA 4F91B 1NG6A 3CZ6A 3K10A 2O5RA 2R7UA 3QYFA 3J7AY 1X4OA 4CZCA 4BE1A 1T0FC 2IS6A 3ZQQA 2K5CA 2KL4A 2CFOA 2LOOA 4BDZA 2PJRB 2IS4A 4LITA 1G59A 4F3QA 4R79A 2JA2A 4X0GA 3SEQA 1DGWY 4C2TA 3DPUA 4G6TB 3VYUB 5HNHA 3K4NA 4PFPA 3QODA 4Y4RA 3OYGA 3LL7A 4B43A 4BS9A 4F55A 1TZLA 3PL8A 4CA0A 1UG0A 2UUZA 1X1BA 3FBIB 3EPZA 3VDXA 2V6EA 3D5LA 4Y33A 4CSWA 2L7KA 3H35A 5FRMA 4HRIA 2CMPA 1MMNA 2GOMA 4IQ4A 3CP2A 3RSNA 3PJRA 2X51A 3A4CA 4N4NB 4Y3OA 4XLEA 4C2UA 3LMMA 3SEZA 2BOLA 2XF7A 3BC8A 4PJJA 2M7BA 4XM3A 2M4GA 4E7JA 3DEEA 4CCNA 2GOXB 3TL4X 3OYEA 2WADA 3S3OA 2R7XA 2V1NA 4F92B 2F5VA 1LKXA 1UELB 1IRXA 4F93B 2WAQA 4XKCA 4BJTA 4XN3A 4HNUA 4BACA 3OMYA 4XKBA 1WJBA 4HSRA 3DTIA 1P9QC 4H4KC 4CCJA 3DPTA 4B48A 4N4OB 2IS1A 1D0YA 1JI8A 3DU5A 3VYTB 2KHMA 2A5WA 5FRNA 3K4LA 3A2KA 2M7AA 5CQGA 3CJRB 4ZTJA 4NNJA 4XN0A 2M3AA 1BR1A 2Q1ZB 1WFXA 2W82A 3OL4A 4HEA2 2V9KA 4YEJA 3S8PA 2DXIA 1WJEA 2BW3B 1V5FA 3OS0A 3HG9A 2K9MA 1WJAA 2R7RA 1DGRM 1QHHD 4CH7A 3NWSA 4KT6A 3ONQA 4II2A 4CUGA 3OYNA 3QOEA 3VYSB 3DTKA 4NC7A 4XORA 4KISA 1OLTA 2DCEA 2PMZA 4D1QA 2HQAA 2XAUA 2X85A 4B47A 3H9GA 1VZ0A 2IGNA 3OYHA 1GLNA 2WY7Q 2RQQA 2X6XA 2LC2A 2K3PA 3LSMA 3OIQA 4LIUA 1DP3A 2CS3A 4JOMA 1V5GA 2XDVA 3BCAA 4BQNA 2DT7B 3HUGB 1AA7A 3RTRA 1N77A 3H5RA 3KX2A 1MNEA 3I3LA 1R6RA 3L2WA 3C2HA 2A6TA 1NG7A 2ELJA 1U0JA 5KNLA 3LSHA 4CCOA 3DPLC 2KMUA 3AFHA 3TBIA 5JHFA 1D1CA 2LRDA 3H9QA 2CV2A 4PUSA 1N75A 4BQOA 3DTEA 1MNDA 3VSLA 3CP8A 4DIQA 4IX7A 3L2VA 4II3A 1D1AA 1X1CA 1WJCA 3PSFA 4PK4A 4AYBA 1UAAA 3DKXA 2FUG2 4P1WA 4DBRA 2P0WA 2XF5A 4FETA 1OR7C 2MD0A 1D0ZA 2JVHA 3HOTA 2XC7A 4BU2A 3DU6A 4J00A 4U87A 2V26A 2R7QA 4RLFA 3L2RA 1LVKA 2HZDA 3EUKL 4XLFA 3OOUA 3OYLA 4BE0A 1X4PA 4XKWA 2DOAA 3LSKA 3L2QA 1Z3XA 3OYDA 3PSIA 3PNVA 1ERDA 4XQFA 3RQ4A 4RLQA 3HPGA 5HOOA 3AL0C 4E7KA 4NQWB 2HVQA 3K70C 4D9JA 1T95A 2X6YA 4HNTA 2WBMA 3BLYA 3D5RC 2OC6A 2E5NA 3K4BA 4MLOA 4B44A 3GBGA 3IAM2 1MW7A 2RREA 2X1DA 2ZSHB 2M0MA 2L2OA 4E7HA 2HDWA 2WAFA 1Y6IA 4QPQA 3KYLA 4OAZA 4E7IA 3FKJA 3OIPA 1FMVA 3ZXSA 3IP4B 1YX3A 2VJ5A 1BR4A 2LREA 2IGMA 3K4KA 4BE2A 1ZELA 2L5QA 3FBNB 4U7BA 2VJIA 3F9KA 4JQFA 2JUGA 3S93A 2VQHA 2VKDA 2HU9A 4PFOA 3H9JA 2W00A 4C30A 3HC7A 2V7FA 3W2AA 2W1OA 4IQJA 3H0DA 2F6CA 2W7NA 3E0JB 3UR3C 4XOTA 3OYFA 1Z7LA 2E5ZA 4FASD 3ZR8X 3ZCOA 2R7TA 3PFYA 1QU3A 2LY2A 3CJQB 2Z2SB 3K4CA 4XR6A 5TGTA 3RPUD 4KITB 3HXLA 4XLCA 3SDBA 4ITVA 2LY1A 4BEHA 4PJNA 2VJJA 4KJZA 3QYBA 1LDKB 3MMYB 2L9NA 2MYSA 3MKWB 2BVLA 2RNGA 2JSPA 2X1CA 2KLOA 2Q2EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KP6 A; 
#chains in the Genus database with same CATH topology
 4RM3 A;  2LG4 A;  3EUH C;  2FNA A;  4HLX A;  4AWX B;  2OA4 A;  2TRT A;  2FJ1 A;  5EG0 B;  3EET A;  3GZ5 A;  2HXO A;  5JLX A;  1KON A;  2LF8 A;  2Y0M A;  1F43 A;  2W57 A;  2ISY A;  4WWC A;  1D1B A;  4ZDL A;  2GWR A;  3BQY A;  2XRL A;  1HQC A;  5LFA A;  1Z21 A;  2WTE A;  2DA7 A;  5ICC A;  4GYG A;  2EIK H;  1R5G A;  5LGU A;  1JUP A;  1BI1 A;  4V2F A;  3S16 J;  4WF2 A;  1VQ6 I;  2OD5 A;  3ABK H;  1PUE E;  5B1B H;  5IP9 J;  3VWB A;  4UHT A;  3V7S A;  4DQ2 A;  4BXF A;  3ZMU A;  4I01 A;  4CCM A;  1X3W B;  2R7W A;  2K86 A;  3I59 B;  5L3C A;  5E3N A;  3WG7 H;  3GUD A;  2CW8 A;  5EGO A;  4M74 A;  2BEO A;  2AXT C;  1BC7 C;  1XPX A;  3BZK A;  1MMD A;  2AQF A;  3CCS I;  1X3U A;  1R58 A;  1ZQ3 P;  1TT0 A;  1L3L A;  2OZU A;  1MMS A;  3H5A A;  3CLQ A;  1T8I A;  2F5F A;  4A5M A;  2CUZ A;  4RAG A;  2VI6 A;  1H9G A;  1SMY F;  4FX0 A;  3JRD A;  2L9S A;  3O2P E;  3I64 A;  4EM0 B;  3G1L A;  4P5O A;  5LD2 C;  1RC9 A;  2Y0S A;  4M72 A;  4UUV A;  1P92 A;  2Q0O A;  4PSW A;  3TDZ C;  3M9A A;  1Z1D A;  1TWA J;  4WXD A;  1J59 A;  3QOP A;  3WE3 A;  4G12 A;  2WAE A;  1JE8 A;  3KP2 A;  3ERE D;  3F21 A;  1SAX A;  1J09 A;  4I0A A;  2ELH A;  6PAX A;  3C3W A;  2WB1 N;  2W4S A;  2WWY A;  3FHN A;  2KQR A;  2L9R A;  1P4A A;  1W0T A;  4X1E A;  3M8E A;  2OJE D;  3AG3 H;  1LE8 B;  2XGC A;  1R1V A;  2F4I A;  3FK7 A;  4RGS A;  2K27 A;  4L9N A;  5B5E C;  2F5D A;  3I5U A;  2XF6 A;  3CES A;  1VFC A;  5GTI C;  1T39 A;  1YO5 C;  5CQE A;  3E6M A;  1U2W A;  2R92 J;  4GRI A;  5E79 C;  3WE2 A;  2MC4 A;  4PJM A;  4BJ5 C;  1P6R A;  2EZH A;  3I54 A;  2KRH A;  1XGM A;  2L0K A;  5FKK A;  3V42 A;  3OYK A;  2STT A;  4NUB A;  2F5E A;  3ABL H;  1JXS A;  2AHQ A;  2NOJ B;  1XGN A;  2AO9 A;  2M34 A;  3WHC A;  3DLA A;  4M3B A;  3WTV C;  1XMX A;  2Y75 A;  1EH7 A;  2JA6 J;  2OQR A;  2DYR H;  3SFZ A;  2AQE A;  1JT6 A;  3RCO A;  2QBY B;  3ZQF A;  1FOX A;  3H5N A;  2VIX A;  1B59 A;  5CVU A;  4HV6 A;  3JRH A;  2DO7 A;  2KZV A;  1GVD A;  4G6Q A;  5GAH J;  1X1P A;  5IYB J;  1HLV A;  2R7S A;  1TWF J;  4OIP F;  2G0E A;  1SAU A;  2NVU B;  1LEB A;  1IC8 A;  2PLY A;  3RPU A;  3HOY J;  4IO9 F;  5L3D A;  3HTU A;  1UCR A;  2QSG X;  3OS2 A;  2R7D A;  3DQV C;  1SD4 A;  4EJT A;  2QQB A;  3SYT A;  4CYD A;  2N8G A;  4LG3 A;  3D1N I;  1Z7U A;  3QP5 A;  1HCR A;  3Q9V A;  3K0L A;  4OIR F;  5D4S A;  2FA5 A;  3J7Z I;  3V8J A;  1VQK I;  2IPQ X;  1D5Y A;  1EJ9 A;  2XSJ C;  2A6H F;  3J81 K;  3RKQ A;  4XLH A;  4JP0 A;  1D0X A;  1XX5 A;  1G8X A;  2Z5U A;  2BYV E;  2RC4 A;  4XLA A;  4XNF A;  4AVZ A;  4EAT A;  4F7Z A;  4D5F A;  5HVQ C;  5LBQ A;  5D5U B;  1SFU A;  3SZG A;  2LBF B;  1TC3 C;  1BI0 A;  2UWM A;  2DMT A;  2M4K A;  3OR2 C;  1I27 A;  1OIS A;  4BQQ A;  1I6H J;  1FMW A;  2QEN A;  3UNG C;  2VLA A;  3O8H A;  1A04 A;  1T56 A;  3ZMS A;  4ZDP A;  3GTG J;  2JA7 J;  2RGV A;  2XAH A;  4I2O A;  2H94 A;  2WB1 A;  2DT6 A;  1Z6R A;  4A3K J;  4FHT A;  3ZOB A;  3WU2 C;  1S8N A;  2PFB A;  1JKP C;  1VQM I;  2BY3 A;  2VBZ A;  1U8B A;  2ESH A;  2KL4 A;  2H1K A;  3TP0 A;  4BBS J;  1ACI A;  5ICG A;  1QBJ A;  5TRD A;  3KEQ A;  4MTE A;  4F3Q A;  5DM6 F;  4R79 A;  2G9W A;  1YRN B;  2DLL A;  1IRG A;  3HOU J;  3S1Q J;  3FK6 A;  3CCQ I;  2A5Y B;  2K4B A;  3K4N A;  2MH2 A;  2MG4 A;  4GYI A;  1Y0N A;  1LFB A;  2B7E A;  4Y4R A;  3OYG A;  4MEX F;  3O3K A;  3LL7 A;  4M9Z A;  1S72 I;  1YIO A;  2BV6 A;  3TP3 A;  4A3E J;  1DUX C;  2NOG A;  3WU1 B;  2K3F A;  1YFH A;  2P81 A;  1AU7 A;  3GCM A;  3WG9 A;  2HEO A;  4BYY A;  2DA2 A;  2P6S A;  2GOM A;  3RSN A;  1LJ9 A;  2NXN B;  4Y3O A;  4KDP A;  3J81 Z;  4HAM A;  4C2U A;  3S1N J;  2XKO A;  3SEZ A;  4MEY F;  3K7A J;  2EWN A;  4EM1 A;  3E7L A;  2Z3Y A;  4XM3 A;  3T8R A;  1RR8 C;  4Q5S F;  4NB5 A;  2GOX B;  3GTQ J;  5ILV A;  2NVT J;  2DFF A;  3GYH X;  1LUJ B;  4QSH A;  3ZQ7 A;  2YU9 J;  3GZN B;  4F93 B;  5EEA A;  1QGP A;  1DP7 P;  3QPS A;  5CVV A;  4BAC A;  3OMY A;  2M1B A;  2ID3 A;  2EV0 A;  1WJB A;  5IOY A;  2EFQ A;  2QF7 A;  1RI7 A;  3LAP A;  2JT1 A;  4ENM A;  4LB6 B;  2VC1 A;  1I50 J;  4HF0 A;  3HOX J;  3ZMT A;  2L9V A;  3N4M A;  3SFI A;  3FHZ A;  2IRF G;  2TCT A;  2ECB A;  4B48 A;  2IS1 A;  3QRF F;  1R4N B;  3KZY A;  3S17 J;  4LFU A;  1IAW A;  3CCU I;  2V9P A;  2KHM A;  2MGQ A;  3MAJ A;  2FQ3 A;  2A5W A;  4S05 A;  4XLP F;  3A2K A;  1TP4 A;  2QCO A;  1YHQ I;  4ZTJ A;  4XN0 A;  4A5N A;  2D1H A;  2M3A A;  2NVY J;  2Q1Z B;  1UST A;  2JPC A;  2V9K A;  3S8P A;  4P9U A;  2MSY A;  1Q1V A;  3CC7 I;  4A6D A;  1V5F A;  3KIO A;  3OS0 A;  4IHY A;  2BBY A;  3GFM A;  1G3T A;  1WJA A;  3E5Q A;  3GFI A;  2ZJQ F;  1XS9 A;  2E35 A;  3DKW A;  1QQI A;  3F0C A;  2QUF A;  4M6V A;  3FMR A;  2R7Z J;  3GLX A;  5EF6 A;  1E3O C;  1I3Q J;  1NH3 A;  3FMS A;  5E8G A;  3OYN A;  5DCM B;  3CC2 I;  4BAY A;  1TWG J;  2KRF A;  1OR7 A;  3A01 B;  3DTK A;  4K2E A;  4NC7 A;  4XOR A;  2Y9Y A;  1F36 A;  2DDA A;  2D2W A;  2O3F A;  2DCE A;  4D1Q A;  2X85 A;  3J80 K;  1R9T J;  1ITY A;  3NAU A;  1IG7 A;  2L7M P;  2RQQ A;  2X6X A;  2LC2 A;  3BPV A;  3OIQ A;  3MWM A;  4ZYD A;  3KFW X;  1RET A;  2K9S A;  2XDV A;  3BCA A;  1H88 C;  3HUG B;  2ZME A;  2DA6 A;  3S1R J;  3H5R A;  1ZK8 A;  2W84 A;  2K40 A;  1OQY A;  2F4O B;  3FZV A;  3LSJ A;  2E2H J;  4IPA A;  4IHX A;  3GFL A;  3P7N A;  2Q8K A;  4ENJ A;  3RIR A;  2ELJ A;  4KIF A;  4MGR A;  4HF2 A;  2PEX A;  2LKX A;  4M3D A;  1JJ8 C;  3HYI A;  3MZH A;  3S14 J;  1D1C A;  1PUF B;  3PO2 J;  3ELK A;  2L7Z A;  3BG3 A;  5ILS A;  1KU3 A;  1TWH J;  2KZG A;  2H6B A;  3VSL A;  1Y1V J;  3CP8 A;  4RGR A;  1OCP A;  3N97 A;  3W6K B;  3BR1 A;  2X48 A;  4II3 A;  1D1A A;  1BL0 A;  1WJC A;  5EDN A;  3ZN0 A;  1B4A A;  3VPR A;  1OCT C;  5LLQ A;  4FET A;  1OR7 C;  3L2C A;  3W6J B;  4IJA A;  3FXR A;  5IY5 H;  1Y39 A;  4KMF A;  3C1D A;  3BTJ A;  4EJO A;  1YQA A;  2FMY A;  1LVK A;  2HZD A;  4XLF A;  5ED4 A;  3OYL A;  1DDN A;  2QYO A;  3BR6 A;  4XKW A;  3HRU A;  3L2Q A;  1Z3X A;  4EGY A;  1XC5 A;  1W7P B;  2ZME C;  4IHT A;  3RQ4 A;  3QPT A;  5A2Q K;  2E2I J;  4IOC F;  5DV5 A;  3HPG A;  3FM5 A;  2E7X A;  4E7K A;  1YJW I;  3JRC A;  3IWF A;  4HBL A;  3GVA A;  3VEP A;  2TDX A;  3J80 Z;  3CO7 C;  3L09 A;  3GFJ A;  2F4M B;  5J8F A;  1BW5 A;  2ESN A;  3BOQ A;  4HNT A;  2L7F P;  1ZN2 A;  2OC6 A;  2AS5 F;  3HM5 A;  3K4B A;  4CGZ A;  2XAQ A;  3KZZ A;  1DPU A;  1LEA A;  2G7H A;  4B44 A;  1D5V A;  2K85 A;  2M0M A;  1NHA A;  2ECC A;  2Y9Z A;  2EZL A;  2L2O A;  1U5T B;  2F48 A;  2GAU A;  3JSO A;  3L1P A;  3ZP5 A;  3CD6 I;  4UV9 A;  3IP4 B;  1I39 A;  1YX3 A;  1BR4 A;  2IGM A;  3SXY A;  1S7A A;  5K7H A;  5KAF C;  4HOB A;  3FBN B;  5DD4 A;  3QP6 A;  3F6O A;  3CCL I;  2JUG A;  1MKM A;  3G73 A;  1HKQ A;  2VQH A;  3KYC B;  4M3F A;  2KIU A;  1U9O A;  4LJZ F;  2KJC A;  1WH5 A;  1POG A;  2W00 A;  2W1O A;  3H0D A;  3E6D A;  4HX4 A;  3ZQH A;  1QZE A;  5HS9 A;  2W7N A;  3M3Y J;  3E0J B;  3AG2 H;  3UR3 C;  2FU4 A;  3H92 A;  3OYF A;  1Z7L A;  2E5Z A;  3CCM I;  3I53 A;  2H8R A;  3HOV J;  1V3F A;  3PFY A;  1SD5 A;  1XDU A;  1QU3 A;  4M3E A;  2LY2 A;  4XR6 A;  1ZRD A;  3L00 A;  1RNL A;  2FML A;  2FXA A;  1YIT I;  4PJN A;  2Y31 A;  3QYB A;  2L9N A;  1K61 A;  2BZT A;  3JSP A;  3H1C A;  1QVU A;  1T0F A;  5BMZ A;  3FWE A;  2VUM J;  2ME6 A;  2KP6 A;  5A2Q Z;  2ETH A;  1WI3 A;  5J4V A;  4G8X A;  4HA8 A;  4BL0 B;  3AL0 B;  4RGU A;  5GTH C;  1SAN A;  2HTJ A;  2XUB A;  3FX3 A;  3JTG A;  1QHG A;  1Z6T A;  1R5H A;  2M2E A;  4GFB A;  2VJ4 A;  2IXS A;  5KAI C;  2PMH A;  2YU3 A;  4PJ0 C;  4HPQ A;  1I6X A;  3BR0 A;  4XSX F;  1W5T A;  2HYJ A;  4G9Y A;  3GME A;  1UJ8 A;  3WTS C;  3TMO A;  2RNJ A;  3FXO A;  2K9N A;  1UHW A;  3K4J A;  1X19 A;  3KE2 A;  5J47 A;  3S2D J;  1U5T C;  1G2H A;  4IRI A;  4NC8 A;  4EVI A;  5JVT A;  4DOZ A;  3GTP J;  1IO2 A;  1K83 J;  1KQ9 A;  3K4M A;  2E19 A;  1W36 C;  3P9C A;  5FB2 A;  3JAM K;  3K70 D;  1Z3Y A;  3FXM A;  2HVR A;  4OOI A;  2HKX A;  2VQG A;  1Z77 A;  2H1L A;  2DMN A;  4BKX A;  4I09 A;  4N0B A;  3K9T A;  2V4J C;  2VQL A;  1YS7 A;  1I3A A;  3MKZ A;  1JHH A;  2ZFU A;  4ZYA A;  1C0W A;  1FIA A;  2XV4 S;  2PI0 A;  5C44 J;  3DXJ F;  2XPW A;  3DBR B;  2XAG A;  2UXN A;  4J01 A;  1XSD A;  1HW1 A;  3ASO H;  5BPI A;  1ZR4 A;  2Z9O A;  1Y0U A;  4HST A;  2DQL A;  4XMY A;  4XBF A;  2L01 A;  3W3C A;  2R7V A;  4Y17 A;  2X0L A;  1XCV A;  3OYM A;  2VXD A;  2WV1 A;  1ZTR A;  2EIL H;  1G3W A;  2IS2 A;  3HKZ N;  2V6C A;  3GEZ A;  5KCM A;  1HDD C;  3IKV A;  1HF0 A;  5EZG A;  3KCC A;  4PSX A;  2NS8 A;  4P9F A;  3TOA A;  3HHG A;  2EFN A;  2XRN A;  4UVA A;  1JTY A;  3PNT A;  2VL8 A;  3LA3 A;  3LSI A;  1TNS A;  3W6V A;  2JSC A;  4G7H F;  2LH9 A;  1IXR C;  1SFO J;  4OMZ A;  1Y8R B;  3Q3S A;  4I7H A;  1JGS A;  2DMQ A;  2DK5 A;  1FC3 A;  3F8C A;  1YX5 A;  3FIW A;  5DUK A;  3UKG A;  2O61 A;  2VN2 A;  1EA3 A;  2VAS A;  1X58 A;  2LYC A;  1GXQ A;  3IH2 A;  3OOP A;  1YJ9 I;  1XG1 A;  3BJA A;  1VQ5 I;  2L4A A;  5AIP A;  4A3F J;  4ZC3 A;  5EEH A;  2CH0 A;  3S3N A;  3CF2 A;  5EZH A;  5F0C A;  3MKL A;  3HL2 A;  3VYR B;  4CCL A;  2K9L A;  3LST A;  2LDU A;  2Y0S N;  4KUM A;  3IHU A;  4HZF A;  3JAM Z;  4IZZ A;  1IV8 A;  2A69 F;  3D5S C;  4FE7 A;  2BHY A;  5KHD A;  2QSH X;  3B02 A;  4PCQ A;  5K1Y A;  4G6D A;  1X1D A;  4EMS A;  1R71 A;  2E71 A;  2NAZ A;  3IAS 2;  2CRG A;  3MKY B;  3BCB A;  4H0E A;  2XHK A;  3CDH A;  4LLN A;  4E4H A;  1YG2 A;  3CMM A;  5CVI A;  1A36 A;  4R8H A;  5HNF A;  2HFH A;  2OTL I;  2I10 A;  1U9N A;  1T08 B;  1JUM A;  2E1C A;  3C7J A;  1MSF C;  4B3X A;  2VOO A;  3GXO A;  1WJD A;  4N9H A;  2X1E A;  4ZZL A;  1T6S A;  4ANJ A;  3WOD F;  2DI3 A;  5IP6 A;  3WTW C;  5HLG A;  1K78 A;  1MBG A;  2FQ4 A;  1APL C;  3MFK A;  4A69 C;  5DEQ A;  5E3O A;  3JRB A;  2Z1D A;  3MD2 A;  5F64 A;  1IDZ A;  4Z6Y A;  1ETO A;  2ZBK A;  3BZ6 A;  2DDB A;  3QWL A;  1X1A A;  4FQG A;  1QRY A;  2BW3 A;  2VBW A;  3AG4 H;  5H6Q A;  5EGO B;  1B1B A;  4DJA A;  2XKP A;  3AKZ A;  2W85 A;  2OUM A;  3HKZ A;  4D5C A;  3HGG A;  2UV1 A;  2CW7 A;  2YX7 A;  3I9V 2;  3OYB A;  2WY8 Q;  4A93 J;  2CO5 A;  2F5C A;  1QZY A;  2ZFW A;  1BOA A;  2IAI A;  3K1N A;  2ACJ A;  1FTZ A;  3F6V A;  1OKR A;  3B73 A;  4PDK A;  3C2G A;  4F91 B;  5M3F J;  4EJW A;  3L7W A;  1NG6 A;  5IPA A;  3CZ6 A;  3KYD B;  5B66 C;  2R7U A;  3FM3 A;  3LSR A;  3QYF A;  3C18 A;  4MO7 A;  1MGT A;  3RDI A;  1IJW C;  4B4C A;  1X4O A;  4ZH4 F;  1W4M A;  2IS6 A;  3ZQQ A;  3X2Q H;  3TDU C;  1GXP A;  4LIT A;  1MZB A;  1NK3 P;  3IC7 A;  5EJC A;  2ZB9 A;  3SEQ A;  1HST A;  4G6T B;  4RB0 A;  4AVP A;  4KNY A;  4L5J A;  4PFP A;  2PJP A;  2DTR A;  3F23 A;  5C3E J;  5ICF A;  4F55 A;  5K5O A;  2DBB A;  1UG0 A;  2FSW A;  1CQT A;  1VTN C;  4D7N A;  2VT2 A;  2V6E A;  1B8I A;  3ERM A;  2Y30 A;  1VQ4 I;  3CQZ J;  2FBI A;  2L7K A;  4EQQ A;  3QU3 A;  3P5J A;  3M07 A;  4IQ4 A;  3CP2 A;  2X51 A;  2GZW A;  3U2R A;  3WTY C;  3T0Y A;  4XLE A;  2QM3 A;  2BOL A;  4YFX F;  3DCF A;  4AD9 A;  4PJJ A;  1MJB A;  1XDS A;  1ZG5 A;  3ZQL A;  3DEE A;  3V8L A;  1J75 A;  2XGX A;  2KIF A;  5JFR A;  3S3O A;  1BA5 A;  2V1N A;  1W1W E;  4A0Y A;  4GDF A;  2F5V A;  1LKX A;  2DAO A;  2X9D A;  4A3G J;  2XAF A;  4XN3 A;  2DPD A;  4HNU A;  1Z0X A;  3ZN1 A;  5L3E A;  4OIN F;  2A07 F;  2JJ7 A;  1FBU A;  4S04 A;  1P4W A;  2CU7 A;  2VPR A;  1R49 A;  4NQW A;  3D0S A;  4CCJ A;  4EEF G;  3DPT A;  2RQP A;  5B1A H;  5LRS A;  4A3D J;  1N25 A;  2V9V A;  4N4O B;  3A0H C;  2A61 A;  4RB3 C;  1YIJ I;  3CMY A;  4FE4 A;  2E36 A;  5M5Y J;  5FLM J;  3HOZ J;  3E97 A;  5FLV A;  3VYT B;  2BGC A;  4N9I A;  1U3E M;  3ULQ B;  4AIH A;  3WU0 A;  2M7A A;  2RDP A;  5CQG A;  4QIW N;  1KZH A;  3R6S A;  4NNJ A;  5DYM A;  1WFX A;  2EBI A;  2W82 A;  4HEA 2;  5CVJ A;  1DPR A;  4YEJ A;  1WJE A;  2DFH A;  4RS8 A;  4UY8 I;  1SMT A;  1ZR2 A;  3OIO A;  2BY2 A;  5F04 A;  2FEZ A;  1SVL A;  4AM3 A;  1FIP A;  2VBY A;  4M3G A;  3IH4 A;  1DGR M;  1W5C C;  4MQ9 F;  1IUF A;  1QHH D;  1EKE A;  3NWS A;  4CH7 A;  1GV2 A;  5BOX A;  4KT6 A;  1HKS A;  3I71 A;  4IL6 C;  3ONQ A;  4CUG A;  4I98 B;  4M73 A;  1G6N A;  2FNP A;  2QSF X;  1IF1 A;  5BNG A;  1FBS A;  4AUX A;  1ETX A;  2CQX A;  1FLI A;  3HRT A;  2DA1 A;  5K5R A;  2ZXJ A;  3P9K A;  2VE9 A;  1I1G A;  1PP7 U;  1JKQ C;  3R61 A;  1CGP A;  5L3B A;  1EH8 A;  3H9G A;  3OYH A;  1GLN A;  5DCF A;  3V4G A;  3ZMZ A;  3F3X A;  1H0M A;  1FP2 A;  2K3P A;  1H8A C;  2DMP A;  2FOW A;  1DP3 A;  3R60 A;  3FKI J;  2CS3 A;  3DP7 A;  4V19 K;  1V5G A;  3MN2 A;  4Q47 A;  4BQN A;  2DT7 B;  1VQ7 I;  1AA7 A;  2STW A;  2V1U A;  1ZGW A;  2ME0 A;  4ON0 A;  1IV6 A;  4RAF A;  2Q2E A;  4PGH A;  3L2W A;  1AOY A;  1NG7 A;  2QA4 I;  3S2H J;  2EIJ H;  2X4H A;  1SC7 A;  5J1U A;  3ZQI A;  3HB9 A;  5J6X A;  2IA1 A;  4UNO A;  2M9H A;  4DYC A;  2E2J J;  3CCE I;  1N75 A;  1TW3 A;  3HOW J;  1UMQ A;  3DTE A;  1A6I A;  4JBA A;  5FO5 A;  3G1O A;  4DIQ A;  4CYC A;  1LVA A;  1SFX A;  4NHJ A;  1JJ6 C;  3CJT B;  1X1C A;  1ETW A;  3DKX A;  2O8X A;  5H2F C;  4DBR A;  2P0W A;  2XF5 A;  3MQ0 A;  2YS9 A;  1ZHF A;  2YUS A;  3VOD A;  2MD0 A;  3HOT A;  2XC7 A;  4Q4Z F;  4RB1 A;  4U87 A;  5ILU A;  5DDG A;  3BR3 A;  3DFG A;  2JRT A;  3OOU A;  1X4P A;  1X3Z B;  1SEU A;  1O3Q A;  2GXB A;  1GHC A;  4KA4 A;  1KU7 A;  1SD7 A;  5K5Q A;  3PSI A;  4IF4 A;  2Z33 A;  1MSE C;  4BY1 J;  1LDD A;  1XCB A;  4KMU X;  5E8I A;  4Y13 A;  3CUO A;  2HVQ A;  1MBH A;  3U1K A;  4D9J A;  1T95 A;  1S3J A;  1FYK A;  1FP1 D;  2UZK A;  2VT3 A;  5IT9 K;  2MD5 A;  4WXH A;  2WBM A;  3BLY A;  2VC0 A;  5AIQ A;  3CDL A;  2GA2 A;  2PQ8 A;  3ZQC A;  2QQ8 A;  2EQR A;  3BZC A;  2K7L A;  2RRE A;  2YPR A;  1S29 A;  3LFK A;  2KIS A;  2OTJ I;  2WAF A;  2XGE A;  1ZAO A;  4QPQ A;  3KYL A;  4E7I A;  3HBL A;  3OIP A;  3F8B A;  1FMV A;  2JWT A;  1PVE A;  3K4K A;  1ZRC A;  1ZEL A;  3GZ6 A;  4U7B A;  2Y69 H;  1R1T A;  1T33 A;  2ZNY A;  3CC4 I;  1JUS A;  3S93 A;  1B72 A;  4CIC A;  3BP8 A;  1PP8 F;  2HU9 A;  4PFO A;  1YW8 A;  2L54 A;  5GAG J;  4C30 A;  4D0P A;  3IRR A;  2F6C A;  4U0W A;  5CVR A;  2QQA A;  2M8E A;  1J7K A;  1R1U A;  4MTD A;  1KU9 A;  3JCU C;  1P7I A;  1GUU A;  2Z2S B;  1ETV A;  3HXL A;  4BEH A;  2DTZ A;  1KYZ A;  3FMQ A;  1B6A A;  1TT5 B;  3S2W A;  2HDC A;  2ID6 A;  1P4X A;  2MYS A;  4A3L J;  3GTK J;  1JKO C;  2ZME B;  1OCZ H;  3PQK A;  3HTS B;  1VQ9 I;  2CV1 A;  2CQK A;  2COB A;  2K4J A;  3FXL A;  4M9S A;  4RM2 A;  4CO8 A;  2FRH A;  2VKV A;  1PJR A;  2DA4 A;  4DYQ A;  4YG2 F;  4JX5 A;  1FY7 A;  5HS8 A;  3FXU A;  2ZSI B;  3COA C;  4IKF A;  4LIV A;  3I58 A;  2E34 A;  4E70 A;  3G2B A;  3I0T A;  1TTY A;  5IT9 Z;  3W2V A;  1FTT A;  2IBD A;  2P8T A;  1OCR H;  3HOS A;  2HPM A;  3E1S A;  5D8L B;  2FBK A;  3IL2 A;  2ZXH A;  3GF2 A;  1BI2 A;  2X6W A;  4P96 A;  1IN8 A;  3B6C A;  5DD8 A;  2EK5 A;  5J40 A;  4A3I J;  3BG5 A;  3VSK A;  3LSG A;  2Z99 A;  3IUO A;  3M1C A;  3HSE A;  3WTT C;  5FRO A;  1CF7 A;  1FOW A;  1G3S A;  2QQ9 A;  3DEU A;  1UG2 A;  5HLH A;  3ZRG A;  1JGG A;  2E1M C;  1S6L A;  4RAY A;  1SFE A;  2PBI A;  2PMU A;  2WC2 A;  4HDV A;  3WTZ A;  3OYJ A;  2EA2 A;  4Z2Y A;  4XID A;  3S3M A;  1FBQ A;  1MIJ A;  1X2M A;  3GW2 A;  1ULY A;  4QTR A;  3CDI A;  1K7A A;  2QKM B;  1FSE A;  4HV5 A;  2DT5 A;  1BC8 C;  3RYP A;  3NAR A;  3PIO F;  4DBQ A;  1PYV A;  5JR3 A;  3FXJ A;  2MAB A;  4HQM A;  2LK2 A;  3BY6 A;  3JR9 A;  3A03 A;  2CWE A;  1FZP B;  2BVM A;  3CMA I;  1RIO H;  2DFE A;  2R7O A;  3EQL F;  3KZI C;  3V8K A;  2HOS A;  3A0B C;  5LHG A;  2GQQ A;  2PJR A;  1TNT A;  1WWX A;  3NEU A;  3LWF A;  2QLZ A;  4LMY A;  3FXK A;  3V7C A;  3BQZ A;  4GXO A;  4BGD A;  3OS1 A;  1HXD A;  2EJR A;  3IRQ A;  4X6A J;  3CLO A;  3MCZ A;  4G7Z F;  5H6R A;  1Y56 A;  3RI4 A;  5CKT A;  3KP3 A;  3BG7 A;  3I4M J;  3DLL F;  4ZDO A;  4ZJZ A;  2KJB A;  2P7C B;  1S9H A;  1VQL I;  3REO A;  3KLO A;  3L9F A;  4E7L A;  5J3L A;  2H8W A;  1SFK A;  4I76 A;  2GA1 A;  4BDY A;  5FJ8 J;  3WTX C;  1UZC A;  1ETK A;  2WA0 A;  5F6F A;  4U0Y A;  2NRA C;  2QVO A;  3SJM A;  1XGS A;  1F4K A;  3JTH A;  1R4M B;  3KET A;  2R4G A;  1W5S A;  1IRF A;  1IN6 A;  1MD0 A;  4MQV A;  4Y52 J;  1D8J A;  5D6E A;  1WJF A;  3LFU A;  3OL3 A;  1BR2 A;  3GTL J;  1U78 A;  1DQU A;  1FPQ A;  3WGH A;  1ZAR A;  4RMN A;  3SDG A;  4AIK A;  4UB8 C;  1MBE A;  1Y8Q B;  3HPH A;  3OWT A;  1WJ5 A;  2BHZ A;  3OSF A;  2ICW G;  4UXN A;  2MH9 A;  1A5J A;  4YII A;  3NQO A;  4L18 B;  5HOD A;  2V1D A;  2VE8 A;  3CCV I;  3S32 A;  4LK0 F;  1U6G A;  2JUC A;  3ESW B;  3OYI A;  1Z91 A;  4E7S A;  3GTJ J;  2HR3 A;  4KIC A;  4PJL A;  4L5E A;  5H20 A;  2BXZ A;  4BY7 J;  2OV7 A;  2CFX A;  3ISP A;  5LEJ A;  1MH3 A;  2IGO A;  1YW9 A;  2VKH A;  1ZGJ A;  2MBF A;  2D1V A;  3H36 A;  2R5Z B;  4LG0 A;  2NNN A;  1IGN A;  1HA8 A;  2JVG A;  1FWZ A;  1FSH A;  5E3M A;  5CPR B;  3HDD A;  2MA3 A;  1IW7 F;  3U21 A;  3DF8 A;  4R1H A;  1WRJ A;  3P9I A;  2NVQ J;  1FOK A;  2CQ7 A;  1WSU A;  2DA3 A;  4W1U A;  5LHH A;  5LHI A;  4HQE A;  3PIP F;  3H0G J;  3A1Y A;  2R5Z A;  2P5V A;  2HOE A;  4O3M A;  2W24 A;  5K7Z A;  3JRF A;  5GAE J;  1FOY A;  4E7Z A;  4JYK A;  5D8K B;  1Z05 A;  1H9T A;  3EDP A;  1VF9 A;  1S7E A;  1ETY A;  2JA5 J;  2MW8 A;  3GWZ A;  1ZKG A;  2CGP A;  3OR1 C;  2KPM A;  3O6B B;  2FE3 A;  3T1B A;  3U1D A;  5F1J A;  1QPM A;  2CSO A;  2IA2 A;  3J7A Y;  4LK1 F;  2QZ8 A;  1M1E B;  3FXQ A;  4CZC A;  4BE1 A;  1J0R A;  1T0F C;  2CUF A;  3DBH B;  2K5C A;  2CFO A;  2LOO A;  1R5I D;  2HI3 A;  4HW0 A;  4XSZ F;  2LD5 A;  2XIG A;  1MDM A;  1TW2 A;  1QNT A;  2JA2 A;  2XSD C;  3SQN A;  2P4W A;  5IT3 A;  4X0G A;  4C2T A;  2WV0 A;  3DPU A;  1F5T A;  4BBR J;  5CYV A;  4J19 A;  1QPI A;  5HNH A;  1J5Y A;  2RV8 A;  3KP5 A;  5FKO A;  1O57 A;  1Q1H A;  1OFC X;  2IEK A;  1IN4 A;  3QOD A;  4NC6 A;  1FYL A;  2PG4 A;  1USS A;  2R5Y A;  1L0O C;  2J5O A;  4EJV A;  2O03 A;  5HDN A;  2UUZ A;  1X1B A;  3FBI B;  3PM1 A;  3EPZ A;  1HOM A;  3VDX A;  4EJU A;  1K4S A;  3JRE A;  1VQ8 I;  4HX7 A;  4WXC A;  3D5L A;  1A35 A;  1J2X A;  5FD5 A;  4Y33 A;  4CSW A;  2LP0 A;  4RDU A;  3H35 A;  1ZLK A;  5IYD J;  2CMP A;  1MMN A;  3Q0W A;  3PJR A;  3A4C A;  5DS9 A;  2DW4 A;  4A3M J;  4KT5 C;  2RN7 A;  3LMM A;  2XF7 A;  4CZZ A;  4HNV A;  3E5U A;  5FLX K;  2M7B A;  5E20 A;  1WGX A;  3K2Z A;  5F0F A;  3OYE A;  2XVC A;  1BJA A;  1MBJ A;  3V7R A;  4W97 A;  1RUO A;  2BE5 F;  2HQ5 A;  1IRX A;  1ON2 A;  3TOB A;  3B6A A;  1ZYR F;  3VB2 A;  3RKY A;  4GO1 A;  2P5K A;  4AYB N;  2HYG D;  3E3V A;  3PUF A;  2JZY A;  3G3Z A;  3WHB A;  4HSR A;  4BNC A;  1YTY A;  2LLK A;  4H4K C;  1OJL A;  1FNN A;  1K6O A;  3BTL A;  5GAD J;  3KEO A;  1U8R A;  3K1M A;  3IH3 A;  3NRV A;  4AIJ A;  1VQO I;  3ROU A;  4IHS A;  4ZYH A;  3DU5 A;  3LOC A;  3M7G A;  4YIF A;  2FX0 A;  4B1R A;  1HW2 A;  1WPK A;  1K78 B;  2H6C A;  5FGM A;  3LNQ A;  5FRN A;  2VKE A;  3K4L A;  2YX4 A;  4OIO F;  2LY9 A;  1IUY A;  2VOD A;  3CJR B;  4UUT A;  4UUS A;  1BR1 A;  2M0C A;  3R0A A;  4RB2 C;  4M6Y A;  3JRG A;  1OMI A;  2DOD A;  4DW6 A;  1FEX A;  2BW3 B;  5TJJ A;  4XIC A;  3CUQ A;  3HSR A;  1QVT A;  1TQM A;  4ABZ A;  2DYS H;  1HKT A;  3T5X A;  3SZP A;  4II2 A;  5BQT A;  4OIQ F;  3CTA A;  3QOE A;  1A6Q A;  4L0Y B;  2VBX A;  3Q5F A;  1Z67 A;  1LB2 A;  2K9Q A;  2VON A;  3M1E A;  4KIS A;  5DUI A;  1OLT A;  2HQA A;  2XAU A;  5FLX Z;  1RRJ A;  1WZ2 A;  1AKH A;  3CME I;  1IN5 A;  2XRO A;  1ON1 A;  5D5X B;  4LD5 A;  1V4R A;  3LSM A;  2GIZ A;  4KIG A;  4LIU A;  2YR2 A;  2H27 A;  4MHG A;  3RTR A;  1WI9 A;  1MNE A;  3I3L A;  2Y2Z A;  1ZRF A;  1R6R A;  5L3F A;  3VFZ A;  1U0J A;  1EV7 A;  4EV0 A;  1I5Z A;  4BH9 A;  5EG0 A;  3DPL C;  2VOP A;  1F9N A;  2IT0 A;  4M9X A;  2OU2 A;  2IA0 A;  4B8X A;  5JHF A;  2CV2 A;  1VI0 A;  2JN6 A;  3CUQ C;  1WHU A;  4BQO A;  2HTS A;  2LKS A;  2E1N A;  1MND A;  1B8I B;  3IV5 A;  4IX7 A;  4QWQ A;  3L2V A;  3RZD J;  2HOT A;  1MJ9 A;  4PK4 A;  4AYB A;  3OV8 A;  1UAA A;  3ABM H;  3BJ6 A;  1KYW A;  2FUG 2;  4P1W A;  4XRM A;  4LB5 A;  2O0Y A;  4G94 A;  2ZKZ A;  4QLC U;  2JVH A;  1MH4 A;  3LQQ A;  3GO5 A;  3I59 A;  2NYX A;  5E1W A;  2HQR A;  4J00 A;  2FF4 A;  3GLL A;  1T38 A;  4RLF A;  3L2R A;  4BE0 A;  2XPV A;  1MJA A;  2DOA A;  3WGG A;  3CF5 F;  3OYD A;  3PNV A;  2NVX J;  1ERD A;  4XQF A;  4HX8 A;  4KN7 X;  1VQP I;  3I56 I;  2JQ7 A;  3KP7 A;  4BXU A;  1KU2 A;  2KIQ A;  2DOF A;  1KQ8 A;  2GLO A;  2LTP A;  3MZY A;  3T8T A;  4NQW B;  3K70 C;  2HOA A;  2LVS A;  3HZJ A;  4FIS A;  2X6Y A;  2CUE A;  2LFB A;  4U0V A;  2M5W A;  5M5X J;  3F8F A;  5D6F A;  1RR7 A;  3D5R C;  1P7J A;  4IHW A;  4LOC A;  1Z9C A;  4MLO A;  3IKT A;  4ZYG A;  1REP C;  2ZSH B;  1MW7 A;  2M87 A;  5CLS A;  1R7J A;  4U7D A;  2EFP A;  3S15 J;  4OAZ A;  3QPH A;  3CO6 C;  3ZXS A;  4RAZ A;  1QZZ A;  1OYI A;  1LE8 A;  1UFM A;  5HDG A;  3TW7 A;  3OSG A;  4I02 A;  2VJI A;  1ZG3 A;  4JQF A;  2DQR A;  3F8M A;  1PDN C;  2RKH A;  3BTC A;  1R00 A;  1ODD A;  4ESB A;  1XSV A;  3H9J A;  4B3A A;  4ENN A;  3F72 A;  4S0H B;  2V7F A;  4PZJ A;  3W2A A;  3BDD A;  3DV8 A;  2GM4 A;  4IQJ A;  5CJ9 A;  4U88 A;  1XSX A;  3ASN H;  4CXF A;  3FF5 A;  3FIS A;  2R7T A;  1IN7 A;  2EIN H;  3HGY A;  4ASN A;  5TGT A;  1BBY A;  1FX7 A;  3J7A O;  1NK2 P;  3SDB A;  2BY0 A;  4YFN F;  3H3Z A;  1D3Y A;  2VJJ A;  4KJZ A;  1LDK B;  4WX9 A;  1IXS B;  5FD6 A;  2KDZ A;  3RJP A;  3MKW B;  1ZLJ A;  1SD6 A;  3PQJ A;  3A02 A;  3LSP A;  2RNG A;  2QBY A;  4B09 A;  2X1C A;  1O7F A;  1Y1W J;  2KLO A;  2ZCW A;  2DMU A;  2Q2E B;  2NS0 A;  1BIA A;  4RA2 A;  3EYI A;  2I8D A;  2CUJ A;  2B9S A;  1BI3 A;  3KEY A;  2P7V B;  3ZMD A;  3AAF A;  3TO6 A;  4ZYE A;  2FBH A;  4LGW A;  2EH3 A;  5JVG F;  1J9I A;  4BXX J;  2M8G X;  1LPQ A;  9ANT A;  4DZP A;  3K6G A;  4QPO A;  1ONV A;  3TQN A;  2IJL A;  3RZO J;  5HLT A;  2HNH A;  4CYC B;  1AHD P;  1BN5 A;  4XL9 A;  4YRV A;  3TED A;  4HG2 A;  2HXI A;  2ZXW H;  1XD7 A;  3E6C C;  5D4R A;  2IGK A;  3R4K A;  4DGW B;  1ZRE A;  1YE9 A;  2IVM A;  4XKV A;  3PFI A;  4AU7 A;  4BHC A;  3JW4 A;  2L3D A;  2Z16 A;  5EEG A;  3ZQG A;  4ETS A;  1E3H A;  2LBF A;  1WH7 A;  3SHF A;  5F27 A;  3TW6 A;  3ECO A;  3K2A A;  1K6Y A;  4E6K G;  3FDY A;  3GTM J;  1HSJ A;  1BW6 A;  1E3P A;  3GTO J;  2D45 A;  2XB0 X;  1R22 A;  1UHS A;  2MFZ A;  2K02 A;  2ZXI A;  2HPI A;  3S1M J;  1D8K A;  2DJI A;  3HRM A;  3OY9 A;  1YJN I;  4YEL A;  2JK3 A;  5D5W B;  4C9Y A;  2QKL B;  1A31 A;  5HS7 A;  4PGG A;  3W2W A;  1RUN A;  2HVS A;  2AXL A;  4XOP A;  3WTU C;  2OQG A;  1UB9 A;  1JKR C;  2R93 J;  4RGX A;  5L3G A;  1V54 H;  3BTI A;  5E17 F;  4NDL A;  4ZTF A;  3DKY A;  1HBX G;  1UHM A;  2KDO A;  3CCR I;  3OYC A;  1XB4 A;  1YRN A;  3TKY A;  2NS7 A;  2MLK A;  2Y48 A;  1TQP A;  1LFU P;  4KFC A;  3N05 A;  2OPT A;  3K1P A;  1WCM J;  1RKT A;  3Q0U A;  3PUB A;  1N78 A;  2UXX A;  5FFZ A;  1FJL A;  2LKP A;  3G6E I;  2GXG A;  1LQ1 A;  2HDD A;  2A05 A;  1B72 B;  5J4Y A;  4XON A;  1FT9 A;  2HGC A;  2EFW A;  1HDP A;  1W7P D;  1T2K A;  2RAE A;  2M30 A;  3EUA A;  1YYV A;  3TO7 A;  4IRG A;  3NWT A;  3QAH A;  2VXZ A;  2O6G E;  1RES A;  1RPW A;  1LFP A;  4L5I A;  4A2U A;  3ZGK A;  1LDJ A;  4CCK A;  5JI6 A;  2W48 A;  2GBY A;  2CV0 A;  4CDG A;  4F52 A;  1GDT A;  2E1M B;  4BEH B;  3PNY A;  1XMA A;  3I55 I;  3BR5 A;  2LR8 A;  1ETQ A;  1OYW A;  4ESF A;  5F1R A;  1BOB A;  1ZG1 A;  1KQ0 A;  2XPU A;  1K4T A;  1XMK A;  4LLG F;  4WK8 F;  4OU0 A;  3F22 A;  2E7W A;  4OWR B;  5KK1 A;  3HSF A;  2VQC A;  3L2U A;  2XAJ A;  2H09 A;  1MMA A;  4FX4 A;  5IOZ A;  3BG6 A;  2KT0 A;  5JLW A;  1NTC A;  3DWL E;  2EFO A;  5EYR A;  1W36 D;  3OYA A;  5HLI A;  3G1M A;  4HYE A;  3CCY A;  2ADU A;  1V5E A;  2ISZ A;  4I99 C;  4BJ6 C;  3RQI A;  2XB5 A;  3TO9 A;  1IDY A;  3QPL A;  4D7M A;  2XAS A;  3K69 A;  4YFK F;  3U9G A;  4ENK A;  4BHP A;  2ZJP F;  4G7O F;  5E18 F;  1EF4 A;  2HKO A;  1JHF A;  2WAQ N;  4JK1 X;  3WGI A;  2E60 A;  2KRC A;  1IRZ A;  1MMG A;  4IOA F;  1W0U A;  4A12 A;  4DNC A;  1HW5 A;  1XGO A;  3QYE A;  4OAY A;  4XK4 A;  4MFD A;  1CF7 B;  1DU6 A;  4P55 A;  4ESJ A;  1ENH A;  4KYW A;  2OBP A;  1SVO A;  5J1R A;  2QWW A;  3ECH A;  4JX6 A;  1GVJ A;  4BUP A;  2VPL A;  2OAZ A;  1E0E A;  2EZK A;  5AON A;  2O9L A;  4CHU A;  3M8J A;  5DCM A;  5ICE A;  2FD5 A;  3F8N A;  2VB6 A;  3A01 A;  4MFE A;  2OCC H;  3MEX A;  3K10 A;  2O5R A;  3VOE A;  4XRS A;  3BG9 A;  4HDU A;  4BQA A;  4O5V A;  5FKM A;  5B3S H;  4BDZ A;  2PJR B;  3CJN A;  2OZ6 A;  4L9T A;  2IS4 A;  1G59 A;  3HUG A;  2A68 F;  3ABU A;  4V2G A;  4JX4 A;  4C3I J;  1DGW Y;  3BT9 A;  4YIR X;  5DTD A;  1S5L C;  5JHU A;  3VYU B;  4RBO A;  2V79 A;  4UVB A;  4C2M J;  5GPC A;  4C3J J;  2PMZ N;  2MC3 A;  1JT0 A;  4IXA A;  4B43 A;  4BS9 A;  1OPC A;  1TZL A;  3PL8 A;  4CA0 A;  1PUF A;  4A0X A;  2HS5 A;  5FRM A;  3HRS A;  4HRI A;  2G7U A;  3JRI A;  1TL8 A;  4A3B J;  2O8K A;  4N4N B;  5K7F A;  3BRO A;  3G71 I;  5D5V B;  5FKL A;  2R3S A;  3BC8 A;  2M4G A;  1TQI A;  4O6J A;  4E7J A;  3EYY A;  1AWC A;  4CCN A;  2NNY A;  3TL4 X;  4M6X A;  1O3R A;  4TV7 A;  2WAD A;  2R7X A;  4F92 B;  3R0J A;  2EZI A;  1UEL B;  1K79 A;  1BIB A;  1BJZ A;  4Y15 A;  2ZJR F;  2B63 J;  2WAQ A;  4XKC A;  3ZMV A;  1W7P A;  1QO0 D;  4BJT A;  2LNB A;  3SZT A;  2DA5 A;  1O3S A;  4XKB A;  2JPB A;  4GGG A;  4L9J A;  1WQ2 A;  3DTI A;  1P9Q C;  2DJN A;  2IP2 A;  1YOV B;  4DZJ A;  2B0L A;  3CCJ I;  5DM7 F;  3J7Y J;  4KIB A;  3I4P A;  1D0Y A;  3DEW A;  2DFI A;  1GT0 C;  1JI8 A;  3E5X A;  4LG0 B;  4L9V A;  5J8C A;  5E1X A;  4L0Z B;  3JRA A;  4FCY A;  5HDK A;  4Y7N J;  2HZT A;  1U5T A;  3G4S I;  1WVR A;  4A0Z A;  3MZ8 A;  3OL4 A;  2C6Y A;  2DXI A;  4XRS G;  5TIS C;  3DBL B;  3BPX A;  2ELK A;  2JRM A;  5IP7 J;  1KGS A;  2ZJ2 A;  3HG9 A;  2K9M A;  2ZC2 A;  1OCO H;  3HHH A;  3H3V K;  1E17 A;  2R7R A;  3KP6 A;  4A3C J;  1G3Y A;  4HLY A;  2E1O A;  3M4O J;  1T98 A;  4WCG A;  1ZH5 A;  1KA8 A;  2EA4 A;  1B9N A;  4A3J J;  3VYS B;  1VQN I;  2DN0 A;  1ORK A;  2GIV A;  5LEK A;  2PMZ A;  1OYY A;  2CG4 A;  1YS6 A;  3H3U A;  2R7F A;  4B47 A;  1VZ0 A;  2IGN A;  5GPA A;  4LLL A;  4I6Z A;  2KKO A;  2WY7 Q;  1YLF A;  4IRH A;  1B9M A;  2X6O A;  1R23 A;  3Q9S A;  2FOK A;  2OCE A;  4JOM A;  3LA2 A;  1MDM B;  5F0H A;  4XLN F;  3AG1 H;  2P6T A;  4DYR A;  1N77 A;  3KX2 A;  4A6E A;  2JMW A;  2V1X A;  4HF1 A;  2D5V A;  3Q0V A;  2MLG A;  2HQN A;  2DOE A;  3C2H A;  2DK8 A;  2EB7 A;  3ABT A;  5KNL A;  3I4N J;  3LSH A;  2P5L C;  2QEX I;  2CJJ A;  4CCO A;  5E1Z B;  2KMU A;  2LMD A;  3AFH A;  1MBF A;  2R5Y B;  2GXA A;  5C4X J;  2W25 A;  5BS6 A;  3TBI A;  2EIM H;  4IEJ A;  1JTX A;  1F1Z A;  2LRD A;  3H9Q A;  4PUS A;  3O8G A;  5LRR A;  4EM2 A;  3BWG A;  1YI2 I;  1OCC H;  1VND A;  3QU6 A;  1TWC J;  2A6E F;  3LA7 A;  2DU9 A;  2JA8 J;  3PSF A;  2PX9 A;  4Q48 A;  5FFX A;  1IXC A;  4NBQ A;  5LGT A;  3GX4 X;  3ML6 A;  4EGZ A;  3TGN A;  5M5W J;  1D0Z A;  2DPU A;  1SVM A;  5M3M J;  1S7O A;  4BU2 A;  5LGN A;  3DU6 A;  2HWV A;  2V26 A;  2R7Q A;  3EUK L;  2ZO4 A;  3RKX A;  4AC0 A;  1IZ1 A;  2BXY A;  1O3T A;  1MBK A;  2EV6 A;  1TLH B;  2CQQ A;  1V55 H;  3LSK A;  2CW0 F;  1TBX A;  3QQA A;  1X2N A;  2IW5 A;  4RLQ A;  1MNM C;  2JTV A;  5HOO A;  2I5U A;  3BJO A;  3AL0 C;  2CYY A;  4IHV A;  2RVC A;  1YW7 A;  3RPQ A;  1STZ A;  1XTA A;  4ZZD A;  3E6B A;  1I1S A;  3MVP A;  3RYR A;  1H89 C;  2R0Q C;  3C2B A;  2KFD A;  5IYC J;  2E5N A;  2ZNZ A;  1ZGA A;  2L4M A;  4KN4 X;  2COM A;  1QA6 A;  3GBG A;  4IVN A;  3IAM 2;  3BR2 A;  1BM9 A;  2X1D A;  4UVC A;  2OF7 A;  2F2E A;  3EUH A;  2LF7 A;  1RKW A;  4E7H A;  5FKN A;  2HDW A;  3HJE A;  3KPH A;  1E2X A;  4UB6 C;  1G4D A;  4UUS B;  1Y6I A;  5GP9 A;  1P2F A;  2PN6 A;  3FKJ A;  2A3S A;  3HEF A;  2BY1 A;  3HIF A;  2YSR A;  2VJ5 A;  4M71 A;  2LRE A;  3CUQ B;  4BE2 A;  1FYM A;  2L5Q A;  3M8F A;  5KVR A;  2LSO A;  3F9K A;  4MNU A;  5F08 A;  5ERI A;  2VKD A;  3ZPL A;  1GV5 A;  5C4J J;  2HYF A;  3RKW A;  2KIM A;  3HC7 A;  5J1Y A;  4FTH A;  4XRF A;  5E3L A;  4GCV A;  1O7L A;  1XN7 A;  4BHB A;  2XGD A;  1LNW A;  3KLN A;  5BPD A;  2L02 A;  2M45 A;  3LQR A;  4XOT A;  3PO3 J;  1HC8 A;  4FAS D;  3KP4 A;  4MIM A;  3LAJ A;  3ZR8 X;  3ZCO A;  3CJQ B;  3K4C A;  4OMY A;  4KIT B;  2O7O A;  3RPU D;  1DU0 A;  2J5P A;  1AKH B;  2CQN A;  4UV8 A;  4ITV A;  2LY1 A;  4XLC A;  2EPF A;  3IWZ A;  4FT8 A;  4I0B A;  2QGU A;  1WKM A;  3MMY B;  2BVL A;  1RZ4 A;  2EV5 A;  2JSP A;  4AID A;  1EH6 A;  4C3H J;  2A6T A;  1O4X A;  1R36 A; 
#chains in the Genus database with same CATH homology
 2CV1 A;  4RM3 A;  3AL0 B;  2I8D A;  2CUJ A;  2LG4 A;  3EUH C;  4RM2 A;  4BL0 B;  3KEY A;  1PJR A;  1QHG A;  2VJ4 A;  2IXS A;  4HPQ A;  1KON A;  2ZSI B;  4IKF A;  4LIV A;  1D1B A;  4ZDL A;  3G2B A;  3W2V A;  3TMO A;  5LFA A;  1Z21 A;  3K6G A;  4QPO A;  3K4J A;  3HOS A;  1X19 A;  2HPM A;  5HLT A;  3E1S A;  2HNH A;  2ZXH A;  4XL9 A;  4YRV A;  2X6W A;  4HG2 A;  4NC8 A;  3VWB A;  4DOZ A;  2IGK A;  3VSK A;  4BXF A;  3K4M A;  3LSG A;  3M1C A;  3IUO A;  4DGW B;  1YE9 A;  4XKV A;  4AU7 A;  4CCM A;  1W36 C;  2R7W A;  3K70 D;  5FRO A;  1Z3Y A;  2Z16 A;  2HVR A;  2LBF A;  2CW8 A;  2VQG A;  3ZRG A;  2E1M C;  4E6K G;  1K6Y A;  3FDY A;  3OYJ A;  2V4J C;  2VQL A;  2MFZ A;  1MMD A;  2ZXI A;  2HPI A;  3MKZ A;  2AQF A;  3S3M A;  2ZFU A;  2DJI A;  4ZYA A;  3OY9 A;  1TT0 A;  2QKM B;  3H5A A;  4YEL A;  2CUZ A;  4C9Y A;  4DBQ A;  4J01 A;  1PYV A;  2QKL B;  2MAB A;  4HST A;  2L9S A;  4XMY A;  3W2W A;  2HVS A;  3W3C A;  2R7V A;  2KP6 A;  4P5O A;  4XOP A;  5LD2 C;  3OYM A;  2BVM A;  2VXD A;  2Y0S A;  2IS2 A;  2R7O A;  4PSW A;  2PJR A;  4ZTF A;  3DKY A;  5KCM A;  4PSX A;  2KDO A;  3OYC A;  2WAE A;  4BGD A;  1J09 A;  3OS1 A;  3PNT A;  2VL8 A;  2W4S A;  1Y56 A;  3FHN A;  3LSI A;  2KQR A;  5CKT A;  2LH9 A;  3BG7 A;  3N05 A;  4ZDO A;  2F4I A;  3PUB A;  1N78 A;  4ZJZ A;  1YX5 A;  1S9H A;  1EA3 A;  4XON A;  2VAS A;  2LYC A;  2XF6 A;  3CES A;  4E7L A;  3EUA A;  5CQE A;  1SFK A;  3NWT A;  4GRI A;  2MC4 A;  2VXZ A;  4BDY A;  4PJM A;  2WA0 A;  4BJ5 C;  3V42 A;  2KRH A;  4ZC3 A;  3OYK A;  4NUB A;  2CH0 A;  1LFP A;  3S3N A;  3CF2 A;  3ZGK A;  4CCK A;  2R4G A;  2NOJ B;  3HL2 A;  3VYR B;  4CCL A;  2K9L A;  4IZZ A;  2CV0 A;  4F52 A;  2E1M B;  3DLA A;  1WJF A;  3LFU A;  4BEH B;  3D5S C;  3OL3 A;  3PNY A;  1BR2 A;  5KHD A;  1DQU A;  4RMN A;  2AQE A;  3HPH A;  1X1D A;  3RCO A;  1BOB A;  3OWT A;  3IAS 2;  1WJ5 A;  3MKY B;  3BCB A;  3H5N A;  2VIX A;  4E4H A;  3CMM A;  4OWR B;  2VQC A;  3L2U A;  2KZV A;  3S32 A;  1MMA A;  3OYI A;  3BG6 A;  4E7S A;  3DWL E;  2R7S A;  5HNF A;  1W36 D;  3OYA A;  4PJL A;  1V5E A;  4BJ6 C;  1SAU A;  2OV7 A;  4B3X A;  1WJD A;  2IGO A;  2VKH A;  3OS2 A;  2X1E A;  3DQV C;  4ANJ A;  3SYT A;  4LG3 A;  2E60 A;  2KRC A;  1HA8 A;  2JVG A;  1MMG A;  5CPR B;  2Z1D A;  2XSJ C;  3MD2 A;  4XLH A;  1D0X A;  3U21 A;  1G8X A;  3QYE A;  4OAY A;  4XLA A;  4XNF A;  4AVZ A;  4EAT A;  5HVQ C;  3SZG A;  2LBF B;  1X1A A;  2UWM A;  2BW3 A;  3A1Y A;  2M4K A;  4DJA A;  3AKZ A;  3OR2 C;  2OUM A;  3HKZ A;  4BQQ A;  2UV1 A;  1FMW A;  2CW7 A;  4E7Z A;  4BUP A;  2VPL A;  3I9V 2;  3UNG C;  2VLA A;  3OYB A;  2WY8 Q;  1E0E A;  4ZDP A;  3M8J A;  2WB1 A;  2DT6 A;  3C2G A;  2VB6 A;  3OR1 C;  2KPM A;  4F91 B;  1NG6 A;  3CZ6 A;  3K10 A;  2O5R A;  2R7U A;  3QYF A;  3J7A Y;  1X4O A;  4CZC A;  4BE1 A;  1T0F C;  2IS6 A;  3ZQQ A;  2K5C A;  2KL4 A;  2CFO A;  2LOO A;  4BDZ A;  2PJR B;  2IS4 A;  4LIT A;  1G59 A;  4F3Q A;  4R79 A;  2JA2 A;  4X0G A;  3SEQ A;  1DGW Y;  4C2T A;  3DPU A;  4G6T B;  3VYU B;  5HNH A;  3K4N A;  4PFP A;  3QOD A;  4Y4R A;  3OYG A;  3LL7 A;  4B43 A;  4BS9 A;  4F55 A;  1TZL A;  3PL8 A;  4CA0 A;  1UG0 A;  2UUZ A;  1X1B A;  3FBI B;  3EPZ A;  3VDX A;  2V6E A;  3D5L A;  4Y33 A;  4CSW A;  2L7K A;  3H35 A;  5FRM A;  4HRI A;  2CMP A;  1MMN A;  2GOM A;  4IQ4 A;  3CP2 A;  3RSN A;  3PJR A;  2X51 A;  3A4C A;  4N4N B;  4Y3O A;  4XLE A;  4C2U A;  3LMM A;  3SEZ A;  2BOL A;  2XF7 A;  3BC8 A;  4PJJ A;  2M7B A;  4XM3 A;  2M4G A;  4E7J A;  3DEE A;  4CCN A;  2GOX B;  3TL4 X;  3OYE A;  2WAD A;  3S3O A;  2R7X A;  2V1N A;  4F92 B;  2F5V A;  1LKX A;  1UEL B;  1IRX A;  4F93 B;  2WAQ A;  4XKC A;  4BJT A;  4XN3 A;  4HNU A;  4BAC A;  3OMY A;  4XKB A;  1WJB A;  4HSR A;  3DTI A;  1P9Q C;  4H4K C;  4CCJ A;  3DPT A;  4B48 A;  4N4O B;  2IS1 A;  1D0Y A;  1JI8 A;  3DU5 A;  3VYT B;  2KHM A;  2A5W A;  5FRN A;  3K4L A;  3A2K A;  2M7A A;  5CQG A;  3CJR B;  4ZTJ A;  4NNJ A;  4XN0 A;  2M3A A;  1BR1 A;  2Q1Z B;  1WFX A;  2W82 A;  3OL4 A;  4HEA 2;  2V9K A;  4YEJ A;  3S8P A;  2DXI A;  1WJE A;  2BW3 B;  1V5F A;  3OS0 A;  3HG9 A;  2K9M A;  1WJA A;  2R7R A;  1DGR M;  1QHH D;  4CH7 A;  3NWS A;  4KT6 A;  3ONQ A;  4II2 A;  4CUG A;  3OYN A;  3QOE A;  3VYS B;  3DTK A;  4NC7 A;  4XOR A;  4KIS A;  1OLT A;  2DCE A;  2PMZ A;  4D1Q A;  2HQA A;  2XAU A;  2X85 A;  4B47 A;  3H9G A;  1VZ0 A;  2IGN A;  3OYH A;  1GLN A;  2WY7 Q;  2RQQ A;  2X6X A;  2LC2 A;  2K3P A;  3LSM A;  3OIQ A;  4LIU A;  1DP3 A;  2CS3 A;  4JOM A;  1V5G A;  2XDV A;  3BCA A;  4BQN A;  2DT7 B;  3HUG B;  1AA7 A;  3RTR A;  1N77 A;  3H5R A;  3KX2 A;  1MNE A;  3I3L A;  1R6R A;  3L2W A;  3C2H A;  2A6T A;  1NG7 A;  2ELJ A;  1U0J A;  5KNL A;  3LSH A;  4CCO A;  3DPL C;  2KMU A;  3AFH A;  3TBI A;  5JHF A;  1D1C A;  2LRD A;  3H9Q A;  2CV2 A;  4PUS A;  1N75 A;  4BQO A;  3DTE A;  1MND A;  3VSL A;  3CP8 A;  4DIQ A;  4IX7 A;  3L2V A;  4II3 A;  1D1A A;  1X1C A;  1WJC A;  3PSF A;  4PK4 A;  4AYB A;  1UAA A;  3DKX A;  2FUG 2;  4P1W A;  4DBR A;  2P0W A;  2XF5 A;  4FET A;  1OR7 C;  2MD0 A;  1D0Z A;  2JVH A;  3HOT A;  2XC7 A;  4BU2 A;  3DU6 A;  4J00 A;  4U87 A;  2V26 A;  2R7Q A;  4RLF A;  3L2R A;  1LVK A;  2HZD A;  3EUK L;  4XLF A;  3OOU A;  3OYL A;  4BE0 A;  1X4P A;  4XKW A;  2DOA A;  3LSK A;  3L2Q A;  1Z3X A;  3OYD A;  3PSI A;  3PNV A;  1ERD A;  4XQF A;  3RQ4 A;  4RLQ A;  3HPG A;  5HOO A;  3AL0 C;  4E7K A;  4NQW B;  2HVQ A;  3K70 C;  4D9J A;  1T95 A;  2X6Y A;  4HNT A;  2WBM A;  3BLY A;  3D5R C;  2OC6 A;  2E5N A;  3K4B A;  4MLO A;  4B44 A;  3GBG A;  3IAM 2;  1MW7 A;  2RRE A;  2X1D A;  2ZSH B;  2M0M A;  2L2O A;  4E7H A;  2HDW A;  2WAF A;  1Y6I A;  4QPQ A;  3KYL A;  4OAZ A;  4E7I A;  3FKJ A;  3OIP A;  1FMV A;  3ZXS A;  3IP4 B;  1YX3 A;  2VJ5 A;  1BR4 A;  2LRE A;  2IGM A;  3K4K A;  4BE2 A;  1ZEL A;  2L5Q A;  3FBN B;  4U7B A;  2VJI A;  3F9K A;  4JQF A;  2JUG A;  3S93 A;  2VQH A;  2VKD A;  2HU9 A;  4PFO A;  3H9J A;  2W00 A;  4C30 A;  3HC7 A;  2V7F A;  3W2A A;  2W1O A;  4IQJ A;  3H0D A;  2F6C A;  2W7N A;  3E0J B;  3UR3 C;  4XOT A;  3OYF A;  1Z7L A;  2E5Z A;  4FAS D;  3ZR8 X;  3ZCO A;  2R7T A;  3PFY A;  1QU3 A;  2LY2 A;  3CJQ B;  2Z2S B;  3K4C A;  4XR6 A;  5TGT A;  3RPU D;  4KIT B;  3HXL A;  4XLC A;  3SDB A;  4ITV A;  2LY1 A;  4BEH A;  4PJN A;  2VJJ A;  4KJZ A;  3QYB A;  1LDK B;  3MMY B;  2L9N A;  2MYS A;  3MKW B;  2BVL A;  2RNG A;  2JSP A;  2X1C A;  2KLO A;  2Q2E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...