2KPTA

Solution nmr structure of the n-terminal domain of cg2496 protein from corynebacterium glutamicum. northeast structural genomics consortium target cgr26a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
148
Chain Sequence
TETYVLAESPEFYQDNVTDYTGQISSSDITNIQAAIDDVKASEQKVIFVVFLSSFDGVDPETWTQQALQANGGGNVLIYALAPEERQYGIQGGTQWTDAELDAANNAAFQALSQEDWAGSALALAESVGSSSSSSSGSSSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the N-terminal domain of cg2496 protein from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum
molecule tags Structural genomics, unknown function
molecule keywords Putative secreted protein
total genus 47
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2009-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2kptA00
3PTJA 2KW7A 2MPBA 2KPTA 2LT2A 3PVHA 5ANPA 4OA3A 3PW9A
chains in the Genus database with same CATH superfamily
1YM5A 3G98A 2PW0A 1W61A 2YMAA 3EJXA 2ZXOA 2IW4A 2ZXPA 3EDNA 4Q2HA 1IR6A 5IWEA 1QY9A 2GKEA 4J9XA 1K20A 2ZVFA 1U0KA 4LS9A 1SDJA 2AZPA 4Q60A 2HAWA 1TM0A 5M47A 1W62A 2H9FA 4LG3A 2KPTA 4LB0A 4J9WA 1U1XA 1U1VA 3EKMA 2ENXA 4OA3A 1BWZA 3WQZA 1WPMA 4RPAA 1K23A 2QB7A 1XUAA 2Q9JA 5ANPA 1XUBA 3W5WA 1I74A 2EB0A 2QB8A 3G7KA 4GL6A 3PW9A 4DUNA 4PY9A 1QYAA 5H2YA 2PVZA 2GKJA 4JUUA 2QB6A 4JBDA 2KW7A 3FVEA 1WPPA 3DEVA 2OTNA 4K7GB 1U1WA 2Q9HA 1S7JA 4K7XA 2LT2A 2ZXRA 3ICJA 4JD7A 1T6KA 3PTJA 4IK0A 4K8LA 4JCIA 2MPBA 4IJZA 5H2GA 3PVHA 3IGHX 5HA4A 1GQZA
chains in the Genus database with same CATH topology
1YM5A 3G98A 2PW0A 1W61A 2YMAA 3EJXA 2ZXOA 2IW4A 2ZXPA 3EDNA 4Q2HA 1IR6A 5IWEA 1QY9A 2GKEA 4J9XA 1K20A 2ZVFA 1U0KA 4LS9A 1SDJA 2AZPA 4Q60A 2HAWA 1TM0A 5M47A 1W62A 2H9FA 4LG3A 2KPTA 4LB0A 4J9WA 1U1XA 1U1VA 3EKMA 2ENXA 4OA3A 1BWZA 3WQZA 1WPMA 4RPAA 1K23A 2QB7A 1XUAA 2Q9JA 5ANPA 1XUBA 3W5WA 1I74A 2EB0A 2QB8A 3G7KA 4GL6A 3PW9A 4DUNA 4PY9A 1QYAA 5H2YA 2PVZA 2GKJA 4JUUA 2QB6A 4JBDA 2KW7A 3FVEA 1WPPA 3DEVA 2OTNA 4K7GB 1U1WA 2Q9HA 1S7JA 4K7XA 2LT2A 2ZXRA 3ICJA 4JD7A 1T6KA 3PTJA 4IK0A 4K8LA 4JCIA 2MPBA 4IJZA 5H2GA 3PVHA 3IGHX 5HA4A 1GQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PTJ A;  2KW7 A;  2MPB A;  2KPT A;  2LT2 A;  3PVH A;  5ANP A;  4OA3 A;  3PW9 A; 
#chains in the Genus database with same CATH topology
 1YM5 A;  3G98 A;  2PW0 A;  1W61 A;  2YMA A;  3EJX A;  2ZXO A;  2IW4 A;  2ZXP A;  3EDN A;  4Q2H A;  1IR6 A;  5IWE A;  1QY9 A;  2GKE A;  4J9X A;  1K20 A;  2ZVF A;  1U0K A;  4LS9 A;  1SDJ A;  2AZP A;  4Q60 A;  2HAW A;  1TM0 A;  5M47 A;  1W62 A;  2H9F A;  4LG3 A;  2KPT A;  4LB0 A;  4J9W A;  1U1X A;  1U1V A;  3EKM A;  2ENX A;  4OA3 A;  1BWZ A;  3WQZ A;  1WPM A;  4RPA A;  1K23 A;  2QB7 A;  1XUA A;  2Q9J A;  5ANP A;  1XUB A;  3W5W A;  1I74 A;  2EB0 A;  2QB8 A;  3G7K A;  4GL6 A;  3PW9 A;  4DUN A;  4PY9 A;  1QYA A;  5H2Y A;  2PVZ A;  2GKJ A;  4JUU A;  2QB6 A;  4JBD A;  2KW7 A;  3FVE A;  1WPP A;  3DEV A;  2OTN A;  4K7G B;  1U1W A;  2Q9H A;  1S7J A;  4K7X A;  2LT2 A;  2ZXR A;  3ICJ A;  4JD7 A;  1T6K A;  3PTJ A;  4IK0 A;  4K8L A;  4JCI A;  2MPB A;  4IJZ A;  5H2G A;  3PVH A;  3IGH X;  5HA4 A;  1GQZ A; 
#chains in the Genus database with same CATH homology
 1YM5 A;  3G98 A;  2PW0 A;  1W61 A;  2YMA A;  3EJX A;  2ZXO A;  2IW4 A;  2ZXP A;  3EDN A;  4Q2H A;  1IR6 A;  5IWE A;  1QY9 A;  2GKE A;  4J9X A;  1K20 A;  2ZVF A;  1U0K A;  4LS9 A;  1SDJ A;  2AZP A;  4Q60 A;  2HAW A;  1TM0 A;  5M47 A;  1W62 A;  2H9F A;  4LG3 A;  2KPT A;  4LB0 A;  4J9W A;  1U1X A;  1U1V A;  3EKM A;  2ENX A;  4OA3 A;  1BWZ A;  3WQZ A;  1WPM A;  4RPA A;  1K23 A;  2QB7 A;  1XUA A;  2Q9J A;  5ANP A;  1XUB A;  3W5W A;  1I74 A;  2EB0 A;  2QB8 A;  3G7K A;  4GL6 A;  3PW9 A;  4DUN A;  4PY9 A;  1QYA A;  5H2Y A;  2PVZ A;  2GKJ A;  4JUU A;  2QB6 A;  4JBD A;  2KW7 A;  3FVE A;  1WPP A;  3DEV A;  2OTN A;  4K7G B;  1U1W A;  2Q9H A;  1S7J A;  4K7X A;  2LT2 A;  2ZXR A;  3ICJ A;  4JD7 A;  1T6K A;  3PTJ A;  4IK0 A;  4K8L A;  4JCI A;  2MPB A;  4IJZ A;  5H2G A;  3PVH A;  3IGH X;  5HA4 A;  1GQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...