2KPTA

Solution nmr structure of the n-terminal domain of cg2496 protein from corynebacterium glutamicum. northeast structural genomics consortium target cgr26a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
148
Chain Sequence
TETYVLAESPEFYQDNVTDYTGQISSSDITNIQAAIDDVKASEQKVIFVVFLSSFDGVDPETWTQQALQANGGGNVLIYALAPEERQYGIQGGTQWTDAELDAANNAAFQALSQEDWAGSALALAESVGSSSSSSSGSSSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative secreted protein
publication title Solution NMR structure of the N-terminal domain of cg2496 protein from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum
molecule tags Structural genomics, unknown function
total genus 47
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2009-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2kptA00
2KPTA 3PW9A 5ANPA 2MPBA 3PVHA 2LT2A 2KW7A 4OA3A 3PTJA
chains in the Genus database with same CATH superfamily
5HA4A 1YM5A 2QB6A 4J9WA 1WPMA 4DUNA 4JBDA 4IJZA 3EKMA 2PW0A 4K8LA 1XUAA 2QB8A 2ZXOA 3FVEA 1BWZA 2EB0A 1WPPA 2IW4A 1I74A 4LS9A 4K7GB 3EJXA 4K7XA 2QB7A 3IGHX 1K23A 2ZXPA 4Q60A 2ZXRA 2GKJA 2OTNA 2YMAA 4JCIA 4Q2HA 4RPAA 3PTJA 3EDNA 3ICJA 1QYAA 2Q9HA 4J9XA 2KPTA 1T6KA 3DEVA 2ZVFA 1K20A 1XUBA 4PY9A 5H2GA 1U0KA 1IR6A 3G7KA 1W61A 4OA3A 4IK0A 2AZPA 2Q9JA 5M47A 2MPBA 1W62A 1S7JA 4JUUA 2PVZA 3PW9A 5H2YA 2LT2A 2KW7A 3G98A 5IWEA 1GQZA 2GKEA 1U1WA 3W5WA 4LB0A 1TM0A 4LG3A 1U1XA 1SDJA 2H9FA 3WQZA 5ANPA 1QY9A 2ENXA 1U1VA 4JD7A 4GL6A 3PVHA 2HAWA
chains in the Genus database with same CATH topology
5HA4A 1YM5A 2QB6A 4J9WA 1WPMA 4DUNA 4JBDA 4IJZA 3EKMA 2PW0A 4K8LA 1XUAA 2QB8A 2ZXOA 3FVEA 1BWZA 2EB0A 1WPPA 2IW4A 1I74A 4LS9A 4K7GB 3EJXA 4K7XA 2QB7A 3IGHX 1K23A 2ZXPA 4Q60A 2ZXRA 2GKJA 2OTNA 2YMAA 4JCIA 4Q2HA 4RPAA 3PTJA 3EDNA 3ICJA 1QYAA 2Q9HA 4J9XA 2KPTA 1T6KA 3DEVA 2ZVFA 1K20A 1XUBA 4PY9A 5H2GA 1U0KA 1IR6A 3G7KA 1W61A 4OA3A 4IK0A 2AZPA 2Q9JA 5M47A 2MPBA 1W62A 1S7JA 4JUUA 2PVZA 3PW9A 5H2YA 2LT2A 2KW7A 3G98A 5IWEA 1GQZA 2GKEA 1U1WA 3W5WA 4LB0A 1TM0A 4LG3A 1U1XA 1SDJA 2H9FA 3WQZA 5ANPA 1QY9A 2ENXA 1U1VA 4JD7A 4GL6A 3PVHA 2HAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPT A;  3PW9 A;  5ANP A;  2MPB A;  3PVH A;  2LT2 A;  2KW7 A;  4OA3 A;  3PTJ A; 
#chains in the Genus database with same CATH topology
 5HA4 A;  1YM5 A;  2QB6 A;  4J9W A;  1WPM A;  4DUN A;  4JBD A;  4IJZ A;  3EKM A;  2PW0 A;  4K8L A;  1XUA A;  2QB8 A;  2ZXO A;  3FVE A;  1BWZ A;  2EB0 A;  1WPP A;  2IW4 A;  1I74 A;  4LS9 A;  4K7G B;  3EJX A;  4K7X A;  2QB7 A;  3IGH X;  1K23 A;  2ZXP A;  4Q60 A;  2ZXR A;  2GKJ A;  2OTN A;  2YMA A;  4JCI A;  4Q2H A;  4RPA A;  3PTJ A;  3EDN A;  3ICJ A;  1QYA A;  2Q9H A;  4J9X A;  2KPT A;  1T6K A;  3DEV A;  2ZVF A;  1K20 A;  1XUB A;  4PY9 A;  5H2G A;  1U0K A;  1IR6 A;  3G7K A;  1W61 A;  4OA3 A;  4IK0 A;  2AZP A;  2Q9J A;  5M47 A;  2MPB A;  1W62 A;  1S7J A;  4JUU A;  2PVZ A;  3PW9 A;  5H2Y A;  2LT2 A;  2KW7 A;  3G98 A;  5IWE A;  1GQZ A;  2GKE A;  1U1W A;  3W5W A;  4LB0 A;  1TM0 A;  4LG3 A;  1U1X A;  1SDJ A;  2H9F A;  3WQZ A;  5ANP A;  1QY9 A;  2ENX A;  1U1V A;  4JD7 A;  4GL6 A;  3PVH A;  2HAW A; 
#chains in the Genus database with same CATH homology
 5HA4 A;  1YM5 A;  2QB6 A;  4J9W A;  1WPM A;  4DUN A;  4JBD A;  4IJZ A;  3EKM A;  2PW0 A;  4K8L A;  1XUA A;  2QB8 A;  2ZXO A;  3FVE A;  1BWZ A;  2EB0 A;  1WPP A;  2IW4 A;  1I74 A;  4LS9 A;  4K7G B;  3EJX A;  4K7X A;  2QB7 A;  3IGH X;  1K23 A;  2ZXP A;  4Q60 A;  2ZXR A;  2GKJ A;  2OTN A;  2YMA A;  4JCI A;  4Q2H A;  4RPA A;  3PTJ A;  3EDN A;  3ICJ A;  1QYA A;  2Q9H A;  4J9X A;  2KPT A;  1T6K A;  3DEV A;  2ZVF A;  1K20 A;  1XUB A;  4PY9 A;  5H2G A;  1U0K A;  1IR6 A;  3G7K A;  1W61 A;  4OA3 A;  4IK0 A;  2AZP A;  2Q9J A;  5M47 A;  2MPB A;  1W62 A;  1S7J A;  4JUU A;  2PVZ A;  3PW9 A;  5H2Y A;  2LT2 A;  2KW7 A;  3G98 A;  5IWE A;  1GQZ A;  2GKE A;  1U1W A;  3W5W A;  4LB0 A;  1TM0 A;  4LG3 A;  1U1X A;  1SDJ A;  2H9F A;  3WQZ A;  5ANP A;  1QY9 A;  2ENX A;  1U1V A;  4JD7 A;  4GL6 A;  3PVH A;  2HAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...