2KPTA

Solution nmr structure of the n-terminal domain of cg2496 protein from corynebacterium glutamicum. northeast structural genomics consortium target cgr26a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
148
Chain Sequence
TETYVLAESPEFYQDNVTDYTGQISSSDITNIQAAIDDVKASEQKVIFVVFLSSFDGVDPETWTQQALQANGGGNVLIYALAPEERQYGIQGGTQWTDAELDAANNAAFQALSQEDWAGSALALAESVGSSSSSSSGSSSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the N-terminal domain of cg2496 protein from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum
molecule tags Structural genomics, unknown function
molecule keywords Putative secreted protein
total genus 47
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2009-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2kptA00
2KW7A 2KPTA 4OA3A 3PVHA 3PTJA 3PW9A 2MPBA 2LT2A 5ANPA
chains in the Genus database with same CATH superfamily
1QY9A 2GKJA 5H2GA 3G98A 3EDNA 5IWEA 4LS9A 2IW4A 4K7XA 5HA4A 4PY9A 2Q9JA 4Q60A 1K23A 3IGHX 1U1WA 1BWZA 1U1VA 2PVZA 4JBDA 2QB6A 4OA3A 3EKMA 2EB0A 1QYAA 2PW0A 2Q9HA 3G7KA 3PW9A 3FVEA 2ZXOA 1K20A 1XUBA 5ANPA 1GQZA 1XUAA 4K7GB 4RPAA 2ZXPA 2MPBA 1I74A 3DEVA 5H2YA 4JCIA 4J9XA 3EJXA 2QB7A 3ICJA 1W61A 2KW7A 1U0KA 1T6KA 4Q2HA 4GL6A 4K8LA 1YM5A 2ENXA 2QB8A 4JD7A 1W62A 2AZPA 4DUNA 2GKEA 2LT2A 1SDJA 3W5WA 1WPPA 1TM0A 2OTNA 2H9FA 2ZXRA 3WQZA 2KPTA 1WPMA 2YMAA 2ZVFA 1S7JA 2HAWA 4LG3A 4J9WA 1U1XA 4LB0A 5M47A 3PTJA 3PVHA 4JUUA 4IK0A 1IR6A 4IJZA
chains in the Genus database with same CATH topology
1QY9A 2GKJA 5H2GA 3G98A 3EDNA 5IWEA 4LS9A 2IW4A 4K7XA 5HA4A 4PY9A 2Q9JA 4Q60A 1K23A 3IGHX 1U1WA 1BWZA 1U1VA 2PVZA 4JBDA 2QB6A 4OA3A 3EKMA 2EB0A 1QYAA 2PW0A 2Q9HA 3G7KA 3PW9A 3FVEA 2ZXOA 1K20A 1XUBA 5ANPA 1GQZA 1XUAA 4K7GB 4RPAA 2ZXPA 2MPBA 1I74A 3DEVA 5H2YA 4JCIA 4J9XA 3EJXA 2QB7A 3ICJA 1W61A 2KW7A 1U0KA 1T6KA 4Q2HA 4GL6A 4K8LA 1YM5A 2ENXA 2QB8A 4JD7A 1W62A 2AZPA 4DUNA 2GKEA 2LT2A 1SDJA 3W5WA 1WPPA 1TM0A 2OTNA 2H9FA 2ZXRA 3WQZA 2KPTA 1WPMA 2YMAA 2ZVFA 1S7JA 2HAWA 4LG3A 4J9WA 1U1XA 4LB0A 5M47A 3PTJA 3PVHA 4JUUA 4IK0A 1IR6A 4IJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW7 A;  2KPT A;  4OA3 A;  3PVH A;  3PTJ A;  3PW9 A;  2MPB A;  2LT2 A;  5ANP A; 
#chains in the Genus database with same CATH topology
 1QY9 A;  2GKJ A;  5H2G A;  3G98 A;  3EDN A;  5IWE A;  4LS9 A;  2IW4 A;  4K7X A;  5HA4 A;  4PY9 A;  2Q9J A;  4Q60 A;  1K23 A;  3IGH X;  1U1W A;  1BWZ A;  1U1V A;  2PVZ A;  4JBD A;  2QB6 A;  4OA3 A;  3EKM A;  2EB0 A;  1QYA A;  2PW0 A;  2Q9H A;  3G7K A;  3PW9 A;  3FVE A;  2ZXO A;  1K20 A;  1XUB A;  5ANP A;  1GQZ A;  1XUA A;  4K7G B;  4RPA A;  2ZXP A;  2MPB A;  1I74 A;  3DEV A;  5H2Y A;  4JCI A;  4J9X A;  3EJX A;  2QB7 A;  3ICJ A;  1W61 A;  2KW7 A;  1U0K A;  1T6K A;  4Q2H A;  4GL6 A;  4K8L A;  1YM5 A;  2ENX A;  2QB8 A;  4JD7 A;  1W62 A;  2AZP A;  4DUN A;  2GKE A;  2LT2 A;  1SDJ A;  3W5W A;  1WPP A;  1TM0 A;  2OTN A;  2H9F A;  2ZXR A;  3WQZ A;  2KPT A;  1WPM A;  2YMA A;  2ZVF A;  1S7J A;  2HAW A;  4LG3 A;  4J9W A;  1U1X A;  4LB0 A;  5M47 A;  3PTJ A;  3PVH A;  4JUU A;  4IK0 A;  1IR6 A;  4IJZ A; 
#chains in the Genus database with same CATH homology
 1QY9 A;  2GKJ A;  5H2G A;  3G98 A;  3EDN A;  5IWE A;  4LS9 A;  2IW4 A;  4K7X A;  5HA4 A;  4PY9 A;  2Q9J A;  4Q60 A;  1K23 A;  3IGH X;  1U1W A;  1BWZ A;  1U1V A;  2PVZ A;  4JBD A;  2QB6 A;  4OA3 A;  3EKM A;  2EB0 A;  1QYA A;  2PW0 A;  2Q9H A;  3G7K A;  3PW9 A;  3FVE A;  2ZXO A;  1K20 A;  1XUB A;  5ANP A;  1GQZ A;  1XUA A;  4K7G B;  4RPA A;  2ZXP A;  2MPB A;  1I74 A;  3DEV A;  5H2Y A;  4JCI A;  4J9X A;  3EJX A;  2QB7 A;  3ICJ A;  1W61 A;  2KW7 A;  1U0K A;  1T6K A;  4Q2H A;  4GL6 A;  4K8L A;  1YM5 A;  2ENX A;  2QB8 A;  4JD7 A;  1W62 A;  2AZP A;  4DUN A;  2GKE A;  2LT2 A;  1SDJ A;  3W5W A;  1WPP A;  1TM0 A;  2OTN A;  2H9F A;  2ZXR A;  3WQZ A;  2KPT A;  1WPM A;  2YMA A;  2ZVF A;  1S7J A;  2HAW A;  4LG3 A;  4J9W A;  1U1X A;  4LB0 A;  5M47 A;  3PTJ A;  3PVH A;  4JUU A;  4IK0 A;  1IR6 A;  4IJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...