2KPTA

Solution nmr structure of the n-terminal domain of cg2496 protein from corynebacterium glutamicum. northeast structural genomics consortium target cgr26a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
148
Chain Sequence
b'TETYVLAESPEFYQDNVTDYTGQISSSDITNIQAAIDDVKASEQKVIFVVFLSSFDGVDPETWTQQALQANGGGNVLIYALAPEERQYGIQGGTQWTDAELDAANNAAFQALSQEDWAGSALALAESVGSSSSSSSGSSSLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative secreted protein
molecule tags Structural genomics, unknown function
source organism Corynebacterium glutamicum
publication title Solution NMR structure of the N-terminal domain of cg2496 protein from Corynebacterium glutamicum
rcsb
total genus 47
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2009-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2kptA00
2LT2A 2KPTA 3PTJA 2MPBA 5ANPA 3PVHA 3PW9A 2KW7A 4OA3A
chains in the Genus database with same CATH superfamily
4IJZA 4RPAA 1IR6A 3ICJA 4LB0A 1WPPA 1U1VA 3EJXA 3W5WA 2ZXPA 4J9XA 1U1XA 2PW0A 4K7GB 3IGHX 2EB0A 4GL6A 3G98A 2OTNA 4JD7A 5ANPA 2HAWA 1W61A 3PW9A 3G7KA 1K23A 2YMAA 4Q60A 2GKEA 1U0KA 2ZXRA 3EDNA 2GKJA 2QB8A 4JBDA 2KPTA 1WPMA 2MPBA 5HA4A 2AZPA 4K8LA 2Q9JA 2LT2A 3EKMA 3DEVA 4IK0A 1QYAA 4PY9A 1XUAA 5H2YA 2KW7A 1BWZA 3WQZA 1S7JA 4JCIA 5H2GA 2IW4A 2ZXOA 4K7XA 4DUNA 1K20A 2ZVFA 3PVHA 4J9WA 2QB6A 1T6KA 2PVZA 1W62A 5IWEA 4LG3A 2H9FA 4OA3A 1XUBA 4LS9A 3PTJA 3FVEA 1SDJA 4Q2HA 2Q9HA 5M47A 2QB7A 1QY9A 1TM0A 2ENXA 1I74A 1GQZA 1YM5A 4JUUA 1U1WA
chains in the Genus database with same CATH topology
4IJZA 4RPAA 1IR6A 3ICJA 4LB0A 1WPPA 1U1VA 3EJXA 3W5WA 2ZXPA 4J9XA 1U1XA 2PW0A 4K7GB 3IGHX 2EB0A 4GL6A 3G98A 2OTNA 4JD7A 5ANPA 2HAWA 1W61A 3PW9A 3G7KA 1K23A 2YMAA 4Q60A 2GKEA 1U0KA 2ZXRA 3EDNA 2GKJA 2QB8A 4JBDA 2KPTA 1WPMA 2MPBA 5HA4A 2AZPA 4K8LA 2Q9JA 2LT2A 3EKMA 3DEVA 4IK0A 1QYAA 4PY9A 1XUAA 5H2YA 2KW7A 1BWZA 3WQZA 1S7JA 4JCIA 5H2GA 2IW4A 2ZXOA 4K7XA 4DUNA 1K20A 2ZVFA 3PVHA 4J9WA 2QB6A 1T6KA 2PVZA 1W62A 5IWEA 4LG3A 2H9FA 4OA3A 1XUBA 4LS9A 3PTJA 3FVEA 1SDJA 4Q2HA 2Q9HA 5M47A 2QB7A 1QY9A 1TM0A 2ENXA 1I74A 1GQZA 1YM5A 4JUUA 1U1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT2 A;  2KPT A;  3PTJ A;  2MPB A;  5ANP A;  3PVH A;  3PW9 A;  2KW7 A;  4OA3 A; 
#chains in the Genus database with same CATH topology
 4IJZ A;  4RPA A;  1IR6 A;  3ICJ A;  4LB0 A;  1WPP A;  1U1V A;  3EJX A;  3W5W A;  2ZXP A;  4J9X A;  1U1X A;  2PW0 A;  4K7G B;  3IGH X;  2EB0 A;  4GL6 A;  3G98 A;  2OTN A;  4JD7 A;  5ANP A;  2HAW A;  1W61 A;  3PW9 A;  3G7K A;  1K23 A;  2YMA A;  4Q60 A;  2GKE A;  1U0K A;  2ZXR A;  3EDN A;  2GKJ A;  2QB8 A;  4JBD A;  2KPT A;  1WPM A;  2MPB A;  5HA4 A;  2AZP A;  4K8L A;  2Q9J A;  2LT2 A;  3EKM A;  3DEV A;  4IK0 A;  1QYA A;  4PY9 A;  1XUA A;  5H2Y A;  2KW7 A;  1BWZ A;  3WQZ A;  1S7J A;  4JCI A;  5H2G A;  2IW4 A;  2ZXO A;  4K7X A;  4DUN A;  1K20 A;  2ZVF A;  3PVH A;  4J9W A;  2QB6 A;  1T6K A;  2PVZ A;  1W62 A;  5IWE A;  4LG3 A;  2H9F A;  4OA3 A;  1XUB A;  4LS9 A;  3PTJ A;  3FVE A;  1SDJ A;  4Q2H A;  2Q9H A;  5M47 A;  2QB7 A;  1QY9 A;  1TM0 A;  2ENX A;  1I74 A;  1GQZ A;  1YM5 A;  4JUU A;  1U1W A; 
#chains in the Genus database with same CATH homology
 4IJZ A;  4RPA A;  1IR6 A;  3ICJ A;  4LB0 A;  1WPP A;  1U1V A;  3EJX A;  3W5W A;  2ZXP A;  4J9X A;  1U1X A;  2PW0 A;  4K7G B;  3IGH X;  2EB0 A;  4GL6 A;  3G98 A;  2OTN A;  4JD7 A;  5ANP A;  2HAW A;  1W61 A;  3PW9 A;  3G7K A;  1K23 A;  2YMA A;  4Q60 A;  2GKE A;  1U0K A;  2ZXR A;  3EDN A;  2GKJ A;  2QB8 A;  4JBD A;  2KPT A;  1WPM A;  2MPB A;  5HA4 A;  2AZP A;  4K8L A;  2Q9J A;  2LT2 A;  3EKM A;  3DEV A;  4IK0 A;  1QYA A;  4PY9 A;  1XUA A;  5H2Y A;  2KW7 A;  1BWZ A;  3WQZ A;  1S7J A;  4JCI A;  5H2G A;  2IW4 A;  2ZXO A;  4K7X A;  4DUN A;  1K20 A;  2ZVF A;  3PVH A;  4J9W A;  2QB6 A;  1T6K A;  2PVZ A;  1W62 A;  5IWE A;  4LG3 A;  2H9F A;  4OA3 A;  1XUB A;  4LS9 A;  3PTJ A;  3FVE A;  1SDJ A;  4Q2H A;  2Q9H A;  5M47 A;  2QB7 A;  1QY9 A;  1TM0 A;  2ENX A;  1I74 A;  1GQZ A;  1YM5 A;  4JUU A;  1U1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...