2KPUA

Nmr structure of ybbr family protein dhaf_0833 (residues 32-118) from desulfitobacterium hafniense dcb-2: northeast structural genomics consortium target dhr29b
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
b'SSQTLDRDPTLTLSLIAKNTPANSMIMTKLPSVRVKTEGYNPSINVNELFAYVDLSGSEPGEHDYEVKVEPIPNIKIVEISPRVVTLQLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YbbR family protein
publication title Structures of domains I and IV from YbbR are representative of a widely distributed protein family.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 2kpuA00
2KQ1A 3LYWA 2L3UA 5HQHA 2KPUA 2L5NA
chains in the Genus database with same CATH superfamily
3S15C 5C44C 3LYWA 3PO3C 2CW0A 5IYCC 4A3BC 3S16C 5DM7S 1TWFC 3HKZD 3PIPS 4BY1C 4BY7C 2O5JA 2O5IA 4LJZA 3GTOC 5IP9C 5JVHS 4A3EC 1I6HC 2PA8D 4A3IC 2B63C 1TWGC 4A93C 1Y1VC 4OIQA 2R92C 4WFNS 2JA5C 2VUMC 2A69A 4Y7NC 4A3GC 4A3DC 5FLMC 4LLGA 4XSXA 3GTPC 4U67S 1I6VA 3HOWC 2R93C 2L5NA 3PO2C 2A6EA 2BE5A 2WAQD 4MEYA 1BDFA 2PMZD 5JVGS 1K83C 4X6AC 1YNJA 2Y0SD 4YFNA 1HQMA 1TWCC 3GTMC 4BBRC 1FEUA 2ZJPS 1I3QC 3HOUC 4JK1A 4Y52C 3HOVC 3S1MC 3S2DC 4G7OA 3GTJC 3DLLS 1SMYA 2NVTC 2NVQC 4LK0A 3I4MC 4MQ9A 3S17C 3RZDC 5D4DA 3HOZC 5DM6S 5C3EC 2JA6C 3HOYC 3M3YC 4ZH4A 4A3JC 4G7ZA 2JA8C 4A3MC 1TWHC 1IW7A 3M4OC 4Q4ZA 4A3FC 4C3IC 4XLPA 5TMFA 3S14C 1WCMC 4A3CC 2JA7C 3S1NC 5IP7C 2L3UA 3K7AC 4OIPA 2NVXC 4XLNA 2YU9C 3WODA 1R9TC 3GTKC 4KMUA 4C3JC 4QIWD 3RZOC 3EQLA 4QJVA 3GTQC 3S1QC 4C3HC 3S2HC 4WFBS 2ZJRS 4GZYA 4AYBD 4XSZA 4IOCS 1Y1WC 1SFOC 2A6HA 4YG2A 4IO9S 3CQZC 4WFAS 2E2JC 3PIOS 4MEXA 2KPUA 3GTLC 4A3LC 4Q5SA 2E2IC 2WB1D 3I4NC 2KQ1A 4NOIA 4C2MC 4BXXC 4WF9S 1ZYRA 4OIRA 4IOAS 4OINA 4BBSC 5C4XC 2NVYC 4KN4A 2PPBA 1YNNA 5TMCA 2ZJQS 4G7HA 5IYBC 3FKIC 4YFXA 4WCES 3DXJA 5HQHA 1TWAC 2R7ZC 3H3VD 4YFKA 3CF5S 2KXYA 3GTGC 5HL7S 5C4JC 2E2HC 1I50C 2A68A 4LK1A 3H0GC 3S1RC 4OIOA 5IYDC 3HOXC 4A3KC 4KN7A
chains in the Genus database with same CATH topology
2KQ1A 2KXYA 3LYWA 2L3UA 5HQHA 2KPUA 2L5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ1 A;  3LYW A;  2L3U A;  5HQH A;  2KPU A;  2L5N A; 
#chains in the Genus database with same CATH topology
 3S15 C;  5C44 C;  3LYW A;  3PO3 C;  2CW0 A;  5IYC C;  4A3B C;  3S16 C;  5DM7 S;  1TWF C;  3HKZ D;  3PIP S;  4BY1 C;  4BY7 C;  2O5J A;  2O5I A;  4LJZ A;  3GTO C;  5IP9 C;  5JVH S;  4A3E C;  1I6H C;  2PA8 D;  4A3I C;  2B63 C;  1TWG C;  4A93 C;  1Y1V C;  4OIQ A;  2R92 C;  4WFN S;  2JA5 C;  2VUM C;  2A69 A;  4Y7N C;  4A3G C;  4A3D C;  5FLM C;  4LLG A;  4XSX A;  3GTP C;  4U67 S;  1I6V A;  3HOW C;  2R93 C;  2L5N A;  3PO2 C;  2A6E A;  2BE5 A;  2WAQ D;  4MEY A;  1BDF A;  2PMZ D;  5JVG S;  1K83 C;  4X6A C;  1YNJ A;  2Y0S D;  4YFN A;  1HQM A;  1TWC C;  3GTM C;  4BBR C;  1FEU A;  2ZJP S;  1I3Q C;  3HOU C;  4JK1 A;  4Y52 C;  3HOV C;  3S1M C;  3S2D C;  4G7O A;  3GTJ C;  3DLL S;  1SMY A;  2NVT C;  2NVQ C;  4LK0 A;  3I4M C;  4MQ9 A;  3S17 C;  3RZD C;  5D4D A;  3HOZ C;  5DM6 S;  5C3E C;  2JA6 C;  3HOY C;  3M3Y C;  4ZH4 A;  4A3J C;  4G7Z A;  2JA8 C;  4A3M C;  1TWH C;  1IW7 A;  3M4O C;  4Q4Z A;  4A3F C;  4C3I C;  4XLP A;  5TMF A;  3S14 C;  1WCM C;  4A3C C;  2JA7 C;  3S1N C;  5IP7 C;  2L3U A;  3K7A C;  4OIP A;  2NVX C;  4XLN A;  2YU9 C;  3WOD A;  1R9T C;  3GTK C;  4KMU A;  4C3J C;  4QIW D;  3RZO C;  3EQL A;  4QJV A;  3GTQ C;  3S1Q C;  4C3H C;  3S2H C;  4WFB S;  2ZJR S;  4GZY A;  4AYB D;  4XSZ A;  4IOC S;  1Y1W C;  1SFO C;  2A6H A;  4YG2 A;  4IO9 S;  3CQZ C;  4WFA S;  2E2J C;  3PIO S;  4MEX A;  2KPU A;  3GTL C;  4A3L C;  4Q5S A;  2E2I C;  2WB1 D;  3I4N C;  2KQ1 A;  4NOI A;  4C2M C;  4BXX C;  4WF9 S;  1ZYR A;  4OIR A;  4IOA S;  4OIN A;  4BBS C;  5C4X C;  2NVY C;  4KN4 A;  2PPB A;  1YNN A;  5TMC A;  2ZJQ S;  4G7H A;  5IYB C;  3FKI C;  4YFX A;  4WCE S;  3DXJ A;  5HQH A;  1TWA C;  2R7Z C;  3H3V D;  4YFK A;  3CF5 S;  2KXY A;  3GTG C;  5HL7 S;  5C4J C;  2E2H C;  1I50 C;  2A68 A;  4LK1 A;  3H0G C;  3S1R C;  4OIO A;  5IYD C;  3HOX C;  4A3K C;  4KN7 A; 
#chains in the Genus database with same CATH homology
 2KQ1 A;  2KXY A;  3LYW A;  2L3U A;  5HQH A;  2KPU A;  2L5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...