The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
12
|
sequence length |
96
|
structure length |
96
|
Chain Sequence |
b'SSQTLDRDPTLTLSLIAKNTPANSMIMTKLPSVRVKTEGYNPSINVNELFAYVDLSGSEPGEHDYEVKVEPIPNIKIVEISPRVVTLQLEHHHHHH'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structures of domains I and IV from YbbR are representative of a widely distributed protein family.
pubmed doi rcsb |
| molecule keywords |
YbbR family protein
|
| source organism |
Desulfitobacterium hafniense
|
| molecule tags |
Structural genomics, unknown function
|
| total genus |
12
|
| structure length |
96
|
| sequence length |
96
|
| ec nomenclature | |
| pdb deposition date | 2009-10-20 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Complex | RNA Polymerase Alpha Subunit; Chain A, domain 2 | RNA Polymerase Alpha Subunit; Chain A, domain 2 |
#chains in the Genus database with same CATH superfamily 2KQ1 A; 2L5N A; 2KPU A; 2L3U A; 3LYW A; 5HQH A; #chains in the Genus database with same CATH topology 3HOX C; 5TMC A; 4JK1 A; 1I50 C; 4A3L C; 5FLM C; 2NVY C; 4G7Z A; 3CQZ C; 3RZD C; 4LJZ A; 2NVT C; 3S1N C; 1I6H C; 4OIR A; 5IYD C; 3GTM C; 4A3M C; 4OIQ A; 2BE5 A; 5C4X C; 3GTK C; 3HKZ D; 2WAQ D; 3H0G C; 4IO9 S; 2CW0 A; 4YFX A; 3S1R C; 4YG2 A; 2NVX C; 1SFO C; 3GTL C; 4MEX A; 4A3B C; 3K7A C; 4C3J C; 4IOC S; 3PO2 C; 2ZJQ S; 3M3Y C; 5IP7 C; 3S16 C; 1SMY A; 4A3E C; 4MEY A; 4OIP A; 4MQ9 A; 2E2I C; 1K83 C; 5C4J C; 4WCE S; 2R93 C; 4ZH4 A; 4XSX A; 5TMF A; 3S1M C; 2PMZ D; 4KMU A; 5D4D A; 3HOW C; 4XLP A; 3HOY C; 4QJV A; 3PO3 C; 3FKI C; 2ZJP S; 4BY1 C; 4A3G C; 4A3J C; 1TWF C; 1YNJ A; 4KN4 A; 2E2J C; 5DM7 S; 1R9T C; 2KQ1 A; 4AYB D; 4Y52 C; 4Y7N C; 2R92 C; 4YFK A; 4A3D C; 3EQL A; 3PIP S; 2R7Z C; 1I6V A; 5IYC C; 3RZO C; 1ZYR A; 1TWH C; 3S2D C; 1TWG C; 1HQM A; 5JVG S; 4G7H A; 2JA5 C; 4WFA S; 4GZY A; 5HQH A; 4WFB S; 2NVQ C; 3I4M C; 4G7O A; 3GTO C; 4YFN A; 3DXJ A; 3GTG C; 4XSZ A; 2L5N A; 4C3H C; 4U67 S; 2KXY A; 2A69 A; 4OIN A; 4KN7 A; 4WFN S; 1TWA C; 5JVH S; 3PIO S; 2PPB A; 3S1Q C; 4BBR C; 4X6A C; 5IYB C; 3LYW A; 4Q4Z A; 3I4N C; 4A3C C; 3S14 C; 2A68 A; 1WCM C; 4BY7 C; 2KPU A; 3GTQ C; 3HOV C; 3M4O C; 2B63 C; 4BXX C; 1IW7 A; 4IOA S; 4QIW D; 2JA8 C; 4OIO A; 2A6H A; 2YU9 C; 3GTP C; 3S2H C; 1YNN A; 2E2H C; 2JA6 C; 4A3I C; 5C3E C; 1I3Q C; 4LK0 A; 2L3U A; 3CF5 S; 4A3F C; 4A3K C; 2VUM C; 3GTJ C; 1TWC C; 3WOD A; 1BDF A; 5C44 C; 2O5I A; 4LLG A; 4Q5S A; 2O5J A; 2ZJR S; 3HOZ C; 2PA8 D; 3H3V D; 3S15 C; 2A6E A; 4WF9 S; 4BBS C; 1Y1V C; 5IP9 C; 4NOI A; 2WB1 D; 2Y0S D; 3DLL S; 4A93 C; 5DM6 S; 1FEU A; 3HOU C; 4C3I C; 4LK1 A; 5HL7 S; 2JA7 C; 4XLN A; 1Y1W C; 3S17 C; 4C2M C; #chains in the Genus database with same CATH homology 2KQ1 A; 2L5N A; 2KPU A; 2L3U A; 2KXY A; 3LYW A; 5HQH A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
