2KPUA

Nmr structure of ybbr family protein dhaf_0833 (residues 32-118) from desulfitobacterium hafniense dcb-2: northeast structural genomics consortium target dhr29b
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
SSQTLDRDPTLTLSLIAKNTPANSMIMTKLPSVRVKTEGYNPSINVNELFAYVDLSGSEPGEHDYEVKVEPIPNIKIVEISPRVVTLQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YbbR family protein
publication title Structures of domains I and IV from YbbR are representative of a widely distributed protein family.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 2kpuA00
2L5NA 2KQ1A 2L3UA 2KPUA 5HQHA 3LYWA
chains in the Genus database with same CATH superfamily
2NVTC 2E2IC 3HOZC 1TWCC 3GTMC 3LYWA 4QJVA 5D4DA 2PPBA 4AYBD 2KPUA 1K83C 2O5IA 4MEXA 4A3LC 4OIOA 1BDFA 4Y7NC 2BE5A 4XLPA 4OIPA 1I6HC 3RZDC 3FKIC 4C2MC 2A6HA 4XLNA 3M4OC 4BY7C 2L3UA 2PA8D 3S1RC 5C3EC 3S17C 4Y52C 4XSXA 4MQ9A 4C3HC 3HOVC 3S1MC 2JA5C 4BXXC 4WFAS 3H0GC 3PIOS 3RZOC 5IYDC 2ZJPS 3S1QC 4ZH4A 1YNNA 4KMUA 1HQMA 5JVHS 3I4MC 2A68A 4XSZA 5DM7S 3CQZC 3GTOC 5HQHA 4KN4A 5IYBC 4IOCS 3S2HC 2PMZD 3S1NC 4MEYA 4NOIA 4A3IC 4BBSC 4WFBS 4YFKA 4C3JC 3HOXC 4OINA 1Y1VC 3HOWC 1TWAC 4G7HA 4G7ZA 4KN7A 3PO3C 4GZYA 3DLLS 4YG2A 4WF9S 2ZJRS 2R7ZC 3S2DC 2YU9C 3HOUC 5FLMC 1WCMC 4IO9S 5TMCA 2A6EA 4LK0A 3GTQC 2JA6C 2ZJQS 4U67S 1I3QC 1TWGC 4Q4ZA 2KXYA 4C3IC 1SFOC 3PIPS 4BY1C 1Y1WC 2WB1D 1ZYRA 5C4XC 4LK1A 3GTPC 3GTJC 5C4JC 2E2JC 3H3VD 2O5JA 4YFNA 3I4NC 4A93C 5IP9C 1YNJA 1SMYA 4A3EC 1R9TC 3DXJA 4JK1A 4A3JC 4X6AC 2JA8C 2JA7C 4A3GC 4LJZA 4A3CC 1IW7A 2VUMC 5IP7C 2Y0SD 2WAQD 4WCES 4A3KC 4A3MC 2NVXC 2B63C 2L5NA 2KQ1A 3CF5S 2R93C 1FEUA 5TMFA 5JVGS 3GTLC 4A3DC 2A69A 2NVQC 5C44C 2NVYC 3HOYC 5DM6S 4YFXA 2E2HC 1TWFC 3GTGC 3M3YC 5IYCC 1TWHC 4BBRC 3GTKC 4IOAS 4OIRA 2R92C 4QIWD 4A3BC 3S16C 4Q5SA 4A3FC 1I50C 2CW0A 3HKZD 1I6VA 3S15C 4WFNS 3PO2C 4LLGA 4G7OA 3K7AC 3EQLA 3S14C 5HL7S 4OIQA 3WODA
chains in the Genus database with same CATH topology
2L5NA 2KQ1A 2L3UA 2KXYA 2KPUA 5HQHA 3LYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L5N A;  2KQ1 A;  2L3U A;  2KPU A;  5HQH A;  3LYW A; 
#chains in the Genus database with same CATH topology
 2NVT C;  2E2I C;  3HOZ C;  1TWC C;  3GTM C;  3LYW A;  4QJV A;  5D4D A;  2PPB A;  4AYB D;  2KPU A;  1K83 C;  2O5I A;  4MEX A;  4A3L C;  4OIO A;  1BDF A;  4Y7N C;  2BE5 A;  4XLP A;  4OIP A;  1I6H C;  3RZD C;  3FKI C;  4C2M C;  2A6H A;  4XLN A;  3M4O C;  4BY7 C;  2L3U A;  2PA8 D;  3S1R C;  5C3E C;  3S17 C;  4Y52 C;  4XSX A;  4MQ9 A;  4C3H C;  3HOV C;  3S1M C;  2JA5 C;  4BXX C;  4WFA S;  3H0G C;  3PIO S;  3RZO C;  5IYD C;  2ZJP S;  3S1Q C;  4ZH4 A;  1YNN A;  4KMU A;  1HQM A;  5JVH S;  3I4M C;  2A68 A;  4XSZ A;  5DM7 S;  3CQZ C;  3GTO C;  5HQH A;  4KN4 A;  5IYB C;  4IOC S;  3S2H C;  2PMZ D;  3S1N C;  4MEY A;  4NOI A;  4A3I C;  4BBS C;  4WFB S;  4YFK A;  4C3J C;  3HOX C;  4OIN A;  1Y1V C;  3HOW C;  1TWA C;  4G7H A;  4G7Z A;  4KN7 A;  3PO3 C;  4GZY A;  3DLL S;  4YG2 A;  4WF9 S;  2ZJR S;  2R7Z C;  3S2D C;  2YU9 C;  3HOU C;  5FLM C;  1WCM C;  4IO9 S;  5TMC A;  2A6E A;  4LK0 A;  3GTQ C;  2JA6 C;  2ZJQ S;  4U67 S;  1I3Q C;  1TWG C;  4Q4Z A;  2KXY A;  4C3I C;  1SFO C;  3PIP S;  4BY1 C;  1Y1W C;  2WB1 D;  1ZYR A;  5C4X C;  4LK1 A;  3GTP C;  3GTJ C;  5C4J C;  2E2J C;  3H3V D;  2O5J A;  4YFN A;  3I4N C;  4A93 C;  5IP9 C;  1YNJ A;  1SMY A;  4A3E C;  1R9T C;  3DXJ A;  4JK1 A;  4A3J C;  4X6A C;  2JA8 C;  2JA7 C;  4A3G C;  4LJZ A;  4A3C C;  1IW7 A;  2VUM C;  5IP7 C;  2Y0S D;  2WAQ D;  4WCE S;  4A3K C;  4A3M C;  2NVX C;  2B63 C;  2L5N A;  2KQ1 A;  3CF5 S;  2R93 C;  1FEU A;  5TMF A;  5JVG S;  3GTL C;  4A3D C;  2A69 A;  2NVQ C;  5C44 C;  2NVY C;  3HOY C;  5DM6 S;  4YFX A;  2E2H C;  1TWF C;  3GTG C;  3M3Y C;  5IYC C;  1TWH C;  4BBR C;  3GTK C;  4IOA S;  4OIR A;  2R92 C;  4QIW D;  4A3B C;  3S16 C;  4Q5S A;  4A3F C;  1I50 C;  2CW0 A;  3HKZ D;  1I6V A;  3S15 C;  4WFN S;  3PO2 C;  4LLG A;  4G7O A;  3K7A C;  3EQL A;  3S14 C;  5HL7 S;  4OIQ A;  3WOD A; 
#chains in the Genus database with same CATH homology
 2L5N A;  2KQ1 A;  2L3U A;  2KXY A;  2KPU A;  5HQH A;  3LYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...