2KQ1A

Solution structure of protein bh0266 from bacillus halodurans. northeast structural genomics consortium target bhr97a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
MPTFDHGNLSLGELELTVLYDEERYDIVEQTETVQVDLEGPRGVLTVFRFARPSYEVFVDLTEAGEGSHTVDVEHRGFPGDLAVTVEPRMARVQLEERQTVSVPVTVEMINLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH0266 protein
publication title Solution Structure Of Protein BH0266 From Bacillus halodurans
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07949 YbbR YbbR-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 2kq1A01
2KQ1A 5HQHA 2L3UA 2L5NA 2KPUA 3LYWA
chains in the Genus database with same CATH superfamily
4OIRA 1K83C 5IYBC 2PMZD 3GTGC 4MEYA 4WFNS 4GZYA 4A3CC 1TWFC 4XSXA 4Y52C 2R93C 3S1MC 4LK1A 5IP7C 4OIOA 4A3EC 4BY1C 2JA6C 5JVHS 5C4JC 4YG2A 4A3LC 1SMYA 5D4DA 3HOUC 3S17C 4BBRC 3PIOS 3HKZD 4XSZA 4G7OA 1BDFA 2A6HA 2JA5C 2E2JC 1TWAC 2E2HC 5HQHA 4OIPA 2CW0A 3HOWC 3RZOC 2E2IC 1FEUA 4BY7C 4A3FC 3PO3C 1YNJA 5JVGS 4WF9S 1TWHC 2L5NA 3GTLC 1ZYRA 4BXXC 1I50C 3S2HC 5TMFA 2R7ZC 1Y1WC 5DM6S 5C4XC 4C3JC 3LYWA 3K7AC 4QIWD 4NOIA 3DLLS 3S15C 3EQLA 3H3VD 2A68A 2NVYC 2NVTC 1HQMA 2WB1D 3FKIC 4C3HC 2KXYA 4KN4A 4A3BC 4QJVA 4WFBS 4A3MC 4Q5SA 3GTOC 5C44C 3S1RC 3HOYC 1I6VA 4A3IC 4A3KC 5FLMC 3DXJA 1YNNA 5IYCC 3RZDC 3S16C 5IYDC 3H0GC 4X6AC 4JK1A 2NVXC 4BBSC 3S1QC 4C2MC 4WCES 3S1NC 3CF5S 4A3DC 4ZH4A 2ZJQS 2NVQC 4YFXA 5HL7S 5IP9C 3M4OC 2BE5A 4IO9S 1WCMC 2PA8D 4LK0A 4LJZA 3HOXC 1SFOC 3PO2C 4LLGA 1IW7A 3GTQC 4A93C 4Q4ZA 4XLPA 4KN7A 4OIQA 4WFAS 1TWGC 4G7HA 4XLNA 2PPBA 4U67S 4IOCS 2ZJPS 4IOAS 5TMCA 4A3JC 3GTPC 2VUMC 3S2DC 4Y7NC 4A3GC 2Y0SD 2O5IA 2KPUA 1I6HC 5C3EC 2JA8C 4MEXA 4YFKA 2KQ1A 2WAQD 3HOZC 2JA7C 3WODA 3S14C 3GTJC 4YFNA 1R9TC 2O5JA 1I3QC 2B63C 3GTKC 4G7ZA 2A69A 2A6EA 4OINA 2R92C 3GTMC 3HOVC 1TWCC 2YU9C 2ZJRS 4MQ9A 3I4MC 5DM7S 4C3IC 3M3YC 3I4NC 4KMUA 4AYBD 1Y1VC 2L3UA 3PIPS 3CQZC
chains in the Genus database with same CATH topology
2KQ1A 2KXYA 5HQHA 2L3UA 2L5NA 2KPUA 3LYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ1 A;  5HQH A;  2L3U A;  2L5N A;  2KPU A;  3LYW A; 
#chains in the Genus database with same CATH topology
 4OIR A;  1K83 C;  5IYB C;  2PMZ D;  3GTG C;  4MEY A;  4WFN S;  4GZY A;  4A3C C;  1TWF C;  4XSX A;  4Y52 C;  2R93 C;  3S1M C;  4LK1 A;  5IP7 C;  4OIO A;  4A3E C;  4BY1 C;  2JA6 C;  5JVH S;  5C4J C;  4YG2 A;  4A3L C;  1SMY A;  5D4D A;  3HOU C;  3S17 C;  4BBR C;  3PIO S;  3HKZ D;  4XSZ A;  4G7O A;  1BDF A;  2A6H A;  2JA5 C;  2E2J C;  1TWA C;  2E2H C;  5HQH A;  4OIP A;  2CW0 A;  3HOW C;  3RZO C;  2E2I C;  1FEU A;  4BY7 C;  4A3F C;  3PO3 C;  1YNJ A;  5JVG S;  4WF9 S;  1TWH C;  2L5N A;  3GTL C;  1ZYR A;  4BXX C;  1I50 C;  3S2H C;  5TMF A;  2R7Z C;  1Y1W C;  5DM6 S;  5C4X C;  4C3J C;  3LYW A;  3K7A C;  4QIW D;  4NOI A;  3DLL S;  3S15 C;  3EQL A;  3H3V D;  2A68 A;  2NVY C;  2NVT C;  1HQM A;  2WB1 D;  3FKI C;  4C3H C;  2KXY A;  4KN4 A;  4A3B C;  4QJV A;  4WFB S;  4A3M C;  4Q5S A;  3GTO C;  5C44 C;  3S1R C;  3HOY C;  1I6V A;  4A3I C;  4A3K C;  5FLM C;  3DXJ A;  1YNN A;  5IYC C;  3RZD C;  3S16 C;  5IYD C;  3H0G C;  4X6A C;  4JK1 A;  2NVX C;  4BBS C;  3S1Q C;  4C2M C;  4WCE S;  3S1N C;  3CF5 S;  4A3D C;  4ZH4 A;  2ZJQ S;  2NVQ C;  4YFX A;  5HL7 S;  5IP9 C;  3M4O C;  2BE5 A;  4IO9 S;  1WCM C;  2PA8 D;  4LK0 A;  4LJZ A;  3HOX C;  1SFO C;  3PO2 C;  4LLG A;  1IW7 A;  3GTQ C;  4A93 C;  4Q4Z A;  4XLP A;  4KN7 A;  4OIQ A;  4WFA S;  1TWG C;  4G7H A;  4XLN A;  2PPB A;  4U67 S;  4IOC S;  2ZJP S;  4IOA S;  5TMC A;  4A3J C;  3GTP C;  2VUM C;  3S2D C;  4Y7N C;  4A3G C;  2Y0S D;  2O5I A;  2KPU A;  1I6H C;  5C3E C;  2JA8 C;  4MEX A;  4YFK A;  2KQ1 A;  2WAQ D;  3HOZ C;  2JA7 C;  3WOD A;  3S14 C;  3GTJ C;  4YFN A;  1R9T C;  2O5J A;  1I3Q C;  2B63 C;  3GTK C;  4G7Z A;  2A69 A;  2A6E A;  4OIN A;  2R92 C;  3GTM C;  3HOV C;  1TWC C;  2YU9 C;  2ZJR S;  4MQ9 A;  3I4M C;  5DM7 S;  4C3I C;  3M3Y C;  3I4N C;  4KMU A;  4AYB D;  1Y1V C;  2L3U A;  3PIP S;  3CQZ C; 
#chains in the Genus database with same CATH homology
 2KQ1 A;  2KXY A;  5HQH A;  2L3U A;  2L5N A;  2KPU A;  3LYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...