2KQ1A

Solution structure of protein bh0266 from bacillus halodurans. northeast structural genomics consortium target bhr97a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
b'MPTFDHGNLSLGELELTVLYDEERYDIVEQTETVQVDLEGPRGVLTVFRFARPSYEVFVDLTEAGEGSHTVDVEHRGFPGDLAVTVEPRMARVQLEERQTVSVPVTVEMINLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH0266 protein
publication title Solution Structure Of Protein BH0266 From Bacillus halodurans
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07949 YbbR YbbR-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 2kq1A01
2KPUA 2KQ1A 2L3UA 5HQHA 3LYWA 2L5NA
chains in the Genus database with same CATH superfamily
4OINA 4A3GC 3PIPS 4LLGA 4A3FC 2PPBA 4BY1C 3GTMC 3S17C 4BY7C 3S14C 4LK0A 4A3IC 3S2DC 1TWHC 2ZJPS 4IOAS 2L5NA 3S1RC 4XSZA 2NVYC 2CW0A 4QIWD 1YNJA 3HOXC 4XLPA 2JA7C 4A3JC 2KPUA 4XLNA 3HOWC 3DLLS 4OIQA 3CF5S 2PMZD 2NVTC 3GTPC 2O5IA 3S16C 4X6AC 1WCMC 5JVHS 3H3VD 2A69A 4LK1A 3GTJC 4MEXA 2A68A 2YU9C 3S15C 2Y0SD 3WODA 4IOCS 4A3LC 5IYDC 1TWFC 1I6HC 3GTGC 4AYBD 4C3IC 4LJZA 1I6VA 2R93C 1K83C 4A3KC 2PA8D 1Y1VC 1YNNA 4WFAS 4A3CC 1HQMA 5C44C 3CQZC 2KXYA 3LYWA 3HOZC 3GTKC 3PO3C 4GZYA 4WF9S 1IW7A 3PIOS 3RZDC 2VUMC 2JA5C 4ZH4A 1TWGC 3HOUC 3GTOC 3DXJA 2JA6C 4OIPA 5DM7S 5JVGS 4KN7A 4A93C 3PO2C 2O5JA 4MQ9A 2ZJQS 4KN4A 4Q5SA 4YFNA 4JK1A 4A3BC 1I50C 5TMCA 5D4DA 2NVXC 3FKIC 4A3EC 3K7AC 2E2JC 5FLMC 5IYBC 5HQHA 2R7ZC 2A6EA 2JA8C 3HOYC 4Y7NC 4OIRA 4WFNS 3GTQC 1SMYA 4MEYA 5IP9C 5C4JC 3M3YC 4A3DC 4G7OA 1ZYRA 4WCES 2R92C 4A3MC 2NVQC 3M4OC 3I4NC 1I3QC 3H0GC 2WAQD 4XSXA 4C2MC 5TMFA 4Q4ZA 1BDFA 4OIOA 4BBRC 4YFKA 4BBSC 2E2IC 3HKZD 3GTLC 4C3JC 4QJVA 2L3UA 1TWCC 4KMUA 5HL7S 4C3HC 4U67S 5DM6S 3HOVC 4G7ZA 5IP7C 1FEUA 3RZOC 2B63C 4Y52C 3EQLA 1SFOC 4YFXA 2BE5A 1R9TC 3S1MC 2KQ1A 5C3EC 2A6HA 3S2HC 4WFBS 2E2HC 4NOIA 2ZJRS 4YG2A 4BXXC 3S1NC 1Y1WC 5C4XC 2WB1D 5IYCC 3I4MC 4IO9S 3S1QC 4G7HA 1TWAC
chains in the Genus database with same CATH topology
2KPUA 2KQ1A 2L3UA 5HQHA 2KXYA 3LYWA 2L5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPU A;  2KQ1 A;  2L3U A;  5HQH A;  3LYW A;  2L5N A; 
#chains in the Genus database with same CATH topology
 4OIN A;  4A3G C;  3PIP S;  4LLG A;  4A3F C;  2PPB A;  4BY1 C;  3GTM C;  3S17 C;  4BY7 C;  3S14 C;  4LK0 A;  4A3I C;  3S2D C;  1TWH C;  2ZJP S;  4IOA S;  2L5N A;  3S1R C;  4XSZ A;  2NVY C;  2CW0 A;  4QIW D;  1YNJ A;  3HOX C;  4XLP A;  2JA7 C;  4A3J C;  2KPU A;  4XLN A;  3HOW C;  3DLL S;  4OIQ A;  3CF5 S;  2PMZ D;  2NVT C;  3GTP C;  2O5I A;  3S16 C;  4X6A C;  1WCM C;  5JVH S;  3H3V D;  2A69 A;  4LK1 A;  3GTJ C;  4MEX A;  2A68 A;  2YU9 C;  3S15 C;  2Y0S D;  3WOD A;  4IOC S;  4A3L C;  5IYD C;  1TWF C;  1I6H C;  3GTG C;  4AYB D;  4C3I C;  4LJZ A;  1I6V A;  2R93 C;  1K83 C;  4A3K C;  2PA8 D;  1Y1V C;  1YNN A;  4WFA S;  4A3C C;  1HQM A;  5C44 C;  3CQZ C;  2KXY A;  3LYW A;  3HOZ C;  3GTK C;  3PO3 C;  4GZY A;  4WF9 S;  1IW7 A;  3PIO S;  3RZD C;  2VUM C;  2JA5 C;  4ZH4 A;  1TWG C;  3HOU C;  3GTO C;  3DXJ A;  2JA6 C;  4OIP A;  5DM7 S;  5JVG S;  4KN7 A;  4A93 C;  3PO2 C;  2O5J A;  4MQ9 A;  2ZJQ S;  4KN4 A;  4Q5S A;  4YFN A;  4JK1 A;  4A3B C;  1I50 C;  5TMC A;  5D4D A;  2NVX C;  3FKI C;  4A3E C;  3K7A C;  2E2J C;  5FLM C;  5IYB C;  5HQH A;  2R7Z C;  2A6E A;  2JA8 C;  3HOY C;  4Y7N C;  4OIR A;  4WFN S;  3GTQ C;  1SMY A;  4MEY A;  5IP9 C;  5C4J C;  3M3Y C;  4A3D C;  4G7O A;  1ZYR A;  4WCE S;  2R92 C;  4A3M C;  2NVQ C;  3M4O C;  3I4N C;  1I3Q C;  3H0G C;  2WAQ D;  4XSX A;  4C2M C;  5TMF A;  4Q4Z A;  1BDF A;  4OIO A;  4BBR C;  4YFK A;  4BBS C;  2E2I C;  3HKZ D;  3GTL C;  4C3J C;  4QJV A;  2L3U A;  1TWC C;  4KMU A;  5HL7 S;  4C3H C;  4U67 S;  5DM6 S;  3HOV C;  4G7Z A;  5IP7 C;  1FEU A;  3RZO C;  2B63 C;  4Y52 C;  3EQL A;  1SFO C;  4YFX A;  2BE5 A;  1R9T C;  3S1M C;  2KQ1 A;  5C3E C;  2A6H A;  3S2H C;  4WFB S;  2E2H C;  4NOI A;  2ZJR S;  4YG2 A;  4BXX C;  3S1N C;  1Y1W C;  5C4X C;  2WB1 D;  5IYC C;  3I4M C;  4IO9 S;  3S1Q C;  4G7H A;  1TWA C; 
#chains in the Genus database with same CATH homology
 2KPU A;  2KQ1 A;  2L3U A;  5HQH A;  2KXY A;  3LYW A;  2L5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...