2KQ2A

Solution nmr structure of the apo form of a ribonuclease h domain of protein dsy1790 from desulfitobacterium hafniense, northeast structural genomics target dhr1a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
147
structure length
147
Chain Sequence
MDDRTEYDVYTDGSYVNGQYAWAYAFVKDGKVHYEDADVGKNPAAATMRNVAGEIAAALYAVKKASQLGVKIRILHDYAGIAFWATGEWKAKNEFTQAYAKLMNQYRGIYSFEKVKAHSGNEFNDYVDMKAKSALGIRDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H-related protein
publication title Solution NMR structure of the apo form of a ribonuclease H domain of protein DSY1790 from Desulfitobacterium hafniense, Northeast Structural Genomics target DhR1A
rcsb
source organism Desulfitobacterium hafniense dcb-2
molecule tags Hydrolase
total genus 30
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2009-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2kq2A01
3MECA 4CK2A 1VSMA 5J2NA 4FJGA 4CECA 4FLVA 3QEVA 4IG3A 3TARA 1QHTA 3K59A 4E0DA 4DMNA 1VSIA 2OA8A 3AA4A 3LZIA 1BI4A 1JLQA 4DSEA 3QEIA 3EZ5A 1K6YA 4I9QA 5T7BA 3AVFA 5HROA 2Z1HA 1RTIA 3VQAA 3NH2A 1ITGA 4C8OA 3RR8A 2IDOA 4AILC 1HNIA 3DLKA 3SV3A 3KKSA 3QERA 4CF8A 1XWLA 4RG8A 1EX4A 1UOCA 4NYNA 4O0JA 4Y1DA 4KPYA 2Z1IA 4CF2A 4HHTA 1ZBLA 4CJPA 2JGUA 2RF2A 4CGDA 1ZBIA 3V1RA 3AA5X 1S9GA 3OYFA 4NYFA 2HNZA 1BI4B 1RBTA 1J54A 2YKNA 4CEAA 1NKEA 2KW4A 3L8BA 4CJUA 4R5PA 1RBVA 4DFKA 4FJXA 4FJ5A 4DTUA 1ZBUA 3NF7A 1W9HA 3HO1A 4RW9A 3P83D 3SQ2A 1EKEA 3RTVA 3U3YA 3LP2A 3NGYA 4B9TA 3H08A 4B3OA 3VA0A 2F96A 3PX0A 2O4IA 4BACA 2HMIA 5HP1A 3KKRA 4H4OA 4KI6A 2X6NA 4CEFA 5FRNA 4DS4A 3RR7A 3KJVA 2BANA 1C0TA 3PX4A 3VQ9A 3VQBA 3K57A 4FLXA 1HQUA 4DQSA 1RTJA 4DTJA 1WSGA 4OLAA 5CY4A 2KZZA 1KCFA 3RRGA 3TAFA 3SUQA 3OJUA 1C0MA 4ID5A 4HUGA 3BGRA 4OJRA 3SUNA 1SKRA 1KTQA 2PYJA 2DFFA 3LP3A 2RN2A 4BE0A 4J2DA 1CLQA 3VQ4A 2NUBA 1JXEA 1XHXA 4CERA 3L2VA 2IS3A 2RKIA 3L2UA 4ZHRA 2XY7A 1A5WA 2BDPA 1U04A 3QESA 1RDCA 4DSJA 2HVHA 3MXIA 2HHQA 3JSMA 2PZSA 4KAZA 3ZT0A 5I3UA 1X9SA 1TK5A 1VRTA 2FC0A 3QEPA 3LPUA 2HHTA 5CZ2A 1KVCA 2X78A 1DTTA 1S1TA 3C6TA 1TKTA 3MEGA 3HJFA 1B9FA 1DTQA 4KHSA 1JKHA 1S1VA 3HPHA 1HYSA 5FROA 1J5OA 5HRRA 4DU4A 1TK0A 4J2EA 1I39A 3OYEA 3M8RA 4KV8A 3DLGA 5D3GA 5JS2A 3WNEA 1U47A 1DLOA 3AVGA 2FBTA 3EYZA 3DYAA 1T05A 4AHTA 3MEDA 1VSLA 4CHZA 3ZT4A 4M41A 3KK1A 3S9HA 1UA0A 4N41A 5J2PA 4Z4EA 3HK2A 4FXDA 4CIFA 1RT1A 4O0IA 1EP4A 3PY8A 4GMJB 3VQPA 2YHAA 1RTHA 4ELVA 4DSFA 4CHNA 4N56A 2WOMA 4OPKA 4Q5VA 4E7KA 1D9FA 4IFVA 3C6UA 3V9SA 3VA3A 1O1WA 2OPRA 1HQEA 4W5TA 4PWDA 4QAGA 1YT3A 3NH1A 3IG1A 4DQRA 4KKOA 4EP4A 3TANA 1NOZA 3AA3A 4OLBA 3HYFA 1RT7A 3C95A 2IAJA 1XI1A 1QTMA 3U6FA 5J2QA 1TKXA 3L3VA 3OVNA 3PX6A 3SNNA 1S9EA 4CJQA 2VG6A 1RDAA 5JS1A 1CZ9A 4O5BA 3V9WA 3L3UA 2FBYA 2I5JA 3HM9A 3B6OA 1R0AA 3ZSYA 3I0RA 3QIPA 4Z4HA 4E1MA 3OYAA 4I2PA 2BE2A 3K5OA 4Z4CA 3SPYA 4ID1A 3SQ0A 2Q3SA 4ZTJA 3KIOA 2OPSA 4CFBA 3WNHA 3OYKA 1WSJA 3SQ1A 4N76A 4M3XA 2KFZA 5EU7A 4FJMA 3B6PA 2LSNA 3ULDA 3HP6A 4I2QA 2QKBA 3S3MA 4C8LA 2KTQA 1NK4A 1RT6A 2YNGA 4KO0A 2B5JA 3O3GA 4O55A 3ZCMA 2KZMA 3CFOA 2E4LA 4DU1A 3SCXA 1WSIA 1BCMA 4B9MA 1IH7A 3BDPA 3KTQA 1VRUA 1SKWA 3VQ8A 1JLEA 1HPZA 1JLCA 1ZYQA 1IKXA 4IDKA 4WE1A 4JRQA 1NK7A 4JS5A 4BDPA 3DRSA 4F3TA 3QEXA 4CGGA 1A5XA 1BIUA 3AVKA 3QINA 3KLGA 4FM0A 3TAMA 4M3YA 1KFSA 4FVMA 3TR8A 3HSTB 3HT3A 3WNFA 4O4GA 3AVJA 4E19A 2GBZA 3FFIA 1RCHA 4FLYA 3QNNA 3L2RA 4FW2A 3T3FA 2OZSA 3CQ8A 4PUOA 1KFDA 3OYHA 1RDDA 4CESA 4FYDA 3THVA 1SKSA 1TKDA 2YNIA 1S5JA 3ITHA 3V9XA 5SWMA 1GOAA 4CJWA 4Z0UA 1Q9XA 4RW6A 3SUOA 3OYGA 4E7HA 3ZT1A 2HHSA 4PA1A 2OZMA 4DTPA 5KRTA 2ATQA 2ETJA 4KREA 4DFJA 3ISNC 3CYMA 1QSYA 1CZBA 2DFEA 1BQMA 1LWFA 4Z4IA 1NK5A 3CFPA 4ELUA 1WN7A 1JLBA 3AVBA 4BDYA 2QXFA 3D45A 2HHUA 1RT2A 4CFCA 4KI4A 3AO5A 1T7PA 1VSEA 3M8QA 1RILA 3RWUA 3ZT3A 4FZXC 4GVMA 3V1QA 4DLEA 2P5GA 1L5UA 3VQ6A 2KFNA 4OKKA 2KQ2A 4CEBA 2DFHA 1C1CA 2IC3A 4KFBA 4OVLA 4H8KA 3U3GA 3OYCA 1Q9YA 3KD5E 2HHXA 2VWJA 1WNSA 1ASVA 1L3VA 2G8KA 3MAQA 1ASWA 4LY7A 3RRHA 4CIEA 3AO4A 4RW7A 5CZ1A 4YNQA 1Q8IA 3CG7A 3V9UA 3VQCA 4BWMA 3CFRA 4QOZB 5DK5A 1LAVA 3NHGA 1HYVA 3K5LA 4KRFA 1FK9A 4DQQA 1JLFA 2FBXA 4JLHA 4LH5A 4RW4A 3VQ7A 4JRPA 4AHSA 5J2MA 3SV4A 4B8CA 1IKYA 3TAGA 4CHPA 3TWHA 2FBVA 1UAXA 1HRHA 1IKWA 4Y1CA 1G15A 3QNOA 3LAMA 2HHVA 1HJRA 3LANA 1NJWA 1BISA 3NF6A 4LD0A 3HVRA 3AO1A 1NK8A 4HCCA 4DTRA 4CJVA 3OY9A 4DS5A 4EP5A 1TGOA 2GUIA 3ZSXA 2GV9A 3DOKA 5HRSA 4F2SA 1IO2A 3D0PA 2IOCA 3O3HA 3O4QA 4CGFA 3O3FA 4IKFA 5HBMA 3SZ2A 4C8MA 3SI6A 3OYDA 2PY5A 3V81A 4ELTA 5HLFA 4CFDA 3NF9A 4DTOA 3LZJA 1NK0A 1QSSA 1WSFA 3AV9A 4CEOA 4CGJA 2D0AA 5C25A 2XY6A 2QKKA 4J2AA 1J53A 1NJZA 3SJJA 3DRPA 4AHCA 1T8EA 3IS9A 1KLNA 2XY8A 1YVUA 4OGCA 4F2RA 4BWJA 1W0HA 3AVAA 4MFBA 3HP9A 3QLHA 3OYMA 1TL3A 3ZT2A 3RMAA 1L3UA 1GOBA 1S1XA 3RMCA 4DTNA 2HNDA 3HPOA 4N47A 4ICLA 4KTWA 1D8YA 4DTXA 1RBRA 3P5JA 2YV0X 4AHUA 3VQQA 4CJLA 1S1WA 4M3RA 3SQ4A 3CM5A 1WSEA 4CJ5A 4KHNA 4DF8A 5HRPA 1NK6A 4DTMA 3ZSZA 3P1GA 1LW0A 4B8AB 5E41A 4M3UA 2DTUA 4F3OA 1I3AA 1Z25A 4CHQA 1VSKA 4G1QA 2EHGA 1BL3A 3G0ZA 4TSXA 4LSNA 4M45A 1EETA 4CGHA 1KVBA 1XC9A 2P51A 4M42A 1SL1A 3LALA 4E7IA 1NKCA 1ZBHA 4CJ4A 1C6VA 1RDBA 2RPIA 1U48A 4KHWA 4K8XA 3O4NA 1L3SA 2Z1JA 1RBSA 3AO2A 3OS2A 5FDLA 1MU2A 3VQ5A 2XRIA 4IFYA 3OYIA 3L2QA 2G8UA 3V6DA 3TAPA 2F8TA 1SV5A 3RMBA 4DSIA 4E7JA 3L2WA 4KB1A 4CFAA 1EXQA 1S6PA 3OS0A 3C94A 4FLUA 4FJKA 4K8ZA 1RTDA 3TABA 1LWEA 4FJ7A 1TKZA 2HHWA 1LAWA 3HXMA 1U45A 3TI0A 3SUPA 1HYZA 4FJNA 4ZTFA 1KSPA 1FXXA 4CGIA 5SZTA 2P5OA 3SPZA 4NCBA 2A1SA 5J1EA 3AA2A 3WNGA 5HRNA 5KGXA 3KK3A 5KTQA 4FK0A 4AH9A 4KHUA 4C8NA 1D9DA 2ZD1A 3LWLA 4BDZA 1GOCA 3HVTA 1NJYA 4HTUA 3V4IA 4FZZA 3KD1E 2YNHA 3PO5A 2YKMA 1WAFA 3NCIA 5KRSA 3T19A 3NF8A 4W5QA 4KTQA 4I9LA 2ITGA 4OKEA 3RMDA 3OJSA 1J9AA 1RT5A 1T03A 1ZBFA 4KB0A 3QO9A 1UA1A 4LH4A 3KLIA 4CE9A 3LAKA 2JLEA 4B9VA 4F4KA 3E01A 2D0CA 4OGEA 3AVLA 3F73A 2YNFA 2Y1JA 2A1RA 1C0UA 3LP1A 4GW6A 1X9WA 1X9MA 1LV5A 4O44A 1TAQA 1BIZA 4QCLA 4FLZA 4FJHA 1BHLA 4B08A 2X6SA 3VN5A 4XIUA 2Z1GA 1VSHA 3MEEA 2G8FA 4LSLA 2VWKA 4CEEA 4J2BA 4CK3A 1U49A 3NGZA 2W42A 1FKOA 1B92A 4DG1A 3OYLA 1QSLA 4UQGA 1NJXA 4HUFA 1XHZA 4DFMA 4PQUA 1LW2A 5KGWA 3ZSVA 3HPGA 3T1AA 3AVHA 2G8IA 3TAEA 4IBNA 1RT4A 4FM2A 5I42A 3NBPA 4CJFA 3UIQA 3K5MA 4CHOA 4DTSA 1Y97A 3K58A 2G8HA 2PYLA 1TV6A 1LWCA 4H4MA 4I7FA 3QETA 3NE6A 4B9UA 1RT3A 2B6AA 3DRRA 4CJEA 5K14A 2VG5A 2QK9A 2VG7A 4KTZA 3VQDA 1BCOA 3S3NA 1IKVA 3I0SA 4CF0A 3DM2A 4E3SA 4FZYA 3QEWA 4EZ9A 1ASUA 4JS4A 4NCAA 4FK4A 3EY1A 2HVIA 4Z4FA 3DLRA 4FW1A 1RNHA 3V1OA 4E1NA 3ZSQA 3DLHA 1WAJA 2HNYA 4BE1A 1VSFA 4IG0A 4KHQA 4Z4GA 1NOYA 3F9KA 5DMRA 2E6LA 2P1JA 2ZQBA 4CEDA 4PY5A 4FLTA 3NAEA 4W5NA 2YHBA 3VQEA 3OS1A 1KLMA 3A2FA 2G8VA 1TVRA 4MQ3A 4CJSA 4AHVA 4L8RB 4M3TA 4CJRA 1YTUA 4RW8A 1BQNA 3ALYA 3NFAA 3K2PA 1JXBA 2XHBA 4DFPA 1N6QA 3OYNA 3ASMA 1JL2A 1VSDA 2E6MA 1C1AA 3V9ZA 3K5NA 1VSJA 1CXQA 4B9SA 1CXUA 1SUQA 4W5RA 4CF9A 4B9LA 2HW3A 4CEZA 4DLGA 1TL1A 2G8WA 1HMVA 3LWMA 4KHYA 1NK9A 3JYTA 1NKBA 1QQCA 4CEQA 2OYQA 1N5YA 5CYMA 3MXMA 3HL8A 4OKJA 2X74A 3ZSWA 1U4BA 1D5AA 1REVA 1B9DA 2XY5A 4B9NA 4Q0BA 3NDKA 2EX3A 1KRPA 1WSHA 3S3OA 3AO3A 2DY4A 4AHRA 4FK2A 1JLGA 1QS4A 2BGGA 3DLBA 1S6QA 1VK0A 3LDSA 3ZSOA 4E89A 4HCBA 2O4GA 3ZSRA 2AJQA 1S1UA 3OYJA 1F21A 4FLWA 1YTAA 4CJ3A 4CCHA 3MXJA 4CF1A 1RBUA 3CM6A 4CJTA 3LPTA 4N5SA 3NGIA 4OPJA 4DSLA 3M8PA 1BGXT 1L3TA 4FCYA 3SYZA 3IAYA 2D5RA 3AVIA 5C24A 1SL0A 5C42A 3DI6A 3AVNA 3DOLA 2D0BA 3KLFA 4CIGA 1JLAA 1X1PA 2F8SA 3DLEA 3DMJA 4FJ8A 4E7LA 4DQIA 4W5OA 3I8DA 2R7YA 3KLEA 4F8RA 4FJLA 1SL2A 4EZ6A 4DWIA 3KLHA 4CK1A 3AVCA 1KVAA 1FKPA 2IGIA 3IRXA 5KI6A 4HVJA 3PV8A 4NCGA 2OPPA 3KK2A 2XO7A 1TK8A 1WLJA 3AVMA 1IG9A 4BE2A 2WONA 1Z26A 3PO4A 3QIOA 3OYBA 1C1BA 2B4JA 1JL1A 2OPQA 3LP0A 3M8SA 4DQPA 4DU3A 4FJ9A 5CYQA 3NH0A 4FM1A 3PUFA 2Y1IA 4YFUA 2HB5A 3TAQA 4M3WA 1A5VA 1QE1A 4FJIA 1TAUA 1UWBA 3G10A 5FRMA 4C8KA 4CHYA 4HUEA 4DF4A 4M3ZA 2ZE2A 4FJJA 4CJKA 1HNVA 4DSKA
chains in the Genus database with same CATH superfamily
3MECA 1IV0A 1VSMA 3CJ9A 4H5TA 5J2NA 4CECA 2V7ZA 4IG3A 5AQMA 1S3XA 4C1NK 3GG4A 3AA4A 3BF3A 1JCFA 2E2PA 3EZ5A 3QEIA 2P9LB 5BR9A 3VTHA 2NNWA 3VQAA 1E3MA 1ITGA 1K8AO 4B1YB 3DLKA 3WQTA 4RG8A 1EX4A 3OA9A 4DR5K 4Y1DA 2Z1IA 4CF2A 4HHTA 1NGHA 4CJPA 2RF2A 5LL6Z 4JKCA 1Q82O 1S9GA 3OYFA 3DXKA 4NYFA 1BI4B 1J54A 3J80O 5DM6L 4FJXA 3NF7A 3MMVA 3P83D 1EKEA 5EXWA 3RTVA 3LP2A 3U4LA 4B9TA 5C0YA 3FGUA 3KKRA 4H4OA 4WQ5C 4KI6A 3VGLA 3RR7A 1GLDG 3VQ9A 2BTFA 4JKFA 4CBUA 3K57A 2ZF5O 3ATUA 5CY4A 3CJAA 2A41A 4WFNL 3TPQA 1C0MA 2QWMA 4ILHA 3SUNA 1SKRA 2DFFA 2RN2A 3HOSA 4GNIA 3UB5A 1K8KB 1JXEA 3L2VA 4BC3A 4FOEA 3QESA 1RDCA 3SLCA 1X3MA 4WFAL 2QA4N 5M1PA 4DR3K 5I3UA 1X9SA 5CZ2A 2X78A 1BA0A 4BRMA 3ULEB 1B9FA 4DKWA 1DTQA 1S1VA 5HRRA 1P90A 4YOXA 2UU9K 5JS2A 1U47A 3EYZA 2ZJRL 4OPHA 4FWNA 1KAYA 3MX2A 4NXNK 3KK1A 4N41A 3HK2A 4CIFA 2O8DB 2FSJA 4OPKA 3C6UA 3VA3A 1QQMA 1M1KO 4W5TA 4PWDA 1NU0A 4DQRA 3VGKA 3CQYA 1CZAN 1LOTB 3HYFA 2Q2RA 3SNNA 2VG6A 3ZEUB 4LFBK 3V9WA 3L3UA 2FBYA 2I5JA 2AA4A 3O6WA 5EY4A 3HM9A 3ZSYA 1VQKN 4Z4HA 1ZBSA 4E1MA 3K5OA 3EEQA 3O4WA 2FXUA 2KFZA 3FZKA 4FJMA 1ATSA 3G71N 2ZGYA 4C8LA 1RT6A 4JV5K 2Q1NA 2KZMA 3E9LA 1EWRA 4B3RK 4DU1A 3NVMA 1QVFM 1IH7A 1GLAG 2YHYA 3U9DA 3KTQA 1SKWA 3A5LC 4AQYK 1JLCA 1HPZA 4CGGA 3AVKA 3QINA 3RSEB 4HTLA 3LDPA 5TKYA 1G99A 1NMNA 4FVMA 3TR8A 1GLEG 1OVYA 2GUPA 1VQ7N 4X64K 2I7NA 5FPMA 1RCHA 4FLYA 3QNNA 2ZGZA 4B1VA 1VQPN 3K0SA 3R6MA 2P9NB 2F4VK 4PUOA 1RDDA 4K41A 1SKSA 4AM7A 1Q9XA 4Z0UA 5M1KA 3SUOA 4E7HA 2BH1A 4IZ9A 4LF5K 1IBKK 2EWSA 1BQMA 4ELUA 4I6MA 1JLBA 2HF4A 4KI4A 3AO5A 1VSEA 3M8QA 3CETA 3ZT3A 4FZXC 4IOCL 2P5GA 3THWA 3VEWA 2KQ2A 4CEBA 4KHPK 4OVLA 4JKGA 3U3GA 5AQGA 3R9PA 1L3VA 1WNSA 3WXIA 3AO4A 2V51B 3CFRA 5EX5A 1S72N 1HYVA 5FPNA 3K5LA 4KRFA 2O8BA 2FBXA 4RW4A 4H0XB 4AHSA 1Q86O 3CJBA 5KPTA 3CHWA 4CHPA 3TAGA 1HRHA 3VEVA 3H6EA 3LL3A 3SK3A 1BISA 4JHDA 4LD0A 3AO1A 3H3OB 3OY9A 4PHTX 1Z6RA 2GUIA 1BOTO 5HRSA 1ESVA 1P8ZA 3O4QA 3O3FA 4IKFA 3SZ2A 3LDNA 4C8MA 3SI6A 3OYDA 5HLFA 3NF9A 3LZJA 3SJJA 3IS9A 1L3UA 3RMAA 2PAVA 1GOBA 2YJFA 4KTWA 4DTXA 4AHUA 3VQQA 5AQRA 3O9SA 1VQMN 1S1WA 3M3ZA 3CM5A 2QWQA 4DF8A 3K9KA 1NK6A 4DTMA 3ZSZA 5EOYA 2EHGA 4LSNA 4BRQA 2P51A 3F2KA 1SL1A 1C6VA 2YHWA 3WXJA 4MO5A 5C12A 3OS2A 2XRIA 3L4QA 3OYIA 4YOTA 3V6DA 2W41A 3L2WA 1YHQN 3OS0A 4K8ZA 4K0KK 3TI0A 3SUPA 1ZC6A 1RGIA 5F2RA 1KSPA 3PSIA 1HNXK 3H45C 5KTQA 1TYQA 1D9DA 2F9TA 3I33A 1GOCA 4FZZA 2QWLA 4BRAA 5AQTA 3NF8A 4WQ4A 1K73O 1T6CA 4BRDA 4FWLA 3RMDA 3OJSA 1T03A 1DGKN 3LAKA 1V4SA 4QS9A 1EWQA 2D0CA 3F73A 5F1XA 1QSSA 3VOVA 4GW6A 1X9WA 1TAQA 3KWGA 3UKRA 4QCLA 4FLZA 4FJHA 2Z1GA 4E1JA 2G8FA 4LSLA 3H1VX 1YVNA 3MX5A 3NGZA 4DG1A 4DFMA 3FR0A 4PQUA 2G8IA 3UIQA 3K5MA 1Y97A 3K58A 2PYLA 3AAQA 4KTZA 1BCOA 3I0SA 4FZYA 2QM1A 3QEWA 4NCAA 1ASUA 4Z4FA 1BWFO 3VTIA 4E1NA 3ZSQA 3DLHA 4BE1A 4KHQA 4JI7K 5AQYA 2YHXA 2I7PA 3BEXA 3F9KA 2ZQBA 4JI3K 3NAEA 2UUBK 1OVQA 1KLMA 3VF4A 4L8RB 4CJSA 1NBWA 5EVZA 1YTUA 3NFAA 4BC2A 4ISGA 2QWRA 1C1AA 1VSJA 2P9SB 4B9SA 3CC7N 4DLGA 3HI0A 2G8WA 1K9MO 3CCMN 4YY3K 1NG9A 3MXMA 1YJ9N 2YCHA 3NDKA 4V19S 4RTFD 3TTFA 4DV7K 5GAEP 2UYTA 2BGGA 3ZSRA 4ISEA 1ILYA 1NGCA 4CCHA 3FZFA 1RBUA 4OPJA 1BGXT 1L3TA 3SYZA 3AVIA 5C24A 3OW2M 3CPWM 3KLFA 1JLAA 2F8SA 3DLEA 3DMJA 2YX6A 4JI8K 4W5OA 4YDUC 3VPZA 4FJLA 2UUCK 1SL2A 4EZ6A 3EE9A 5AQLA 5KI6A 3PV8A 2RHKA 3KK2A 2OPPA 2E88A 4C1NI 4X62K 2WONA 3QIOA 3UKUA 3M8SA 3D2EB 5CYQA 3NH0A 3CERA 4YFUA 3TAQA 2QI2A 1A5VA 1VHXA 3GBTA 3DLLL 4CHYA 3TAEA 4DSKA 3CCSN 3MWPA 3C7NA 4CK2A 4FJGA 1QHTA 5HOOA 5JVGL 3WEEA 3ZETA 4LFCK 1JLQA 4DSEA 2W6LA 4I9QA 3AVFA 1W97L 3RR8A 4BREA 3SV3A 1XWLA 5AQSA 3MN6A 4BC5A 2JGUA 3ID6A 1ZBIA 4BGAA 2IVOA 5AZJB 4BVPA 2HNZA 3OBWA 4CEAA 2YKNA 1NKEA 2NRHA 3O80A 1RBVA 4FJ5A 1ZBUA 4JI5K 1C0GA 3NGYA 2F96A 4BACA 5DM7L 2QXLA 1C0TA 5E84A 4FWQA 1RTJA 1WSGA 1Y64A 2KZZA 5BRFA 3TAFA 5M1QA 3SUQA 1IJJA 5MLCQ 2ITMA 3VQ4A 3PLAA 1XHXA 3I56N 4CERA 1HKBA 4CZJA 3L2UA 4ZHRA 2Q97A 3M6GA 4DR2K 2NRTA 1U04A 4DSJA 2HVHA 4KAZA 3ZT0A 3QEPA 3E66A 1XQSC 3C6TA 1TKTA 3ATVA 4NLCA 1SAZA 3THWB 2BUPA 1HYSA 3HPHA 2O8FA 5FROA 2E2OA 3OYEA 5D3GA 3A5OC 3AVGA 2FBTA 3VEZA 3F9MA 4BQZA 3MEDA 4FPAA 4DV6K 4CHZA 1NWKA 4MLEA 3S9HA 5H1SQ 1RT1A 4O5FA 3PY8A 4GMJB 2CGKA 3VQPA 4A57A 1NLVA 4ELVA 4N56A 2WOMA 2P9UA 1O1WA 2OPRA 1HQEA 4LC9B 1YT3A 3IG1A 4LF6K 4KKOA 4EP4A 1HNWK 1NOZA 3AA3A 3PX6A 5J2QA 3OVNA 3KZBA 1S9EA 1J5EK 5AQQA 2AP1A 2KKZA 3AAPA 1X9JA 3I0RA 2Q3SA 4CFBA 2O8EB 3R3LA 5C2FA 4I2QA 3THXB 3S3MA 2F7TA 1NK4A 3HZ6A 2GWKA 4DV1K 4O55A 3CFOA 2E4LA 5C15A 3SCXA 1WSIA 3G4SN 3CCEN 3TSQA 3P4IA 3ZLJA 4FM0A 4BRIA 3KLGA 4M3YA 3WNFA 4E19A 3CXCM 2GBZA 4BR4A 2E2QA 2OZSA 4AF1A 4MLHA 5BPMA 4CESA 4A2BA 1S5JA 3V9XA 2UUAK 1VQNN 3CCUN 4AM6A 4CJWA 4KH4A 4GKKK 4DTPA 3HM8A 5KRTA 3S41A 4KREA 3CYMA 1TYQB 5F0XA 1QSYA 4BR2A 1DT9A 2O8CB 2DFEA 1LWFA 4Z4IA 4DR4K 3AVBA 3D45A 4CFCA 3FE1A 5GADP 5FLXO 3J81O 1T7PA 3RWUA 1LCUA 5C10A 2KFNA 1GLCG 2IVPA 5KPRA 2HHXA 3OHRA 3KD5E 3L4IA 2G8KA 3MAQA 1ASWA 3BF1A 3VEOA 4YNQA 2VWBA 3VQCA 4QOZB 4CZKA 5DK5A 1LAVA 3NHGA 3UKRB 3VQ7A 2ZM6K 2A40A 4JRPA 1HUXA 3IKMA 2W40A 3QNOA 2OTLN 1YJNN 3LANA 3HVRA 1HKCA 4CJVA 2WTUA 4DS5A 3WXMB 3ZSXA 5M1NA 3HBTA 2IOCA 5AQZA 5JLFA 4CGFA 1NMDA 5ADXH 1EQYA 4M7YA 1NGIA 3WUHA 2OCEA 3CC4N 4LF4K 2VQFK 2PY5A 3LDQA 5AQVA 4DTOA 3DLBA 2D0AA 1NGJA 4CD1A 5I9EB 2YI1A 1XNRK 3DXMA 4FPBA 3TTDA 4B3MK 3RMCA 3CCLN 2D1KA 3HPOA 4N47A 4ICLA 2WFBA 3P5JA 5JLHA 4DV4K 3C6AA 4M3RA 3SQ4A 1WSEA 4CJ5A 4JI4K 3P1GA 5E41A 4F3OA 1Z25A 4B1UB 4TSXA 1BL3A 4C23A 4WQ5A 1XC9A 1NGFA 2ASPA 5AQUA 3LALA 3TTCA 1U48A 1L3SA 1RBSA 3L0QA 3AO2A 5FDLA 4IFYA 2F8TA 5BR8K 3JS6A 4E7JA 4CFAA 1KAZA 3FFKB 2QWNA 1C0FA 1S6PA 4FJKA 3TABA 4FJ7A 3GOIA 1LAWA 3HXMA 4BVOA 3SPZA 3WNGA 5KGXA 2NRRA 3KK3A 4AH9A 1GLLO 2HHHK 2ZD1A 1BUPA 3LWLA 3KVGA 1HPMA 3E1YA 4HTUA 3V4IA 5AQIA 2YKMA 3NCIA 3T19A 4KTQA 4I9LA 4LFAK 1J9AA 4KB0A 1ZBFA 1UA1A 4LH4A 3EZWA 3KLIA 1U2VA 4B9VA 3AVLA 3IMXA 2A1RA 2Y1JA 3VF2A 1C0UA 1X9MA 1LV5A 3THYB 3QB0A 3LDLA 3C7NB 4B08A 4DR6K 5TKWA 2X6SA 2JWLA 1VSHA 2VWKA 4JI6K 2JWKA 4UQGA 1QQNA 1LW2A 3HPGA 2QWOA 3AVHA 4IBNA 4FM2A 3WT0A 3NBPA 1FJGK 2UXDK 3VF6A 4X66K 2G8HA 4I7FA 1LWCA 3QETA 2Q31A 1WB9A 4JKAA 3A5NC 5K14A 3VQDA 3CMAN 3S3NA 1IKVA 4CF0A 2HVIA 4DUYK 4JS4A 3EY1A 4OX9K 4JK7A 5GINA 2HNYA 4DR1K 1KXPA 2IIRA 1VSFA 1YF5L 4DV0K 4Z4GA 4CBXA 1HX1A 2FSKA 4B1ZA 3WXLA 4WCEL 4M3TA 4AHVA 4CJRA 3EKUA 1BQNA 1JXBA 3CQXA 3V9ZA 1CXQA 1SUQA 2HW3A 3BZKA 3OBYA 1HMVA 4MDBA 1NGBA 3B8AX 1NKBA 1QQCA 3DWLA 3JXUA 1N5YA 2KHOA 2QW9A 1U4BA 1D5AA 2XY5A 1B9DA 4YHHK 3O9QA 4FK2A 1QS4A 2P9PA 2FLOA 1VK0A 2O4GA 4B1XB 4MDAA 2ZJQL 3OYJA 3CI5A 1YTAA 4DSLA 3VEXA 4N5SA 3M8PA 3D2FA 1OH8A 5BPLA 2D0BA 1MA9B 4DQIA 2ASOA 3HOTA 5LMNK 3KLHA 3AVCA 4EHUA 1KVAA 3FLCO 1BU6O 4NCGA 2XO7A 1TK8A 3AVMA 4JK9A 3CMEN 3OYBA 1C1BA 4R79A 4KH6A 1JL1A 5BREA 3CIPA 2P9LA 4DU3A 4FJ9A 3PUFA 2CGJA 1QVGM 3G10A 5FRMA 4C8KA 3AY9A 2V52B 1V4TA 3QEVA 3TARA 3K59A 1IBLK 1VSIA 1QZ6A 2OA8A 3T1HK 3CD6N 5AR0A 1BI4A 2QEXN 3P38A 3O08A 5HROA 4CZEA 1RTIA 3AGRA 1KAXA 1HNIA 3KKSA 4CF8A 1UOCA 4NYNA 4O0JA 5BPNA 3OTOK 4KPYA 1S22A 5ELZA 5BN8A 3AA5X 3EN9A 2KW4A 3L8BA 4DFKA 4FWSA 2ZJPL 4DTUA 4FWKA 1W9HA 1SS6A 2D0OA 4RW9A 2HSTA 1K8KA 3H08A 4BR0A 3VA0A 4FWRA 2GEMA 2HMIA 5HP1A 4CEFA 4DS4A 3KJVA 3PX4A 2E8AA 1IBMK 3VQBA 4FLXA 1HQUA 4DQSA 3DXKB 4DTJA 4OLAA 4A5AA 3OJUA 3AGKA 4HUGA 3BGRA 3ZX2A 4OJRA 1KTQA 3R1XA 1CLQA 4EHTA 2NUBA 1RDUA 2IS3A 2RKIA 2XY7A 1A5WA 3IUCA 2BDPA 3PIOL 3VENA 3MXIA 3JSMA 2PZSA 1VAZA 2HHTA 1T44A 1VRTA 2FC0A 3LPUA 4BR9A 1KVCA 1YJWN 3QBWA 1S1TA 2NRWA 4B1WB 4OPAA 3MN5A 1J5OA 4DU4A 4DCHA 3MN9A 4J2EA 2E20A 1I39A 3M8RA 3DLGA 3NVKA 1DLOA 4JEPA 1VSLA 3J8AA 3ZEUA 4M41A 3ZT4A 2P9KA 4Z4EA 5J2PA 4FXDA 1JJ2M 4O0IA 1EP4A 2A6AA 1T6DA 3QFUA 2YHAA 5E26A 4CHNA 4CJ7A 4Q5VA 4E7KA 1D9FA 4IFVA 5BRHA 4U7BA 4H0OA 4QAGA 1HKGA 4YOVA 4PKIA 3TANA 3EKSA 4OLBA 1XI1A 2IAJA 1QTMA 1NJIO 3L3VA 4JD2A 5LJWA 5ADXA 4O5BA 1VQ5N 5AZIA 3MWTA 4PL8A 3B6OA 4QS8A 2E1YA 4BG8A 3QIPA 1OH5A 4RWTA 4I2PA 2BE2A 4Z4CA 3OYAA 3SPYA 1KQSM 3RSEA 3H3NO 2QTDA 3KIOA 3O9TA 4PKGA 3SQ1A 3ZX3A 4M3XA 4IJNA 5EU7A 1W7AA 2QKBA 2P9NA 2KTQA 4KO0A 3O3GA 3ZCMA 3GE1A 3FZMA 1BCMA 2D0PA 3BDPA 3Q7CA 1JLEA 3VQ8A 3HO1A 3FZHA 3KHYA 4IDKA 4WE1A 4XH5A 3O5BA 3DRSA 4JRQA 1BIUA 4GV6A 3TAMA 1KFSA 3N4QA 3HT3A 3AVJA 5AQFA 2VCPA 1HJOA 4FW2A 3DAWA 3MK6A 1KFDA 1NM1A 3OYHA 4FYDA 4BRNA 1TKDA 3M1FA 4CZLA 1GOAA 4RW6A 1N36K 3OYGA 4PA1A 3VMFB 5HL7L 2ETJA 4IJAA 4DFJA 3LDOA 5FPEA 1CZBA 5AQWA 3J7AP 4BROA 3CFPA 1NK5A 1KC8O 4YDUA 3CCJN 2HHUA 1RT2A 5LY3A 1D4XA 1RILA 4GVMA 5M1FA 3VQ6A 4OKKA 2IC3A 1VQ9N 4H0TB 1U2VB 4BRHA 2VWJA 3H1QA 4IWVA 4LY7A 4DV3K 5CZ1A 3V9UA 1JCGA 3BZCA 4BWMA 3M5RA 4IDHA 4DQQA 4JLHA 4LH5A 4I6MB 1FW6A 3SV4A 4B8CA 1IKYA 3TWHA 2FBVA 1UAXA 5CR4A 3LAMA 1HJRA 4YOWA 3NF6A 4JKGB 4JAXA 1NK8A 4HCCA 1BA1A 3HTVA 5C2DA 1OH7A 4EP5A 4H5VA 1OKJA 1TGOA 3SBGA 3DOKA 3MCPA 5AFUH 3T1YK 2O8BB 5HBMA 1WBDA 1XNQK 4JYAK 3V81A 4FOIA 1WSFA 3AV9A 5C25A 1J6ZA 4CGJA 2QKKA 1J53A 1NJZA 3CJ1A 3DRPA 4AHCA 3SMSA 2XY8A 4OGCA 4F2RA 4BWJA 1W0HA 3AVAA 4DR7K 3HP9A 4JHDB 2WBNA 3ZT2A 1S1XA 4CD3A 4QS7A 4DTNA 3O1BA 1VQ8N 1D8YA 1T3VA 2FF6A 4CVNE 2NRZA 4CJLA 5HRPA 2DTUA 1LW0A 4B8AB 4M3UA 1I3AA 1VSKA 3G0ZA 4CGHA 4M45A 1RFQA 4O8KA 4M42A 1ZBHA 3VETA 1RDBA 4KHWA 5AQPA 4UY8O 3O4NA 1QZ5A 1VQ6N 1MU2A 4JKDA 3L2QA 2G8UA 4LF8K 1SV5A 4DSIA 1EXQA 1N33K 1LWEA 1TKZA 2HHWA 1ATNA 4H5RA 3HSCA 5KPZA 1FXXA 2P5OA 4NCBA 2A1SA 5J1EA 3AA2A 4FK0A 4DV2K 2HBJA 3EO3A 2P9IA 3PSFA 4BDZA 3HVTA 1NJYA 1VQ4N 3KD1E 2YNHA 1WAFA 5KQ8A 5KRSA 4W5QA 3QFPA 1XC3A 2ITGA 4GVEA 1RT5A 3QO9A 5GAHP 2JLEA 3E01A 2E1ZA 1NGGA 1HLUA 3KWIA 3LM9A 5JS1A 3LP1A 4ISFA 5A2QO 4XIUA 2NRVA 4CK3A 1FKOA 1NJXA 4HUFA 1XHZA 5KGWA 2FSNA 3ZSVA 5I42A 2E2NA 5CHIA 4WYBA 4CHOA 4H4MA 3D6RA 4B9UA 3I55N 4CI6A 3DRRA 3E9PA 4IO9L 2VG5A 2P9SA 3T69A 5JICA 3DM2A 4FK4A 4XH4A 2H3GX 4FVUA 1RNHA 4NB4A 4BRCA 4J8FA 3VERA 3AARA 1NOYA 4CEDA 2P1JA 4Y0WA 4FLTA 2YHBA 3VQEA 3OS1A 3A2FA 4MQ3A 1H1VA 3C0BA 1TUUA 3ALYA 1Q7YO 1SZ2A 2OANA 4DFPA 3OYNA 3ASMA 3A8YA 4H03B 1CXUA 4B9LA 4W5RA 4CEZA 1TL1A 4FL9A 4A59A 3LWMA 5AQJA 4BR7A 4K42A 2OYQA 1EO1A 3G25A 5CYMA 2GWJA 4OKJA 3ZSWA 4B9NA 2NRXA 1REVA 1KRPA 4B3TK 2VQEK 3S3OA 3AO3A 4L3QA 2DY4A 4BRKA 4AHRA 3O1WA 1JLGA 3UE5A 1S6QA 3LDSA 4HCBA 5IWAK 1S1UA 4CJ3A 4YOUA 4CF1A 3NGIA 5AQHA 5AQOA 1KD1O 3BP8A 1N34K 4FCYA 1SL0A 2Q0UA 3D2EA 5C42A 4IO8A 4CW7B 2V7YA 3AVNA 3DOLA 3BY5A 4FJ8A 4E7LA 3MN7A 2R7YA 3KLEA 4F8RA 3LM2A 3HRGA 1Q18A 1YUWA 4CZHA 4K25A 1FKPA 4HVJA 3ZX0A 1WLJA 2VGNA 3ID8A 3PO4A 5CE3A 2B4JA 2CH5A 2OPQA 3GL1A 3EE8A 2P9KB 4A62A 4A2AA 4M3WA 1JCEA 4IFEA 4NO7A 1NGEA 4HUEA 4CZIA 4CZMA 2ZE2A 4FJJA 4CJKA 1HNVA 4BE2A 4FWMA 3E9OA 4JK8A 1RDWX 3JAMO 4FLVA 4GKJK 4JI0K 4E0DA 4DMNA 3W3DA 5AZJA 3LZIA 4JD2B 3TSUA 3UKUB 4BRPA 1K6YA 3CJCA 4BRFA 4H0PA 5T7BA 4BRLA 2Z1HA 3NH2A 5AZIB 4C8OA 2IDOA 4AILC 3VESA 5AQNA 3QERA 4XH1A 2VGMA 4BQLA 3EL2A 2W6KA 1ZBLA 3R8EA 3GDQA 4IOXA 4CGDA 3V1RA 3WEEB 5LMUK 3ZETB 1RBTA 4A5BA 1QQOA 1MWKA 4CJUA 4R5PA 2OTJN 3U8XA 4M7XA 3SQ2A 3CC2N 3CCQN 3U3YA 3O8MA 4B3OA 3PX0A 2O4IA 2WC9A 4YORA 2X6NA 5FRNA 2BANA 4IXCA 4NLBA 1HNZK 2NZTA 3ENBA 2RE2A 1KCFA 3RRGA 3CF5L 4BGBA 4ID5A 3TSPA 4BR5A 1N32K 2PYJA 4BE0A 3LP3A 4BRGA 2HOEA 4J2DA 2A3ZA 4DB3A 2UXCK 4FWOA 4B9QA 3CCRN 2HHQA 1ZXOA 3DJCA 1TK5A 3ENHA 1DTTA 4X65K 4JKBA 3MEGA 4JKHA 3T7ZA 3HJFA 1ATRA 1NNEA 4KHSA 1JKHA 4EFHA 4CZGA 4WQ4C 4Z94A 1TK0A 4KV8A 1MDUB 3L6QA 3WNEA 3DYAA 1T05A 4AHTA 1UA0A 4H5NA 3QMLA 3QICA 3NMUA 1RTHA 4DSFA 3V9SA 2O8FB 2D4WA 3QDKA 4GV3A 2O8EA 1GLBG 3NH1A 1QHAA 1RT7A 3C95A 3THXA 3I8BA 3U6FA 1TKXA 4YOYA 4CJQA 1Z05A 5AFUA 1RDAA 5KQDA 1CZ9A 4U67L 1R0AA 2E5LK 2HF3A 3G6EN 2P9UB 4ID1A 3SQ0A 4ZTJA 2OPSA 3WNHA 3OYKA 4LF9K 1WSJA 4N76A 1OH6A 1U6ZA 3B6PA 2LSNA 4ILGB 3ULDA 3HP6A 1R59O 2YNGA 2B5JA 1MWMA 4B9MA 1XMOK 1VRUA 1GLJO 1ZYQA 1NK7A 1IKXA 4BDPA 4F3TA 3SBTA 4JS5A 3QEXA 1A5XA 3W0LA 4DV5K 2O8CA 3HSTB 4O4GA 3C65A 3FFIA 4LF7K 3L2RA 3QBXA 3T3FA 2FF3B 2CH6A 3CQ8A 3P31A 3THVA 2GELA 2YNIA 3ITHA 2VYPA 5SWMA 4DUZK 3ZT1A 2HHSA 2OZMA 2ATQA 4JI2K 3SJHA 3VEYA 1N8RO 3ISNC 3F5TA 2P9IB 1IG8A 4EIAA 5IT9O 1WN7A 4WF9L 2KLAA 4BDYA 2QXFA 1BO5O 1M90O 3V1QA 4DLEA 3ULEA 4WFBL 1L5UA 3WXKA 2DFHA 1C1CA 4KFBA 4H8KA 3OYCA 3ZYYX 4JKEA 1Q9YA 2QWPA 5LJVA 1ASVA 4FSVA 3RRHA 4CIEA 4RW7A 1Q8IA 3CG7A 2Q36A 1FK9A 1YAGA 1JLFA 1VQON 5M1OA 3N4PA 5J2MA 1WOQA 3J7YP 1IKWA 4K43A 4Y1CA 1G15A 4F9OA 2HHVA 4KBOA 2HBKA 1NJWA 3A5MC 2O8DA 1TUYA 4DTRA 3PIPL 5FPDA 5BRDA 2GV9A 4F2SA 1IO2A 3D0PA 3K9JA 3O3HA 5AQXA 4PL7A 4ELTA 1NK0A 4CFDA 4J2AA 4CEOA 2XY6A 3A0IX 1T8EA 1KLNA 1DEJA 1YVUA 4MFBA 4BG9A 2A5XA 3QLHA 1TL3A 5B8HA 3OYMA 1NGAA 3IDHA 2GX9A 4ILJA 2HNDA 4XEIA 4CZFA 1RBRA 4BC4A 3KK7A 3P39A 2YV0X 3IFRA 4KHNA 4CHQA 1DKGD 4G1QA 1WUAA 4EAHD 1EETA 1KVBA 1NKCA 3DXMB 4E7IA 1E4GT 4FWPA 2RPIA 4CJ4A 4K8XA 2Z1JA 2ZWHA 3VQ5A 3TAPA 3RMBA 4KB1A 4DHYA 4A61A 3C94A 4FLUA 4B3SK 1RTDA 5BN9A 1BDGA 1U45A 2WUSA 1HYZA 4FJNA 2GTDA 4ZTFA 5GIPA 4CGIA 5SZTA 5HRNA 4FO0A 4KHUA 3THYA 4C8NA 3O9UA 3PO5A 3CPEA 4OKEA 3SAFA 1Q81O 1NGDA 3J7ZO 1W2BM 4CE9A 1O13A 4F4KA 4OGEA 2YNFA 3MCAB 4O44A 1X3NA 1BIZA 4JN4A 3MDQA 3O9RA 1BHLA 3RVCA 3VN5A 2HMPA 1I94K 3MEEA 4CEEA 4H0VB 2F9WA 4J2BA 1U49A 2W42A 3OYLA 1B92A 1QSLA 3T1AA 4CBWA 1RT4A 4G9ZA 4CJFA 4DTSA 4M63C 1TV6A 3NE6A 1RT3A 2B6AA 4IEIA 4H5WA 4CJEA 1YI2N 2QK9A 2VG7A 3FZLA 5AQKA 4E3SA 4PKHA 4EZ9A 1SQKA 5GAGP 5JVHL 3DLRA 4FW1A 3V1OA 1WAJA 4IEEA 3C6HA 4IG0A 1BG3A 5DMRA 2E6LA 2PBDA 5JMVA 4PY5A 4W5NA 2G8VA 1TVRA 4RCHA 3SMPA 2DPNA 2J4RA 4RW8A 4MO4A 2XHBA 1N6QA 3K2PA 4O8UA 1JL2A 1VSDA 2E6MA 3CCVN 2UXBK 3K5NA 3TU5A 3SAGA 1XUPO 2HBLA 4CF9A 3CJ7A 2ASMA 4KHYA 3ENOA 3JYTA 1NK9A 4OO1J 4CEQA 3HL8A 3D7EO 3SAHA 4KH5A 2X74A 3Q7BA 4H0YB 4Q0BA 2EX3A 2IVNA 1WSHA 1YXQA 3VGMA 3ZSOA 4E89A 4BY9C 2AJQA 4NXMK 1F21A 4FLWA 3WQUA 2A42A 3MXJA 2PFUA 3CM6A 4CJTA 3LPTA 3IAYA 2D5RA 3DI6A 3U9ZA 4CIGA 1X1PA 1YITN 1WBBA 5GIOA 2HBMA 4DQ8A 3I8DA 2Q0RA 1GLFO 4DWIA 4CK1A 2P9PB 1HR0K 2IGIA 3IRXA 1E4FT 4HWIA 3H46O 1IG9A 1Z26A 2CGLA 2NLXA 5AJ3K 3D2FB 3LP0A 4DQPA 1YIJN 1VQLN 2Y1IA 4FM1A 4GV9A 2HB5A 4JNEA 4FJIA 1QE1A 4GY2B 4IOAL 1TAUA 1UWBA 3BUZB 4JI1K 4DF4A 2YJEA 4M3ZA 1XMQK
chains in the Genus database with same CATH topology
3MECA 4CK2A 1VSMA 5J2NA 4FJGA 4CECA 4FLVA 3QEVA 4IG3A 3TARA 1QHTA 3K59A 4E0DA 4DMNA 1VSIA 2OA8A 3AA4A 3LZIA 1BI4A 1JLQA 4DSEA 3QEIA 3EZ5A 1K6YA 4I9QA 5T7BA 3AVFA 5HROA 2Z1HA 1RTIA 3VQAA 3NH2A 1ITGA 4C8OA 3RR8A 2IDOA 4AILC 1HNIA 3DLKA 3SV3A 3KKSA 3QERA 4CF8A 1XWLA 4RG8A 1EX4A 1UOCA 4NYNA 4O0JA 4Y1DA 4KPYA 2Z1IA 4CF2A 4HHTA 1ZBLA 4CJPA 2JGUA 2RF2A 4CGDA 1ZBIA 3V1RA 3AA5X 1S9GA 3OYFA 4NYFA 2HNZA 1BI4B 1RBTA 1J54A 2YKNA 4CEAA 1NKEA 2KW4A 3L8BA 4CJUA 4R5PA 1RBVA 4DFKA 4FJXA 4FJ5A 4DTUA 1ZBUA 3NF7A 1W9HA 3HO1A 4RW9A 3P83D 3SQ2A 1EKEA 3RTVA 3U3YA 3LP2A 3NGYA 4B9TA 3H08A 4B3OA 3VA0A 2F96A 3PX0A 2O4IA 4BACA 2HMIA 5HP1A 3KKRA 4H4OA 4KI6A 2X6NA 4CEFA 5FRNA 4DS4A 3RR7A 3KJVA 2BANA 1C0TA 3PX4A 3VQ9A 3VQBA 3K57A 4FLXA 1HQUA 4DQSA 1RTJA 4DTJA 1WSGA 4OLAA 5CY4A 2KZZA 1KCFA 3RRGA 3TAFA 3SUQA 3OJUA 1C0MA 4ID5A 4HUGA 3BGRA 4OJRA 3SUNA 1SKRA 1KTQA 2PYJA 2DFFA 3LP3A 2RN2A 4BE0A 4J2DA 1CLQA 3VQ4A 2NUBA 1JXEA 1XHXA 4CERA 3L2VA 2IS3A 2RKIA 3L2UA 4ZHRA 2XY7A 1A5WA 2BDPA 1U04A 3QESA 1RDCA 4DSJA 2HVHA 3MXIA 2HHQA 3JSMA 2PZSA 4KAZA 3ZT0A 5I3UA 1X9SA 1TK5A 1VRTA 2FC0A 3QEPA 3LPUA 2HHTA 5CZ2A 1KVCA 2X78A 1DTTA 1S1TA 3C6TA 1TKTA 3MEGA 3HJFA 1B9FA 1DTQA 4KHSA 1JKHA 1S1VA 3HPHA 1HYSA 5FROA 1J5OA 5HRRA 4DU4A 1TK0A 4J2EA 1I39A 3OYEA 3M8RA 4KV8A 3DLGA 5D3GA 5JS2A 3WNEA 1U47A 1DLOA 3AVGA 2FBTA 3EYZA 3DYAA 1T05A 4AHTA 3MEDA 1VSLA 4CHZA 3ZT4A 4M41A 3KK1A 3S9HA 1UA0A 4N41A 5J2PA 4Z4EA 3HK2A 4FXDA 4CIFA 1RT1A 4O0IA 1EP4A 3PY8A 4GMJB 3VQPA 2YHAA 1RTHA 4ELVA 4DSFA 4CHNA 4N56A 2WOMA 4OPKA 4Q5VA 4E7KA 1D9FA 4IFVA 3C6UA 3V9SA 3VA3A 1O1WA 2OPRA 1HQEA 4W5TA 4PWDA 4QAGA 1YT3A 3NH1A 3IG1A 4DQRA 4KKOA 4EP4A 3TANA 1NOZA 3AA3A 4OLBA 3HYFA 1RT7A 3C95A 2IAJA 1XI1A 1QTMA 3U6FA 5J2QA 1TKXA 3L3VA 3OVNA 3PX6A 3SNNA 1S9EA 4CJQA 2VG6A 1RDAA 5JS1A 1CZ9A 4O5BA 3V9WA 3L3UA 2FBYA 2I5JA 3HM9A 3B6OA 1R0AA 3ZSYA 3I0RA 3QIPA 4Z4HA 4E1MA 3OYAA 4I2PA 2BE2A 3K5OA 4Z4CA 3SPYA 4ID1A 3SQ0A 2Q3SA 4ZTJA 3KIOA 2OPSA 4CFBA 3WNHA 3OYKA 1WSJA 3SQ1A 4N76A 4M3XA 2KFZA 5EU7A 4FJMA 3B6PA 2LSNA 3ULDA 3HP6A 4I2QA 2QKBA 3S3MA 4C8LA 2KTQA 1NK4A 1RT6A 2YNGA 4KO0A 2B5JA 3O3GA 4O55A 3ZCMA 2KZMA 3CFOA 2E4LA 4DU1A 3SCXA 1WSIA 1BCMA 4B9MA 1IH7A 3BDPA 3KTQA 1VRUA 1SKWA 3VQ8A 1JLEA 1HPZA 1JLCA 1ZYQA 1IKXA 4IDKA 4WE1A 4JRQA 1NK7A 4JS5A 4BDPA 3DRSA 4F3TA 3QEXA 4CGGA 1A5XA 1BIUA 3AVKA 3QINA 3KLGA 4FM0A 3TAMA 4M3YA 1KFSA 4FVMA 3TR8A 3HSTB 3HT3A 3WNFA 4O4GA 3AVJA 4E19A 2GBZA 3FFIA 1RCHA 4FLYA 3QNNA 3L2RA 4FW2A 3T3FA 2OZSA 3CQ8A 4PUOA 1KFDA 3OYHA 1RDDA 4CESA 4FYDA 3THVA 1SKSA 1TKDA 2YNIA 1S5JA 3ITHA 3V9XA 5SWMA 1GOAA 4CJWA 4Z0UA 1Q9XA 4RW6A 3SUOA 3OYGA 4E7HA 3ZT1A 2HHSA 4PA1A 2OZMA 4DTPA 5KRTA 2ATQA 2ETJA 4KREA 4DFJA 3ISNC 3CYMA 1QSYA 1CZBA 2DFEA 1BQMA 1LWFA 4Z4IA 1NK5A 3CFPA 4ELUA 1WN7A 1JLBA 3AVBA 4BDYA 2QXFA 3D45A 2HHUA 1RT2A 4CFCA 4KI4A 3AO5A 1T7PA 1VSEA 3M8QA 1RILA 3RWUA 3ZT3A 4FZXC 4GVMA 3V1QA 4DLEA 2P5GA 1L5UA 3VQ6A 2KFNA 4OKKA 2KQ2A 4CEBA 2DFHA 1C1CA 2IC3A 4KFBA 4OVLA 4H8KA 3U3GA 3OYCA 1Q9YA 3KD5E 2HHXA 2VWJA 1WNSA 1ASVA 1L3VA 2G8KA 3MAQA 1ASWA 4LY7A 3RRHA 4CIEA 3AO4A 4RW7A 5CZ1A 4YNQA 1Q8IA 3CG7A 3V9UA 3VQCA 4BWMA 3CFRA 4QOZB 5DK5A 1LAVA 3NHGA 1HYVA 3K5LA 4KRFA 1FK9A 4DQQA 1JLFA 2FBXA 4JLHA 4LH5A 4RW4A 3VQ7A 4JRPA 4AHSA 5J2MA 3SV4A 4B8CA 1IKYA 3TAGA 4CHPA 3TWHA 2FBVA 1UAXA 1HRHA 1IKWA 4Y1CA 1G15A 3QNOA 3LAMA 2HHVA 1HJRA 3LANA 1NJWA 1BISA 3NF6A 4LD0A 3HVRA 3AO1A 1NK8A 4HCCA 4DTRA 4CJVA 3OY9A 4DS5A 4EP5A 1TGOA 2GUIA 3ZSXA 2GV9A 3DOKA 5HRSA 4F2SA 1IO2A 3D0PA 2IOCA 3O3HA 3O4QA 4CGFA 3O3FA 4IKFA 5HBMA 3SZ2A 4C8MA 3SI6A 3OYDA 2PY5A 3V81A 4ELTA 5HLFA 4CFDA 3NF9A 4DTOA 3LZJA 1NK0A 1QSSA 1WSFA 3AV9A 4CEOA 4CGJA 2D0AA 5C25A 2XY6A 2QKKA 4J2AA 1J53A 1NJZA 3SJJA 3DRPA 4AHCA 1T8EA 3IS9A 1KLNA 2XY8A 1YVUA 4OGCA 4F2RA 4BWJA 1W0HA 3AVAA 4MFBA 3HP9A 3QLHA 3OYMA 1TL3A 3ZT2A 3RMAA 1L3UA 1GOBA 1S1XA 3RMCA 4DTNA 2HNDA 3HPOA 4N47A 4ICLA 4KTWA 1D8YA 4DTXA 1RBRA 3P5JA 2YV0X 4AHUA 3VQQA 4CJLA 1S1WA 4M3RA 3SQ4A 3CM5A 1WSEA 4CJ5A 4KHNA 4DF8A 5HRPA 1NK6A 4DTMA 3ZSZA 3P1GA 1LW0A 4B8AB 5E41A 4M3UA 2DTUA 4F3OA 1I3AA 1Z25A 4CHQA 1VSKA 4G1QA 2EHGA 1BL3A 3G0ZA 4TSXA 4LSNA 4M45A 1EETA 4CGHA 1KVBA 1XC9A 2P51A 4M42A 1SL1A 3LALA 4E7IA 1NKCA 1ZBHA 4CJ4A 1C6VA 1RDBA 2RPIA 1U48A 4KHWA 4K8XA 3O4NA 1L3SA 2Z1JA 1RBSA 3AO2A 3OS2A 5FDLA 1MU2A 3VQ5A 2XRIA 4IFYA 3OYIA 3L2QA 2G8UA 3V6DA 3TAPA 2F8TA 1SV5A 3RMBA 4DSIA 4E7JA 3L2WA 4KB1A 4CFAA 1EXQA 1S6PA 3OS0A 3C94A 4FLUA 4FJKA 4K8ZA 1RTDA 3TABA 1LWEA 4FJ7A 1TKZA 2HHWA 1LAWA 3HXMA 1U45A 3TI0A 3SUPA 1HYZA 4FJNA 4ZTFA 1KSPA 1FXXA 4CGIA 5SZTA 2P5OA 3SPZA 4NCBA 2A1SA 5J1EA 3AA2A 3WNGA 5HRNA 5KGXA 3KK3A 5KTQA 4FK0A 4AH9A 4KHUA 4C8NA 1D9DA 2ZD1A 3LWLA 4BDZA 1GOCA 3HVTA 1NJYA 4HTUA 3V4IA 4FZZA 3KD1E 2YNHA 3PO5A 2YKMA 1WAFA 3NCIA 5KRSA 3T19A 3NF8A 4W5QA 4KTQA 4I9LA 2ITGA 4OKEA 3RMDA 3OJSA 1J9AA 1RT5A 1T03A 1ZBFA 4KB0A 3QO9A 1UA1A 4LH4A 3KLIA 4CE9A 3LAKA 2JLEA 4B9VA 4F4KA 3E01A 2D0CA 4OGEA 3AVLA 3F73A 2YNFA 2Y1JA 2A1RA 1C0UA 3LP1A 4GW6A 1X9WA 1X9MA 1LV5A 4O44A 1TAQA 1BIZA 4QCLA 4FLZA 4FJHA 1BHLA 4B08A 2X6SA 3VN5A 4XIUA 2Z1GA 1VSHA 3MEEA 2G8FA 4LSLA 2VWKA 4CEEA 4J2BA 4CK3A 1U49A 3NGZA 2W42A 1FKOA 1B92A 4DG1A 3OYLA 1QSLA 4UQGA 1NJXA 4HUFA 1XHZA 4DFMA 4PQUA 1LW2A 5KGWA 3ZSVA 3HPGA 3T1AA 3AVHA 2G8IA 3TAEA 4IBNA 1RT4A 4FM2A 5I42A 3NBPA 4CJFA 3UIQA 3K5MA 4CHOA 4DTSA 1Y97A 3K58A 2G8HA 2PYLA 1TV6A 1LWCA 4H4MA 4I7FA 3QETA 3NE6A 4B9UA 1RT3A 2B6AA 3DRRA 4CJEA 5K14A 2VG5A 2QK9A 2VG7A 4KTZA 3VQDA 1BCOA 3S3NA 1IKVA 3I0SA 4CF0A 3DM2A 4E3SA 4FZYA 3QEWA 4EZ9A 1ASUA 4JS4A 4NCAA 4FK4A 3EY1A 2HVIA 4Z4FA 3DLRA 4FW1A 1RNHA 3V1OA 4E1NA 3ZSQA 3DLHA 1WAJA 2HNYA 4BE1A 1VSFA 4IG0A 4KHQA 4Z4GA 1NOYA 3F9KA 5DMRA 2E6LA 2P1JA 2ZQBA 4CEDA 4PY5A 4FLTA 3NAEA 4W5NA 2YHBA 3VQEA 3OS1A 1KLMA 3A2FA 2G8VA 1TVRA 4MQ3A 4CJSA 4AHVA 4L8RB 4M3TA 4CJRA 1YTUA 4RW8A 1BQNA 3ALYA 3NFAA 3K2PA 1JXBA 2XHBA 4DFPA 1N6QA 3OYNA 3ASMA 1JL2A 1VSDA 2E6MA 1C1AA 3V9ZA 3K5NA 1VSJA 1CXQA 4B9SA 1CXUA 1SUQA 4W5RA 4CF9A 4B9LA 2HW3A 4CEZA 4DLGA 1TL1A 2G8WA 1HMVA 3LWMA 4KHYA 1NK9A 3JYTA 1NKBA 1QQCA 4CEQA 2OYQA 1N5YA 5CYMA 3MXMA 3HL8A 4OKJA 2X74A 3ZSWA 1U4BA 1D5AA 1REVA 1B9DA 2XY5A 4B9NA 4Q0BA 3NDKA 2EX3A 1KRPA 1WSHA 3S3OA 3AO3A 2DY4A 4AHRA 4FK2A 1JLGA 1QS4A 2BGGA 3DLBA 1S6QA 1VK0A 3LDSA 3ZSOA 4E89A 4HCBA 2O4GA 3ZSRA 2AJQA 1S1UA 3OYJA 1F21A 4FLWA 1YTAA 4CJ3A 4CCHA 3MXJA 4CF1A 1RBUA 3CM6A 4CJTA 3LPTA 4N5SA 3NGIA 4OPJA 4DSLA 3M8PA 1BGXT 1L3TA 4FCYA 3SYZA 3IAYA 2D5RA 3AVIA 5C24A 1SL0A 5C42A 3DI6A 3AVNA 3DOLA 2D0BA 3KLFA 4CIGA 1JLAA 1X1PA 2F8SA 3DLEA 3DMJA 4FJ8A 4E7LA 4DQIA 4W5OA 3I8DA 2R7YA 3KLEA 4F8RA 4FJLA 1SL2A 4EZ6A 4DWIA 3KLHA 4CK1A 3AVCA 1KVAA 1FKPA 2IGIA 3IRXA 5KI6A 4HVJA 3PV8A 4NCGA 2OPPA 3KK2A 2XO7A 1TK8A 1WLJA 3AVMA 1IG9A 4BE2A 2WONA 1Z26A 3PO4A 3QIOA 3OYBA 1C1BA 2B4JA 1JL1A 2OPQA 3LP0A 3M8SA 4DQPA 4DU3A 4FJ9A 5CYQA 3NH0A 4FM1A 3PUFA 2Y1IA 4YFUA 2HB5A 3TAQA 4M3WA 1A5VA 1QE1A 4FJIA 1TAUA 1UWBA 3G10A 5FRMA 4C8KA 4CHYA 4HUEA 4DF4A 4M3ZA 2ZE2A 4FJJA 4CJKA 1HNVA 4DSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEC A;  4CK2 A;  1VSM A;  5J2N A;  4FJG A;  4CEC A;  4FLV A;  3QEV A;  4IG3 A;  3TAR A;  1QHT A;  3K59 A;  4E0D A;  4DMN A;  1VSI A;  2OA8 A;  3AA4 A;  3LZI A;  1BI4 A;  1JLQ A;  4DSE A;  3QEI A;  3EZ5 A;  1K6Y A;  4I9Q A;  5T7B A;  3AVF A;  5HRO A;  2Z1H A;  1RTI A;  3VQA A;  3NH2 A;  1ITG A;  4C8O A;  3RR8 A;  2IDO A;  4AIL C;  1HNI A;  3DLK A;  3SV3 A;  3KKS A;  3QER A;  4CF8 A;  1XWL A;  4RG8 A;  1EX4 A;  1UOC A;  4NYN A;  4O0J A;  4Y1D A;  4KPY A;  2Z1I A;  4CF2 A;  4HHT A;  1ZBL A;  4CJP A;  2JGU A;  2RF2 A;  4CGD A;  1ZBI A;  3V1R A;  3AA5 X;  1S9G A;  3OYF A;  4NYF A;  2HNZ A;  1BI4 B;  1RBT A;  1J54 A;  2YKN A;  4CEA A;  1NKE A;  2KW4 A;  3L8B A;  4CJU A;  4R5P A;  1RBV A;  4DFK A;  4FJX A;  4FJ5 A;  4DTU A;  1ZBU A;  3NF7 A;  1W9H A;  3HO1 A;  4RW9 A;  3P83 D;  3SQ2 A;  1EKE A;  3RTV A;  3U3Y A;  3LP2 A;  3NGY A;  4B9T A;  3H08 A;  4B3O A;  3VA0 A;  2F96 A;  3PX0 A;  2O4I A;  4BAC A;  2HMI A;  5HP1 A;  3KKR A;  4H4O A;  4KI6 A;  2X6N A;  4CEF A;  5FRN A;  4DS4 A;  3RR7 A;  3KJV A;  2BAN A;  1C0T A;  3PX4 A;  3VQ9 A;  3VQB A;  3K57 A;  4FLX A;  1HQU A;  4DQS A;  1RTJ A;  4DTJ A;  1WSG A;  4OLA A;  5CY4 A;  2KZZ A;  1KCF A;  3RRG A;  3TAF A;  3SUQ A;  3OJU A;  1C0M A;  4ID5 A;  4HUG A;  3BGR A;  4OJR A;  3SUN A;  1SKR A;  1KTQ A;  2PYJ A;  2DFF A;  3LP3 A;  2RN2 A;  4BE0 A;  4J2D A;  1CLQ A;  3VQ4 A;  2NUB A;  1JXE A;  1XHX A;  4CER A;  3L2V A;  2IS3 A;  2RKI A;  3L2U A;  4ZHR A;  2XY7 A;  1A5W A;  2BDP A;  1U04 A;  3QES A;  1RDC A;  4DSJ A;  2HVH A;  3MXI A;  2HHQ A;  3JSM A;  2PZS A;  4KAZ A;  3ZT0 A;  5I3U A;  1X9S A;  1TK5 A;  1VRT A;  2FC0 A;  3QEP A;  3LPU A;  2HHT A;  5CZ2 A;  1KVC A;  2X78 A;  1DTT A;  1S1T A;  3C6T A;  1TKT A;  3MEG A;  3HJF A;  1B9F A;  1DTQ A;  4KHS A;  1JKH A;  1S1V A;  3HPH A;  1HYS A;  5FRO A;  1J5O A;  5HRR A;  4DU4 A;  1TK0 A;  4J2E A;  1I39 A;  3OYE A;  3M8R A;  4KV8 A;  3DLG A;  5D3G A;  5JS2 A;  3WNE A;  1U47 A;  1DLO A;  3AVG A;  2FBT A;  3EYZ A;  3DYA A;  1T05 A;  4AHT A;  3MED A;  1VSL A;  4CHZ A;  3ZT4 A;  4M41 A;  3KK1 A;  3S9H A;  1UA0 A;  4N41 A;  5J2P A;  4Z4E A;  3HK2 A;  4FXD A;  4CIF A;  1RT1 A;  4O0I A;  1EP4 A;  3PY8 A;  4GMJ B;  3VQP A;  2YHA A;  1RTH A;  4ELV A;  4DSF A;  4CHN A;  4N56 A;  2WOM A;  4OPK A;  4Q5V A;  4E7K A;  1D9F A;  4IFV A;  3C6U A;  3V9S A;  3VA3 A;  1O1W A;  2OPR A;  1HQE A;  4W5T A;  4PWD A;  4QAG A;  1YT3 A;  3NH1 A;  3IG1 A;  4DQR A;  4KKO A;  4EP4 A;  3TAN A;  1NOZ A;  3AA3 A;  4OLB A;  3HYF A;  1RT7 A;  3C95 A;  2IAJ A;  1XI1 A;  1QTM A;  3U6F A;  5J2Q A;  1TKX A;  3L3V A;  3OVN A;  3PX6 A;  3SNN A;  1S9E A;  4CJQ A;  2VG6 A;  1RDA A;  5JS1 A;  1CZ9 A;  4O5B A;  3V9W A;  3L3U A;  2FBY A;  2I5J A;  3HM9 A;  3B6O A;  1R0A A;  3ZSY A;  3I0R A;  3QIP A;  4Z4H A;  4E1M A;  3OYA A;  4I2P A;  2BE2 A;  3K5O A;  4Z4C A;  3SPY A;  4ID1 A;  3SQ0 A;  2Q3S A;  4ZTJ A;  3KIO A;  2OPS A;  4CFB A;  3WNH A;  3OYK A;  1WSJ A;  3SQ1 A;  4N76 A;  4M3X A;  2KFZ A;  5EU7 A;  4FJM A;  3B6P A;  2LSN A;  3ULD A;  3HP6 A;  4I2Q A;  2QKB A;  3S3M A;  4C8L A;  2KTQ A;  1NK4 A;  1RT6 A;  2YNG A;  4KO0 A;  2B5J A;  3O3G A;  4O55 A;  3ZCM A;  2KZM A;  3CFO A;  2E4L A;  4DU1 A;  3SCX A;  1WSI A;  1BCM A;  4B9M A;  1IH7 A;  3BDP A;  3KTQ A;  1VRU A;  1SKW A;  3VQ8 A;  1JLE A;  1HPZ A;  1JLC A;  1ZYQ A;  1IKX A;  4IDK A;  4WE1 A;  4JRQ A;  1NK7 A;  4JS5 A;  4BDP A;  3DRS A;  4F3T A;  3QEX A;  4CGG A;  1A5X A;  1BIU A;  3AVK A;  3QIN A;  3KLG A;  4FM0 A;  3TAM A;  4M3Y A;  1KFS A;  4FVM A;  3TR8 A;  3HST B;  3HT3 A;  3WNF A;  4O4G A;  3AVJ A;  4E19 A;  2GBZ A;  3FFI A;  1RCH A;  4FLY A;  3QNN A;  3L2R A;  4FW2 A;  3T3F A;  2OZS A;  3CQ8 A;  4PUO A;  1KFD A;  3OYH A;  1RDD A;  4CES A;  4FYD A;  3THV A;  1SKS A;  1TKD A;  2YNI A;  1S5J A;  3ITH A;  3V9X A;  5SWM A;  1GOA A;  4CJW A;  4Z0U A;  1Q9X A;  4RW6 A;  3SUO A;  3OYG A;  4E7H A;  3ZT1 A;  2HHS A;  4PA1 A;  2OZM A;  4DTP A;  5KRT A;  2ATQ A;  2ETJ A;  4KRE A;  4DFJ A;  3ISN C;  3CYM A;  1QSY A;  1CZB A;  2DFE A;  1BQM A;  1LWF A;  4Z4I A;  1NK5 A;  3CFP A;  4ELU A;  1WN7 A;  1JLB A;  3AVB A;  4BDY A;  2QXF A;  3D45 A;  2HHU A;  1RT2 A;  4CFC A;  4KI4 A;  3AO5 A;  1T7P A;  1VSE A;  3M8Q A;  1RIL A;  3RWU A;  3ZT3 A;  4FZX C;  4GVM A;  3V1Q A;  4DLE A;  2P5G A;  1L5U A;  3VQ6 A;  2KFN A;  4OKK A;  2KQ2 A;  4CEB A;  2DFH A;  1C1C A;  2IC3 A;  4KFB A;  4OVL A;  4H8K A;  3U3G A;  3OYC A;  1Q9Y A;  3KD5 E;  2HHX A;  2VWJ A;  1WNS A;  1ASV A;  1L3V A;  2G8K A;  3MAQ A;  1ASW A;  4LY7 A;  3RRH A;  4CIE A;  3AO4 A;  4RW7 A;  5CZ1 A;  4YNQ A;  1Q8I A;  3CG7 A;  3V9U A;  3VQC A;  4BWM A;  3CFR A;  4QOZ B;  5DK5 A;  1LAV A;  3NHG A;  1HYV A;  3K5L A;  4KRF A;  1FK9 A;  4DQQ A;  1JLF A;  2FBX A;  4JLH A;  4LH5 A;  4RW4 A;  3VQ7 A;  4JRP A;  4AHS A;  5J2M A;  3SV4 A;  4B8C A;  1IKY A;  3TAG A;  4CHP A;  3TWH A;  2FBV A;  1UAX A;  1HRH A;  1IKW A;  4Y1C A;  1G15 A;  3QNO A;  3LAM A;  2HHV A;  1HJR A;  3LAN A;  1NJW A;  1BIS A;  3NF6 A;  4LD0 A;  3HVR A;  3AO1 A;  1NK8 A;  4HCC A;  4DTR A;  4CJV A;  3OY9 A;  4DS5 A;  4EP5 A;  1TGO A;  2GUI A;  3ZSX A;  2GV9 A;  3DOK A;  5HRS A;  4F2S A;  1IO2 A;  3D0P A;  2IOC A;  3O3H A;  3O4Q A;  4CGF A;  3O3F A;  4IKF A;  5HBM A;  3SZ2 A;  4C8M A;  3SI6 A;  3OYD A;  2PY5 A;  3V81 A;  4ELT A;  5HLF A;  4CFD A;  3NF9 A;  4DTO A;  3LZJ A;  1NK0 A;  1QSS A;  1WSF A;  3AV9 A;  4CEO A;  4CGJ A;  2D0A A;  5C25 A;  2XY6 A;  2QKK A;  4J2A A;  1J53 A;  1NJZ A;  3SJJ A;  3DRP A;  4AHC A;  1T8E A;  3IS9 A;  1KLN A;  2XY8 A;  1YVU A;  4OGC A;  4F2R A;  4BWJ A;  1W0H A;  3AVA A;  4MFB A;  3HP9 A;  3QLH A;  3OYM A;  1TL3 A;  3ZT2 A;  3RMA A;  1L3U A;  1GOB A;  1S1X A;  3RMC A;  4DTN A;  2HND A;  3HPO A;  4N47 A;  4ICL A;  4KTW A;  1D8Y A;  4DTX A;  1RBR A;  3P5J A;  2YV0 X;  4AHU A;  3VQQ A;  4CJL A;  1S1W A;  4M3R A;  3SQ4 A;  3CM5 A;  1WSE A;  4CJ5 A;  4KHN A;  4DF8 A;  5HRP A;  1NK6 A;  4DTM A;  3ZSZ A;  3P1G A;  1LW0 A;  4B8A B;  5E41 A;  4M3U A;  2DTU A;  4F3O A;  1I3A A;  1Z25 A;  4CHQ A;  1VSK A;  4G1Q A;  2EHG A;  1BL3 A;  3G0Z A;  4TSX A;  4LSN A;  4M45 A;  1EET A;  4CGH A;  1KVB A;  1XC9 A;  2P51 A;  4M42 A;  1SL1 A;  3LAL A;  4E7I A;  1NKC A;  1ZBH A;  4CJ4 A;  1C6V A;  1RDB A;  2RPI A;  1U48 A;  4KHW A;  4K8X A;  3O4N A;  1L3S A;  2Z1J A;  1RBS A;  3AO2 A;  3OS2 A;  5FDL A;  1MU2 A;  3VQ5 A;  2XRI A;  4IFY A;  3OYI A;  3L2Q A;  2G8U A;  3V6D A;  3TAP A;  2F8T A;  1SV5 A;  3RMB A;  4DSI A;  4E7J A;  3L2W A;  4KB1 A;  4CFA A;  1EXQ A;  1S6P A;  3OS0 A;  3C94 A;  4FLU A;  4FJK A;  4K8Z A;  1RTD A;  3TAB A;  1LWE A;  4FJ7 A;  1TKZ A;  2HHW A;  1LAW A;  3HXM A;  1U45 A;  3TI0 A;  3SUP A;  1HYZ A;  4FJN A;  4ZTF A;  1KSP A;  1FXX A;  4CGI A;  5SZT A;  2P5O A;  3SPZ A;  4NCB A;  2A1S A;  5J1E A;  3AA2 A;  3WNG A;  5HRN A;  5KGX A;  3KK3 A;  5KTQ A;  4FK0 A;  4AH9 A;  4KHU A;  4C8N A;  1D9D A;  2ZD1 A;  3LWL A;  4BDZ A;  1GOC A;  3HVT A;  1NJY A;  4HTU A;  3V4I A;  4FZZ A;  3KD1 E;  2YNH A;  3PO5 A;  2YKM A;  1WAF A;  3NCI A;  5KRS A;  3T19 A;  3NF8 A;  4W5Q A;  4KTQ A;  4I9L A;  2ITG A;  4OKE A;  3RMD A;  3OJS A;  1J9A A;  1RT5 A;  1T03 A;  1ZBF A;  4KB0 A;  3QO9 A;  1UA1 A;  4LH4 A;  3KLI A;  4CE9 A;  3LAK A;  2JLE A;  4B9V A;  4F4K A;  3E01 A;  2D0C A;  4OGE A;  3AVL A;  3F73 A;  2YNF A;  2Y1J A;  2A1R A;  1C0U A;  3LP1 A;  4GW6 A;  1X9W A;  1X9M A;  1LV5 A;  4O44 A;  1TAQ A;  1BIZ A;  4QCL A;  4FLZ A;  4FJH A;  1BHL A;  4B08 A;  2X6S A;  3VN5 A;  4XIU A;  2Z1G A;  1VSH A;  3MEE A;  2G8F A;  4LSL A;  2VWK A;  4CEE A;  4J2B A;  4CK3 A;  1U49 A;  3NGZ A;  2W42 A;  1FKO A;  1B92 A;  4DG1 A;  3OYL A;  1QSL A;  4UQG A;  1NJX A;  4HUF A;  1XHZ A;  4DFM A;  4PQU A;  1LW2 A;  5KGW A;  3ZSV A;  3HPG A;  3T1A A;  3AVH A;  2G8I A;  3TAE A;  4IBN A;  1RT4 A;  4FM2 A;  5I42 A;  3NBP A;  4CJF A;  3UIQ A;  3K5M A;  4CHO A;  4DTS A;  1Y97 A;  3K58 A;  2G8H A;  2PYL A;  1TV6 A;  1LWC A;  4H4M A;  4I7F A;  3QET A;  3NE6 A;  4B9U A;  1RT3 A;  2B6A A;  3DRR A;  4CJE A;  5K14 A;  2VG5 A;  2QK9 A;  2VG7 A;  4KTZ A;  3VQD A;  1BCO A;  3S3N A;  1IKV A;  3I0S A;  4CF0 A;  3DM2 A;  4E3S A;  4FZY A;  3QEW A;  4EZ9 A;  1ASU A;  4JS4 A;  4NCA A;  4FK4 A;  3EY1 A;  2HVI A;  4Z4F A;  3DLR A;  4FW1 A;  1RNH A;  3V1O A;  4E1N A;  3ZSQ A;  3DLH A;  1WAJ A;  2HNY A;  4BE1 A;  1VSF A;  4IG0 A;  4KHQ A;  4Z4G A;  1NOY A;  3F9K A;  5DMR A;  2E6L A;  2P1J A;  2ZQB A;  4CED A;  4PY5 A;  4FLT A;  3NAE A;  4W5N A;  2YHB A;  3VQE A;  3OS1 A;  1KLM A;  3A2F A;  2G8V A;  1TVR A;  4MQ3 A;  4CJS A;  4AHV A;  4L8R B;  4M3T A;  4CJR A;  1YTU A;  4RW8 A;  1BQN A;  3ALY A;  3NFA A;  3K2P A;  1JXB A;  2XHB A;  4DFP A;  1N6Q A;  3OYN A;  3ASM A;  1JL2 A;  1VSD A;  2E6M A;  1C1A A;  3V9Z A;  3K5N A;  1VSJ A;  1CXQ A;  4B9S A;  1CXU A;  1SUQ A;  4W5R A;  4CF9 A;  4B9L A;  2HW3 A;  4CEZ A;  4DLG A;  1TL1 A;  2G8W A;  1HMV A;  3LWM A;  4KHY A;  1NK9 A;  3JYT A;  1NKB A;  1QQC A;  4CEQ A;  2OYQ A;  1N5Y A;  5CYM A;  3MXM A;  3HL8 A;  4OKJ A;  2X74 A;  3ZSW A;  1U4B A;  1D5A A;  1REV A;  1B9D A;  2XY5 A;  4B9N A;  4Q0B A;  3NDK A;  2EX3 A;  1KRP A;  1WSH A;  3S3O A;  3AO3 A;  2DY4 A;  4AHR A;  4FK2 A;  1JLG A;  1QS4 A;  2BGG A;  3DLB A;  1S6Q A;  1VK0 A;  3LDS A;  3ZSO A;  4E89 A;  4HCB A;  2O4G A;  3ZSR A;  2AJQ A;  1S1U A;  3OYJ A;  1F21 A;  4FLW A;  1YTA A;  4CJ3 A;  4CCH A;  3MXJ A;  4CF1 A;  1RBU A;  3CM6 A;  4CJT A;  3LPT A;  4N5S A;  3NGI A;  4OPJ A;  4DSL A;  3M8P A;  1BGX T;  1L3T A;  4FCY A;  3SYZ A;  3IAY A;  2D5R A;  3AVI A;  5C24 A;  1SL0 A;  5C42 A;  3DI6 A;  3AVN A;  3DOL A;  2D0B A;  3KLF A;  4CIG A;  1JLA A;  1X1P A;  2F8S A;  3DLE A;  3DMJ A;  4FJ8 A;  4E7L A;  4DQI A;  4W5O A;  3I8D A;  2R7Y A;  3KLE A;  4F8R A;  4FJL A;  1SL2 A;  4EZ6 A;  4DWI A;  3KLH A;  4CK1 A;  3AVC A;  1KVA A;  1FKP A;  2IGI A;  3IRX A;  5KI6 A;  4HVJ A;  3PV8 A;  4NCG A;  2OPP A;  3KK2 A;  2XO7 A;  1TK8 A;  1WLJ A;  3AVM A;  1IG9 A;  4BE2 A;  2WON A;  1Z26 A;  3PO4 A;  3QIO A;  3OYB A;  1C1B A;  2B4J A;  1JL1 A;  2OPQ A;  3LP0 A;  3M8S A;  4DQP A;  4DU3 A;  4FJ9 A;  5CYQ A;  3NH0 A;  4FM1 A;  3PUF A;  2Y1I A;  4YFU A;  2HB5 A;  3TAQ A;  4M3W A;  1A5V A;  1QE1 A;  4FJI A;  1TAU A;  1UWB A;  3G10 A;  5FRM A;  4C8K A;  4CHY A;  4HUE A;  4DF4 A;  4M3Z A;  2ZE2 A;  4FJJ A;  4CJK A;  1HNV A;  4DSK A; 
#chains in the Genus database with same CATH topology
 3MEC A;  1IV0 A;  1VSM A;  3CJ9 A;  4H5T A;  5J2N A;  4CEC A;  2V7Z A;  4IG3 A;  5AQM A;  1S3X A;  4C1N K;  3GG4 A;  3AA4 A;  3BF3 A;  1JCF A;  2E2P A;  3EZ5 A;  3QEI A;  2P9L B;  5BR9 A;  3VTH A;  2NNW A;  3VQA A;  1E3M A;  1ITG A;  1K8A O;  4B1Y B;  3DLK A;  3WQT A;  4RG8 A;  1EX4 A;  3OA9 A;  4DR5 K;  4Y1D A;  2Z1I A;  4CF2 A;  4HHT A;  1NGH A;  4CJP A;  2RF2 A;  5LL6 Z;  4JKC A;  1Q82 O;  1S9G A;  3OYF A;  3DXK A;  4NYF A;  1BI4 B;  1J54 A;  3J80 O;  5DM6 L;  4FJX A;  3NF7 A;  3MMV A;  3P83 D;  1EKE A;  5EXW A;  3RTV A;  3LP2 A;  3U4L A;  4B9T A;  5C0Y A;  3FGU A;  3KKR A;  4H4O A;  4WQ5 C;  4KI6 A;  3VGL A;  3RR7 A;  1GLD G;  3VQ9 A;  2BTF A;  4JKF A;  4CBU A;  3K57 A;  2ZF5 O;  3ATU A;  5CY4 A;  3CJA A;  2A41 A;  4WFN L;  3TPQ A;  1C0M A;  2QWM A;  4ILH A;  3SUN A;  1SKR A;  2DFF A;  2RN2 A;  3HOS A;  4GNI A;  3UB5 A;  1K8K B;  1JXE A;  3L2V A;  4BC3 A;  4FOE A;  3QES A;  1RDC A;  3SLC A;  1X3M A;  4WFA L;  2QA4 N;  5M1P A;  4DR3 K;  5I3U A;  1X9S A;  5CZ2 A;  2X78 A;  1BA0 A;  4BRM A;  3ULE B;  1B9F A;  4DKW A;  1DTQ A;  1S1V A;  5HRR A;  1P90 A;  4YOX A;  2UU9 K;  5JS2 A;  1U47 A;  3EYZ A;  2ZJR L;  4OPH A;  4FWN A;  1KAY A;  3MX2 A;  4NXN K;  3KK1 A;  4N41 A;  3HK2 A;  4CIF A;  2O8D B;  2FSJ A;  4OPK A;  3C6U A;  3VA3 A;  1QQM A;  1M1K O;  4W5T A;  4PWD A;  1NU0 A;  4DQR A;  3VGK A;  3CQY A;  1CZA N;  1LOT B;  3HYF A;  2Q2R A;  3SNN A;  2VG6 A;  3ZEU B;  4LFB K;  3V9W A;  3L3U A;  2FBY A;  2I5J A;  2AA4 A;  3O6W A;  5EY4 A;  3HM9 A;  3ZSY A;  1VQK N;  4Z4H A;  1ZBS A;  4E1M A;  3K5O A;  3EEQ A;  3O4W A;  2FXU A;  2KFZ A;  3FZK A;  4FJM A;  1ATS A;  3G71 N;  2ZGY A;  4C8L A;  1RT6 A;  4JV5 K;  2Q1N A;  2KZM A;  3E9L A;  1EWR A;  4B3R K;  4DU1 A;  3NVM A;  1QVF M;  1IH7 A;  1GLA G;  2YHY A;  3U9D A;  3KTQ A;  1SKW A;  3A5L C;  4AQY K;  1JLC A;  1HPZ A;  4CGG A;  3AVK A;  3QIN A;  3RSE B;  4HTL A;  3LDP A;  5TKY A;  1G99 A;  1NMN A;  4FVM A;  3TR8 A;  1GLE G;  1OVY A;  2GUP A;  1VQ7 N;  4X64 K;  2I7N A;  5FPM A;  1RCH A;  4FLY A;  3QNN A;  2ZGZ A;  4B1V A;  1VQP N;  3K0S A;  3R6M A;  2P9N B;  2F4V K;  4PUO A;  1RDD A;  4K41 A;  1SKS A;  4AM7 A;  1Q9X A;  4Z0U A;  5M1K A;  3SUO A;  4E7H A;  2BH1 A;  4IZ9 A;  4LF5 K;  1IBK K;  2EWS A;  1BQM A;  4ELU A;  4I6M A;  1JLB A;  2HF4 A;  4KI4 A;  3AO5 A;  1VSE A;  3M8Q A;  3CET A;  3ZT3 A;  4FZX C;  4IOC L;  2P5G A;  3THW A;  3VEW A;  2KQ2 A;  4CEB A;  4KHP K;  4OVL A;  4JKG A;  3U3G A;  5AQG A;  3R9P A;  1L3V A;  1WNS A;  3WXI A;  3AO4 A;  2V51 B;  3CFR A;  5EX5 A;  1S72 N;  1HYV A;  5FPN A;  3K5L A;  4KRF A;  2O8B A;  2FBX A;  4RW4 A;  4H0X B;  4AHS A;  1Q86 O;  3CJB A;  5KPT A;  3CHW A;  4CHP A;  3TAG A;  1HRH A;  3VEV A;  3H6E A;  3LL3 A;  3SK3 A;  1BIS A;  4JHD A;  4LD0 A;  3AO1 A;  3H3O B;  3OY9 A;  4PHT X;  1Z6R A;  2GUI A;  1BOT O;  5HRS A;  1ESV A;  1P8Z A;  3O4Q A;  3O3F A;  4IKF A;  3SZ2 A;  3LDN A;  4C8M A;  3SI6 A;  3OYD A;  5HLF A;  3NF9 A;  3LZJ A;  3SJJ A;  3IS9 A;  1L3U A;  3RMA A;  2PAV A;  1GOB A;  2YJF A;  4KTW A;  4DTX A;  4AHU A;  3VQQ A;  5AQR A;  3O9S A;  1VQM N;  1S1W A;  3M3Z A;  3CM5 A;  2QWQ A;  4DF8 A;  3K9K A;  1NK6 A;  4DTM A;  3ZSZ A;  5EOY A;  2EHG A;  4LSN A;  4BRQ A;  2P51 A;  3F2K A;  1SL1 A;  1C6V A;  2YHW A;  3WXJ A;  4MO5 A;  5C12 A;  3OS2 A;  2XRI A;  3L4Q A;  3OYI A;  4YOT A;  3V6D A;  2W41 A;  3L2W A;  1YHQ N;  3OS0 A;  4K8Z A;  4K0K K;  3TI0 A;  3SUP A;  1ZC6 A;  1RGI A;  5F2R A;  1KSP A;  3PSI A;  1HNX K;  3H45 C;  5KTQ A;  1TYQ A;  1D9D A;  2F9T A;  3I33 A;  1GOC A;  4FZZ A;  2QWL A;  4BRA A;  5AQT A;  3NF8 A;  4WQ4 A;  1K73 O;  1T6C A;  4BRD A;  4FWL A;  3RMD A;  3OJS A;  1T03 A;  1DGK N;  3LAK A;  1V4S A;  4QS9 A;  1EWQ A;  2D0C A;  3F73 A;  5F1X A;  1QSS A;  3VOV A;  4GW6 A;  1X9W A;  1TAQ A;  3KWG A;  3UKR A;  4QCL A;  4FLZ A;  4FJH A;  2Z1G A;  4E1J A;  2G8F A;  4LSL A;  3H1V X;  1YVN A;  3MX5 A;  3NGZ A;  4DG1 A;  4DFM A;  3FR0 A;  4PQU A;  2G8I A;  3UIQ A;  3K5M A;  1Y97 A;  3K58 A;  2PYL A;  3AAQ A;  4KTZ A;  1BCO A;  3I0S A;  4FZY A;  2QM1 A;  3QEW A;  4NCA A;  1ASU A;  4Z4F A;  1BWF O;  3VTI A;  4E1N A;  3ZSQ A;  3DLH A;  4BE1 A;  4KHQ A;  4JI7 K;  5AQY A;  2YHX A;  2I7P A;  3BEX A;  3F9K A;  2ZQB A;  4JI3 K;  3NAE A;  2UUB K;  1OVQ A;  1KLM A;  3VF4 A;  4L8R B;  4CJS A;  1NBW A;  5EVZ A;  1YTU A;  3NFA A;  4BC2 A;  4ISG A;  2QWR A;  1C1A A;  1VSJ A;  2P9S B;  4B9S A;  3CC7 N;  4DLG A;  3HI0 A;  2G8W A;  1K9M O;  3CCM N;  4YY3 K;  1NG9 A;  3MXM A;  1YJ9 N;  2YCH A;  3NDK A;  4V19 S;  4RTF D;  3TTF A;  4DV7 K;  5GAE P;  2UYT A;  2BGG A;  3ZSR A;  4ISE A;  1ILY A;  1NGC A;  4CCH A;  3FZF A;  1RBU A;  4OPJ A;  1BGX T;  1L3T A;  3SYZ A;  3AVI A;  5C24 A;  3OW2 M;  3CPW M;  3KLF A;  1JLA A;  2F8S A;  3DLE A;  3DMJ A;  2YX6 A;  4JI8 K;  4W5O A;  4YDU C;  3VPZ A;  4FJL A;  2UUC K;  1SL2 A;  4EZ6 A;  3EE9 A;  5AQL A;  5KI6 A;  3PV8 A;  2RHK A;  3KK2 A;  2OPP A;  2E88 A;  4C1N I;  4X62 K;  2WON A;  3QIO A;  3UKU A;  3M8S A;  3D2E B;  5CYQ A;  3NH0 A;  3CER A;  4YFU A;  3TAQ A;  2QI2 A;  1A5V A;  1VHX A;  3GBT A;  3DLL L;  4CHY A;  3TAE A;  4DSK A;  3CCS N;  3MWP A;  3C7N A;  4CK2 A;  4FJG A;  1QHT A;  5HOO A;  5JVG L;  3WEE A;  3ZET A;  4LFC K;  1JLQ A;  4DSE A;  2W6L A;  4I9Q A;  3AVF A;  1W97 L;  3RR8 A;  4BRE A;  3SV3 A;  1XWL A;  5AQS A;  3MN6 A;  4BC5 A;  2JGU A;  3ID6 A;  1ZBI A;  4BGA A;  2IVO A;  5AZJ B;  4BVP A;  2HNZ A;  3OBW A;  4CEA A;  2YKN A;  1NKE A;  2NRH A;  3O80 A;  1RBV A;  4FJ5 A;  1ZBU A;  4JI5 K;  1C0G A;  3NGY A;  2F96 A;  4BAC A;  5DM7 L;  2QXL A;  1C0T A;  5E84 A;  4FWQ A;  1RTJ A;  1WSG A;  1Y64 A;  2KZZ A;  5BRF A;  3TAF A;  5M1Q A;  3SUQ A;  1IJJ A;  5MLC Q;  2ITM A;  3VQ4 A;  3PLA A;  1XHX A;  3I56 N;  4CER A;  1HKB A;  4CZJ A;  3L2U A;  4ZHR A;  2Q97 A;  3M6G A;  4DR2 K;  2NRT A;  1U04 A;  4DSJ A;  2HVH A;  4KAZ A;  3ZT0 A;  3QEP A;  3E66 A;  1XQS C;  3C6T A;  1TKT A;  3ATV A;  4NLC A;  1SAZ A;  3THW B;  2BUP A;  1HYS A;  3HPH A;  2O8F A;  5FRO A;  2E2O A;  3OYE A;  5D3G A;  3A5O C;  3AVG A;  2FBT A;  3VEZ A;  3F9M A;  4BQZ A;  3MED A;  4FPA A;  4DV6 K;  4CHZ A;  1NWK A;  4MLE A;  3S9H A;  5H1S Q;  1RT1 A;  4O5F A;  3PY8 A;  4GMJ B;  2CGK A;  3VQP A;  4A57 A;  1NLV A;  4ELV A;  4N56 A;  2WOM A;  2P9U A;  1O1W A;  2OPR A;  1HQE A;  4LC9 B;  1YT3 A;  3IG1 A;  4LF6 K;  4KKO A;  4EP4 A;  1HNW K;  1NOZ A;  3AA3 A;  3PX6 A;  5J2Q A;  3OVN A;  3KZB A;  1S9E A;  1J5E K;  5AQQ A;  2AP1 A;  2KKZ A;  3AAP A;  1X9J A;  3I0R A;  2Q3S A;  4CFB A;  2O8E B;  3R3L A;  5C2F A;  4I2Q A;  3THX B;  3S3M A;  2F7T A;  1NK4 A;  3HZ6 A;  2GWK A;  4DV1 K;  4O55 A;  3CFO A;  2E4L A;  5C15 A;  3SCX A;  1WSI A;  3G4S N;  3CCE N;  3TSQ A;  3P4I A;  3ZLJ A;  4FM0 A;  4BRI A;  3KLG A;  4M3Y A;  3WNF A;  4E19 A;  3CXC M;  2GBZ A;  4BR4 A;  2E2Q A;  2OZS A;  4AF1 A;  4MLH A;  5BPM A;  4CES A;  4A2B A;  1S5J A;  3V9X A;  2UUA K;  1VQN N;  3CCU N;  4AM6 A;  4CJW A;  4KH4 A;  4GKK K;  4DTP A;  3HM8 A;  5KRT A;  3S41 A;  4KRE A;  3CYM A;  1TYQ B;  5F0X A;  1QSY A;  4BR2 A;  1DT9 A;  2O8C B;  2DFE A;  1LWF A;  4Z4I A;  4DR4 K;  3AVB A;  3D45 A;  4CFC A;  3FE1 A;  5GAD P;  5FLX O;  3J81 O;  1T7P A;  3RWU A;  1LCU A;  5C10 A;  2KFN A;  1GLC G;  2IVP A;  5KPR A;  2HHX A;  3OHR A;  3KD5 E;  3L4I A;  2G8K A;  3MAQ A;  1ASW A;  3BF1 A;  3VEO A;  4YNQ A;  2VWB A;  3VQC A;  4QOZ B;  4CZK A;  5DK5 A;  1LAV A;  3NHG A;  3UKR B;  3VQ7 A;  2ZM6 K;  2A40 A;  4JRP A;  1HUX A;  3IKM A;  2W40 A;  3QNO A;  2OTL N;  1YJN N;  3LAN A;  3HVR A;  1HKC A;  4CJV A;  2WTU A;  4DS5 A;  3WXM B;  3ZSX A;  5M1N A;  3HBT A;  2IOC A;  5AQZ A;  5JLF A;  4CGF A;  1NMD A;  5ADX H;  1EQY A;  4M7Y A;  1NGI A;  3WUH A;  2OCE A;  3CC4 N;  4LF4 K;  2VQF K;  2PY5 A;  3LDQ A;  5AQV A;  4DTO A;  3DLB A;  2D0A A;  1NGJ A;  4CD1 A;  5I9E B;  2YI1 A;  1XNR K;  3DXM A;  4FPB A;  3TTD A;  4B3M K;  3RMC A;  3CCL N;  2D1K A;  3HPO A;  4N47 A;  4ICL A;  2WFB A;  3P5J A;  5JLH A;  4DV4 K;  3C6A A;  4M3R A;  3SQ4 A;  1WSE A;  4CJ5 A;  4JI4 K;  3P1G A;  5E41 A;  4F3O A;  1Z25 A;  4B1U B;  4TSX A;  1BL3 A;  4C23 A;  4WQ5 A;  1XC9 A;  1NGF A;  2ASP A;  5AQU A;  3LAL A;  3TTC A;  1U48 A;  1L3S A;  1RBS A;  3L0Q A;  3AO2 A;  5FDL A;  4IFY A;  2F8T A;  5BR8 K;  3JS6 A;  4E7J A;  4CFA A;  1KAZ A;  3FFK B;  2QWN A;  1C0F A;  1S6P A;  4FJK A;  3TAB A;  4FJ7 A;  3GOI A;  1LAW A;  3HXM A;  4BVO A;  3SPZ A;  3WNG A;  5KGX A;  2NRR A;  3KK3 A;  4AH9 A;  1GLL O;  2HHH K;  2ZD1 A;  1BUP A;  3LWL A;  3KVG A;  1HPM A;  3E1Y A;  4HTU A;  3V4I A;  5AQI A;  2YKM A;  3NCI A;  3T19 A;  4KTQ A;  4I9L A;  4LFA K;  1J9A A;  4KB0 A;  1ZBF A;  1UA1 A;  4LH4 A;  3EZW A;  3KLI A;  1U2V A;  4B9V A;  3AVL A;  3IMX A;  2A1R A;  2Y1J A;  3VF2 A;  1C0U A;  1X9M A;  1LV5 A;  3THY B;  3QB0 A;  3LDL A;  3C7N B;  4B08 A;  4DR6 K;  5TKW A;  2X6S A;  2JWL A;  1VSH A;  2VWK A;  4JI6 K;  2JWK A;  4UQG A;  1QQN A;  1LW2 A;  3HPG A;  2QWO A;  3AVH A;  4IBN A;  4FM2 A;  3WT0 A;  3NBP A;  1FJG K;  2UXD K;  3VF6 A;  4X66 K;  2G8H A;  4I7F A;  1LWC A;  3QET A;  2Q31 A;  1WB9 A;  4JKA A;  3A5N C;  5K14 A;  3VQD A;  3CMA N;  3S3N A;  1IKV A;  4CF0 A;  2HVI A;  4DUY K;  4JS4 A;  3EY1 A;  4OX9 K;  4JK7 A;  5GIN A;  2HNY A;  4DR1 K;  1KXP A;  2IIR A;  1VSF A;  1YF5 L;  4DV0 K;  4Z4G A;  4CBX A;  1HX1 A;  2FSK A;  4B1Z A;  3WXL A;  4WCE L;  4M3T A;  4AHV A;  4CJR A;  3EKU A;  1BQN A;  1JXB A;  3CQX A;  3V9Z A;  1CXQ A;  1SUQ A;  2HW3 A;  3BZK A;  3OBY A;  1HMV A;  4MDB A;  1NGB A;  3B8A X;  1NKB A;  1QQC A;  3DWL A;  3JXU A;  1N5Y A;  2KHO A;  2QW9 A;  1U4B A;  1D5A A;  2XY5 A;  1B9D A;  4YHH K;  3O9Q A;  4FK2 A;  1QS4 A;  2P9P A;  2FLO A;  1VK0 A;  2O4G A;  4B1X B;  4MDA A;  2ZJQ L;  3OYJ A;  3CI5 A;  1YTA A;  4DSL A;  3VEX A;  4N5S A;  3M8P A;  3D2F A;  1OH8 A;  5BPL A;  2D0B A;  1MA9 B;  4DQI A;  2ASO A;  3HOT A;  5LMN K;  3KLH A;  3AVC A;  4EHU A;  1KVA A;  3FLC O;  1BU6 O;  4NCG A;  2XO7 A;  1TK8 A;  3AVM A;  4JK9 A;  3CME N;  3OYB A;  1C1B A;  4R79 A;  4KH6 A;  1JL1 A;  5BRE A;  3CIP A;  2P9L A;  4DU3 A;  4FJ9 A;  3PUF A;  2CGJ A;  1QVG M;  3G10 A;  5FRM A;  4C8K A;  3AY9 A;  2V52 B;  1V4T A;  3QEV A;  3TAR A;  3K59 A;  1IBL K;  1VSI A;  1QZ6 A;  2OA8 A;  3T1H K;  3CD6 N;  5AR0 A;  1BI4 A;  2QEX N;  3P38 A;  3O08 A;  5HRO A;  4CZE A;  1RTI A;  3AGR A;  1KAX A;  1HNI A;  3KKS A;  4CF8 A;  1UOC A;  4NYN A;  4O0J A;  5BPN A;  3OTO K;  4KPY A;  1S22 A;  5ELZ A;  5BN8 A;  3AA5 X;  3EN9 A;  2KW4 A;  3L8B A;  4DFK A;  4FWS A;  2ZJP L;  4DTU A;  4FWK A;  1W9H A;  1SS6 A;  2D0O A;  4RW9 A;  2HST A;  1K8K A;  3H08 A;  4BR0 A;  3VA0 A;  4FWR A;  2GEM A;  2HMI A;  5HP1 A;  4CEF A;  4DS4 A;  3KJV A;  3PX4 A;  2E8A A;  1IBM K;  3VQB A;  4FLX A;  1HQU A;  4DQS A;  3DXK B;  4DTJ A;  4OLA A;  4A5A A;  3OJU A;  3AGK A;  4HUG A;  3BGR A;  3ZX2 A;  4OJR A;  1KTQ A;  3R1X A;  1CLQ A;  4EHT A;  2NUB A;  1RDU A;  2IS3 A;  2RKI A;  2XY7 A;  1A5W A;  3IUC A;  2BDP A;  3PIO L;  3VEN A;  3MXI A;  3JSM A;  2PZS A;  1VAZ A;  2HHT A;  1T44 A;  1VRT A;  2FC0 A;  3LPU A;  4BR9 A;  1KVC A;  1YJW N;  3QBW A;  1S1T A;  2NRW A;  4B1W B;  4OPA A;  3MN5 A;  1J5O A;  4DU4 A;  4DCH A;  3MN9 A;  4J2E A;  2E20 A;  1I39 A;  3M8R A;  3DLG A;  3NVK A;  1DLO A;  4JEP A;  1VSL A;  3J8A A;  3ZEU A;  4M41 A;  3ZT4 A;  2P9K A;  4Z4E A;  5J2P A;  4FXD A;  1JJ2 M;  4O0I A;  1EP4 A;  2A6A A;  1T6D A;  3QFU A;  2YHA A;  5E26 A;  4CHN A;  4CJ7 A;  4Q5V A;  4E7K A;  1D9F A;  4IFV A;  5BRH A;  4U7B A;  4H0O A;  4QAG A;  1HKG A;  4YOV A;  4PKI A;  3TAN A;  3EKS A;  4OLB A;  1XI1 A;  2IAJ A;  1QTM A;  1NJI O;  3L3V A;  4JD2 A;  5LJW A;  5ADX A;  4O5B A;  1VQ5 N;  5AZI A;  3MWT A;  4PL8 A;  3B6O A;  4QS8 A;  2E1Y A;  4BG8 A;  3QIP A;  1OH5 A;  4RWT A;  4I2P A;  2BE2 A;  4Z4C A;  3OYA A;  3SPY A;  1KQS M;  3RSE A;  3H3N O;  2QTD A;  3KIO A;  3O9T A;  4PKG A;  3SQ1 A;  3ZX3 A;  4M3X A;  4IJN A;  5EU7 A;  1W7A A;  2QKB A;  2P9N A;  2KTQ A;  4KO0 A;  3O3G A;  3ZCM A;  3GE1 A;  3FZM A;  1BCM A;  2D0P A;  3BDP A;  3Q7C A;  1JLE A;  3VQ8 A;  3HO1 A;  3FZH A;  3KHY A;  4IDK A;  4WE1 A;  4XH5 A;  3O5B A;  3DRS A;  4JRQ A;  1BIU A;  4GV6 A;  3TAM A;  1KFS A;  3N4Q A;  3HT3 A;  3AVJ A;  5AQF A;  2VCP A;  1HJO A;  4FW2 A;  3DAW A;  3MK6 A;  1KFD A;  1NM1 A;  3OYH A;  4FYD A;  4BRN A;  1TKD A;  3M1F A;  4CZL A;  1GOA A;  4RW6 A;  1N36 K;  3OYG A;  4PA1 A;  3VMF B;  5HL7 L;  2ETJ A;  4IJA A;  4DFJ A;  3LDO A;  5FPE A;  1CZB A;  5AQW A;  3J7A P;  4BRO A;  3CFP A;  1NK5 A;  1KC8 O;  4YDU A;  3CCJ N;  2HHU A;  1RT2 A;  5LY3 A;  1D4X A;  1RIL A;  4GVM A;  5M1F A;  3VQ6 A;  4OKK A;  2IC3 A;  1VQ9 N;  4H0T B;  1U2V B;  4BRH A;  2VWJ A;  3H1Q A;  4IWV A;  4LY7 A;  4DV3 K;  5CZ1 A;  3V9U A;  1JCG A;  3BZC A;  4BWM A;  3M5R A;  4IDH A;  4DQQ A;  4JLH A;  4LH5 A;  4I6M B;  1FW6 A;  3SV4 A;  4B8C A;  1IKY A;  3TWH A;  2FBV A;  1UAX A;  5CR4 A;  3LAM A;  1HJR A;  4YOW A;  3NF6 A;  4JKG B;  4JAX A;  1NK8 A;  4HCC A;  1BA1 A;  3HTV A;  5C2D A;  1OH7 A;  4EP5 A;  4H5V A;  1OKJ A;  1TGO A;  3SBG A;  3DOK A;  3MCP A;  5AFU H;  3T1Y K;  2O8B B;  5HBM A;  1WBD A;  1XNQ K;  4JYA K;  3V81 A;  4FOI A;  1WSF A;  3AV9 A;  5C25 A;  1J6Z A;  4CGJ A;  2QKK A;  1J53 A;  1NJZ A;  3CJ1 A;  3DRP A;  4AHC A;  3SMS A;  2XY8 A;  4OGC A;  4F2R A;  4BWJ A;  1W0H A;  3AVA A;  4DR7 K;  3HP9 A;  4JHD B;  2WBN A;  3ZT2 A;  1S1X A;  4CD3 A;  4QS7 A;  4DTN A;  3O1B A;  1VQ8 N;  1D8Y A;  1T3V A;  2FF6 A;  4CVN E;  2NRZ A;  4CJL A;  5HRP A;  2DTU A;  1LW0 A;  4B8A B;  4M3U A;  1I3A A;  1VSK A;  3G0Z A;  4CGH A;  4M45 A;  1RFQ A;  4O8K A;  4M42 A;  1ZBH A;  3VET A;  1RDB A;  4KHW A;  5AQP A;  4UY8 O;  3O4N A;  1QZ5 A;  1VQ6 N;  1MU2 A;  4JKD A;  3L2Q A;  2G8U A;  4LF8 K;  1SV5 A;  4DSI A;  1EXQ A;  1N33 K;  1LWE A;  1TKZ A;  2HHW A;  1ATN A;  4H5R A;  3HSC A;  5KPZ A;  1FXX A;  2P5O A;  4NCB A;  2A1S A;  5J1E A;  3AA2 A;  4FK0 A;  4DV2 K;  2HBJ A;  3EO3 A;  2P9I A;  3PSF A;  4BDZ A;  3HVT A;  1NJY A;  1VQ4 N;  3KD1 E;  2YNH A;  1WAF A;  5KQ8 A;  5KRS A;  4W5Q A;  3QFP A;  1XC3 A;  2ITG A;  4GVE A;  1RT5 A;  3QO9 A;  5GAH P;  2JLE A;  3E01 A;  2E1Z A;  1NGG A;  1HLU A;  3KWI A;  3LM9 A;  5JS1 A;  3LP1 A;  4ISF A;  5A2Q O;  4XIU A;  2NRV A;  4CK3 A;  1FKO A;  1NJX A;  4HUF A;  1XHZ A;  5KGW A;  2FSN A;  3ZSV A;  5I42 A;  2E2N A;  5CHI A;  4WYB A;  4CHO A;  4H4M A;  3D6R A;  4B9U A;  3I55 N;  4CI6 A;  3DRR A;  3E9P A;  4IO9 L;  2VG5 A;  2P9S A;  3T69 A;  5JIC A;  3DM2 A;  4FK4 A;  4XH4 A;  2H3G X;  4FVU A;  1RNH A;  4NB4 A;  4BRC A;  4J8F A;  3VER A;  3AAR A;  1NOY A;  4CED A;  2P1J A;  4Y0W A;  4FLT A;  2YHB A;  3VQE A;  3OS1 A;  3A2F A;  4MQ3 A;  1H1V A;  3C0B A;  1TUU A;  3ALY A;  1Q7Y O;  1SZ2 A;  2OAN A;  4DFP A;  3OYN A;  3ASM A;  3A8Y A;  4H03 B;  1CXU A;  4B9L A;  4W5R A;  4CEZ A;  1TL1 A;  4FL9 A;  4A59 A;  3LWM A;  5AQJ A;  4BR7 A;  4K42 A;  2OYQ A;  1EO1 A;  3G25 A;  5CYM A;  2GWJ A;  4OKJ A;  3ZSW A;  4B9N A;  2NRX A;  1REV A;  1KRP A;  4B3T K;  2VQE K;  3S3O A;  3AO3 A;  4L3Q A;  2DY4 A;  4BRK A;  4AHR A;  3O1W A;  1JLG A;  3UE5 A;  1S6Q A;  3LDS A;  4HCB A;  5IWA K;  1S1U A;  4CJ3 A;  4YOU A;  4CF1 A;  3NGI A;  5AQH A;  5AQO A;  1KD1 O;  3BP8 A;  1N34 K;  4FCY A;  1SL0 A;  2Q0U A;  3D2E A;  5C42 A;  4IO8 A;  4CW7 B;  2V7Y A;  3AVN A;  3DOL A;  3BY5 A;  4FJ8 A;  4E7L A;  3MN7 A;  2R7Y A;  3KLE A;  4F8R A;  3LM2 A;  3HRG A;  1Q18 A;  1YUW A;  4CZH A;  4K25 A;  1FKP A;  4HVJ A;  3ZX0 A;  1WLJ A;  2VGN A;  3ID8 A;  3PO4 A;  5CE3 A;  2B4J A;  2CH5 A;  2OPQ A;  3GL1 A;  3EE8 A;  2P9K B;  4A62 A;  4A2A A;  4M3W A;  1JCE A;  4IFE A;  4NO7 A;  1NGE A;  4HUE A;  4CZI A;  4CZM A;  2ZE2 A;  4FJJ A;  4CJK A;  1HNV A;  4BE2 A;  4FWM A;  3E9O A;  4JK8 A;  1RDW X;  3JAM O;  4FLV A;  4GKJ K;  4JI0 K;  4E0D A;  4DMN A;  3W3D A;  5AZJ A;  3LZI A;  4JD2 B;  3TSU A;  3UKU B;  4BRP A;  1K6Y A;  3CJC A;  4BRF A;  4H0P A;  5T7B A;  4BRL A;  2Z1H A;  3NH2 A;  5AZI B;  4C8O A;  2IDO A;  4AIL C;  3VES A;  5AQN A;  3QER A;  4XH1 A;  2VGM A;  4BQL A;  3EL2 A;  2W6K A;  1ZBL A;  3R8E A;  3GDQ A;  4IOX A;  4CGD A;  3V1R A;  3WEE B;  5LMU K;  3ZET B;  1RBT A;  4A5B A;  1QQO A;  1MWK A;  4CJU A;  4R5P A;  2OTJ N;  3U8X A;  4M7X A;  3SQ2 A;  3CC2 N;  3CCQ N;  3U3Y A;  3O8M A;  4B3O A;  3PX0 A;  2O4I A;  2WC9 A;  4YOR A;  2X6N A;  5FRN A;  2BAN A;  4IXC A;  4NLB A;  1HNZ K;  2NZT A;  3ENB A;  2RE2 A;  1KCF A;  3RRG A;  3CF5 L;  4BGB A;  4ID5 A;  3TSP A;  4BR5 A;  1N32 K;  2PYJ A;  4BE0 A;  3LP3 A;  4BRG A;  2HOE A;  4J2D A;  2A3Z A;  4DB3 A;  2UXC K;  4FWO A;  4B9Q A;  3CCR N;  2HHQ A;  1ZXO A;  3DJC A;  1TK5 A;  3ENH A;  1DTT A;  4X65 K;  4JKB A;  3MEG A;  4JKH A;  3T7Z A;  3HJF A;  1ATR A;  1NNE A;  4KHS A;  1JKH A;  4EFH A;  4CZG A;  4WQ4 C;  4Z94 A;  1TK0 A;  4KV8 A;  1MDU B;  3L6Q A;  3WNE A;  3DYA A;  1T05 A;  4AHT A;  1UA0 A;  4H5N A;  3QML A;  3QIC A;  3NMU A;  1RTH A;  4DSF A;  3V9S A;  2O8F B;  2D4W A;  3QDK A;  4GV3 A;  2O8E A;  1GLB G;  3NH1 A;  1QHA A;  1RT7 A;  3C95 A;  3THX A;  3I8B A;  3U6F A;  1TKX A;  4YOY A;  4CJQ A;  1Z05 A;  5AFU A;  1RDA A;  5KQD A;  1CZ9 A;  4U67 L;  1R0A A;  2E5L K;  2HF3 A;  3G6E N;  2P9U B;  4ID1 A;  3SQ0 A;  4ZTJ A;  2OPS A;  3WNH A;  3OYK A;  4LF9 K;  1WSJ A;  4N76 A;  1OH6 A;  1U6Z A;  3B6P A;  2LSN A;  4ILG B;  3ULD A;  3HP6 A;  1R59 O;  2YNG A;  2B5J A;  1MWM A;  4B9M A;  1XMO K;  1VRU A;  1GLJ O;  1ZYQ A;  1NK7 A;  1IKX A;  4BDP A;  4F3T A;  3SBT A;  4JS5 A;  3QEX A;  1A5X A;  3W0L A;  4DV5 K;  2O8C A;  3HST B;  4O4G A;  3C65 A;  3FFI A;  4LF7 K;  3L2R A;  3QBX A;  3T3F A;  2FF3 B;  2CH6 A;  3CQ8 A;  3P31 A;  3THV A;  2GEL A;  2YNI A;  3ITH A;  2VYP A;  5SWM A;  4DUZ K;  3ZT1 A;  2HHS A;  2OZM A;  2ATQ A;  4JI2 K;  3SJH A;  3VEY A;  1N8R O;  3ISN C;  3F5T A;  2P9I B;  1IG8 A;  4EIA A;  5IT9 O;  1WN7 A;  4WF9 L;  2KLA A;  4BDY A;  2QXF A;  1BO5 O;  1M90 O;  3V1Q A;  4DLE A;  3ULE A;  4WFB L;  1L5U A;  3WXK A;  2DFH A;  1C1C A;  4KFB A;  4H8K A;  3OYC A;  3ZYY X;  4JKE A;  1Q9Y A;  2QWP A;  5LJV A;  1ASV A;  4FSV A;  3RRH A;  4CIE A;  4RW7 A;  1Q8I A;  3CG7 A;  2Q36 A;  1FK9 A;  1YAG A;  1JLF A;  1VQO N;  5M1O A;  3N4P A;  5J2M A;  1WOQ A;  3J7Y P;  1IKW A;  4K43 A;  4Y1C A;  1G15 A;  4F9O A;  2HHV A;  4KBO A;  2HBK A;  1NJW A;  3A5M C;  2O8D A;  1TUY A;  4DTR A;  3PIP L;  5FPD A;  5BRD A;  2GV9 A;  4F2S A;  1IO2 A;  3D0P A;  3K9J A;  3O3H A;  5AQX A;  4PL7 A;  4ELT A;  1NK0 A;  4CFD A;  4J2A A;  4CEO A;  2XY6 A;  3A0I X;  1T8E A;  1KLN A;  1DEJ A;  1YVU A;  4MFB A;  4BG9 A;  2A5X A;  3QLH A;  1TL3 A;  5B8H A;  3OYM A;  1NGA A;  3IDH A;  2GX9 A;  4ILJ A;  2HND A;  4XEI A;  4CZF A;  1RBR A;  4BC4 A;  3KK7 A;  3P39 A;  2YV0 X;  3IFR A;  4KHN A;  4CHQ A;  1DKG D;  4G1Q A;  1WUA A;  4EAH D;  1EET A;  1KVB A;  1NKC A;  3DXM B;  4E7I A;  1E4G T;  4FWP A;  2RPI A;  4CJ4 A;  4K8X A;  2Z1J A;  2ZWH A;  3VQ5 A;  3TAP A;  3RMB A;  4KB1 A;  4DHY A;  4A61 A;  3C94 A;  4FLU A;  4B3S K;  1RTD A;  5BN9 A;  1BDG A;  1U45 A;  2WUS A;  1HYZ A;  4FJN A;  2GTD A;  4ZTF A;  5GIP A;  4CGI A;  5SZT A;  5HRN A;  4FO0 A;  4KHU A;  3THY A;  4C8N A;  3O9U A;  3PO5 A;  3CPE A;  4OKE A;  3SAF A;  1Q81 O;  1NGD A;  3J7Z O;  1W2B M;  4CE9 A;  1O13 A;  4F4K A;  4OGE A;  2YNF A;  3MCA B;  4O44 A;  1X3N A;  1BIZ A;  4JN4 A;  3MDQ A;  3O9R A;  1BHL A;  3RVC A;  3VN5 A;  2HMP A;  1I94 K;  3MEE A;  4CEE A;  4H0V B;  2F9W A;  4J2B A;  1U49 A;  2W42 A;  3OYL A;  1B92 A;  1QSL A;  3T1A A;  4CBW A;  1RT4 A;  4G9Z A;  4CJF A;  4DTS A;  4M63 C;  1TV6 A;  3NE6 A;  1RT3 A;  2B6A A;  4IEI A;  4H5W A;  4CJE A;  1YI2 N;  2QK9 A;  2VG7 A;  3FZL A;  5AQK A;  4E3S A;  4PKH A;  4EZ9 A;  1SQK A;  5GAG P;  5JVH L;  3DLR A;  4FW1 A;  3V1O A;  1WAJ A;  4IEE A;  3C6H A;  4IG0 A;  1BG3 A;  5DMR A;  2E6L A;  2PBD A;  5JMV A;  4PY5 A;  4W5N A;  2G8V A;  1TVR A;  4RCH A;  3SMP A;  2DPN A;  2J4R A;  4RW8 A;  4MO4 A;  2XHB A;  1N6Q A;  3K2P A;  4O8U A;  1JL2 A;  1VSD A;  2E6M A;  3CCV N;  2UXB K;  3K5N A;  3TU5 A;  3SAG A;  1XUP O;  2HBL A;  4CF9 A;  3CJ7 A;  2ASM A;  4KHY A;  3ENO A;  3JYT A;  1NK9 A;  4OO1 J;  4CEQ A;  3HL8 A;  3D7E O;  3SAH A;  4KH5 A;  2X74 A;  3Q7B A;  4H0Y B;  4Q0B A;  2EX3 A;  2IVN A;  1WSH A;  1YXQ A;  3VGM A;  3ZSO A;  4E89 A;  4BY9 C;  2AJQ A;  4NXM K;  1F21 A;  4FLW A;  3WQU A;  2A42 A;  3MXJ A;  2PFU A;  3CM6 A;  4CJT A;  3LPT A;  3IAY A;  2D5R A;  3DI6 A;  3U9Z A;  4CIG A;  1X1P A;  1YIT N;  1WBB A;  5GIO A;  2HBM A;  4DQ8 A;  3I8D A;  2Q0R A;  1GLF O;  4DWI A;  4CK1 A;  2P9P B;  1HR0 K;  2IGI A;  3IRX A;  1E4F T;  4HWI A;  3H46 O;  1IG9 A;  1Z26 A;  2CGL A;  2NLX A;  5AJ3 K;  3D2F B;  3LP0 A;  4DQP A;  1YIJ N;  1VQL N;  2Y1I A;  4FM1 A;  4GV9 A;  2HB5 A;  4JNE A;  4FJI A;  1QE1 A;  4GY2 B;  4IOA L;  1TAU A;  1UWB A;  3BUZ B;  4JI1 K;  4DF4 A;  2YJE A;  4M3Z A;  1XMQ K; 
#chains in the Genus database with same CATH homology
 3MEC A;  4CK2 A;  1VSM A;  5J2N A;  4FJG A;  4CEC A;  4FLV A;  3QEV A;  4IG3 A;  3TAR A;  1QHT A;  3K59 A;  4E0D A;  4DMN A;  1VSI A;  2OA8 A;  3AA4 A;  3LZI A;  1BI4 A;  1JLQ A;  4DSE A;  3QEI A;  3EZ5 A;  1K6Y A;  4I9Q A;  5T7B A;  3AVF A;  5HRO A;  2Z1H A;  1RTI A;  3VQA A;  3NH2 A;  1ITG A;  4C8O A;  3RR8 A;  2IDO A;  4AIL C;  1HNI A;  3DLK A;  3SV3 A;  3KKS A;  3QER A;  4CF8 A;  1XWL A;  4RG8 A;  1EX4 A;  1UOC A;  4NYN A;  4O0J A;  4Y1D A;  4KPY A;  2Z1I A;  4CF2 A;  4HHT A;  1ZBL A;  4CJP A;  2JGU A;  2RF2 A;  4CGD A;  1ZBI A;  3V1R A;  3AA5 X;  1S9G A;  3OYF A;  4NYF A;  2HNZ A;  1BI4 B;  1RBT A;  1J54 A;  2YKN A;  4CEA A;  1NKE A;  2KW4 A;  3L8B A;  4CJU A;  4R5P A;  1RBV A;  4DFK A;  4FJX A;  4FJ5 A;  4DTU A;  1ZBU A;  3NF7 A;  1W9H A;  3HO1 A;  4RW9 A;  3P83 D;  3SQ2 A;  1EKE A;  3RTV A;  3U3Y A;  3LP2 A;  3NGY A;  4B9T A;  3H08 A;  4B3O A;  3VA0 A;  2F96 A;  3PX0 A;  2O4I A;  4BAC A;  2HMI A;  5HP1 A;  3KKR A;  4H4O A;  4KI6 A;  2X6N A;  4CEF A;  5FRN A;  4DS4 A;  3RR7 A;  3KJV A;  2BAN A;  1C0T A;  3PX4 A;  3VQ9 A;  3VQB A;  3K57 A;  4FLX A;  1HQU A;  4DQS A;  1RTJ A;  4DTJ A;  1WSG A;  4OLA A;  5CY4 A;  2KZZ A;  1KCF A;  3RRG A;  3TAF A;  3SUQ A;  3OJU A;  1C0M A;  4ID5 A;  4HUG A;  3BGR A;  4OJR A;  3SUN A;  1SKR A;  1KTQ A;  2PYJ A;  2DFF A;  3LP3 A;  2RN2 A;  4BE0 A;  4J2D A;  1CLQ A;  3VQ4 A;  2NUB A;  1JXE A;  1XHX A;  4CER A;  3L2V A;  2IS3 A;  2RKI A;  3L2U A;  4ZHR A;  2XY7 A;  1A5W A;  2BDP A;  1U04 A;  3QES A;  1RDC A;  4DSJ A;  2HVH A;  3MXI A;  2HHQ A;  3JSM A;  2PZS A;  4KAZ A;  3ZT0 A;  5I3U A;  1X9S A;  1TK5 A;  1VRT A;  2FC0 A;  3QEP A;  3LPU A;  2HHT A;  5CZ2 A;  1KVC A;  2X78 A;  1DTT A;  1S1T A;  3C6T A;  1TKT A;  3MEG A;  3HJF A;  1B9F A;  1DTQ A;  4KHS A;  1JKH A;  1S1V A;  3HPH A;  1HYS A;  5FRO A;  1J5O A;  5HRR A;  4DU4 A;  1TK0 A;  4J2E A;  1I39 A;  3OYE A;  3M8R A;  4KV8 A;  3DLG A;  5D3G A;  5JS2 A;  3WNE A;  1U47 A;  1DLO A;  3AVG A;  2FBT A;  3EYZ A;  3DYA A;  1T05 A;  4AHT A;  3MED A;  1VSL A;  4CHZ A;  3ZT4 A;  4M41 A;  3KK1 A;  3S9H A;  1UA0 A;  4N41 A;  5J2P A;  4Z4E A;  3HK2 A;  4FXD A;  4CIF A;  1RT1 A;  4O0I A;  1EP4 A;  3PY8 A;  4GMJ B;  3VQP A;  2YHA A;  1RTH A;  4ELV A;  4DSF A;  4CHN A;  4N56 A;  2WOM A;  4OPK A;  4Q5V A;  4E7K A;  1D9F A;  4IFV A;  3C6U A;  3V9S A;  3VA3 A;  1O1W A;  2OPR A;  1HQE A;  4W5T A;  4PWD A;  4QAG A;  1YT3 A;  3NH1 A;  3IG1 A;  4DQR A;  4KKO A;  4EP4 A;  3TAN A;  1NOZ A;  3AA3 A;  4OLB A;  3HYF A;  1RT7 A;  3C95 A;  2IAJ A;  1XI1 A;  1QTM A;  3U6F A;  5J2Q A;  1TKX A;  3L3V A;  3OVN A;  3PX6 A;  3SNN A;  1S9E A;  4CJQ A;  2VG6 A;  1RDA A;  5JS1 A;  1CZ9 A;  4O5B A;  3V9W A;  3L3U A;  2FBY A;  2I5J A;  3HM9 A;  3B6O A;  1R0A A;  3ZSY A;  3I0R A;  3QIP A;  4Z4H A;  4E1M A;  3OYA A;  4I2P A;  2BE2 A;  3K5O A;  4Z4C A;  3SPY A;  4ID1 A;  3SQ0 A;  2Q3S A;  4ZTJ A;  3KIO A;  2OPS A;  4CFB A;  3WNH A;  3OYK A;  1WSJ A;  3SQ1 A;  4N76 A;  4M3X A;  2KFZ A;  5EU7 A;  4FJM A;  3B6P A;  2LSN A;  3ULD A;  3HP6 A;  4I2Q A;  2QKB A;  3S3M A;  4C8L A;  2KTQ A;  1NK4 A;  1RT6 A;  2YNG A;  4KO0 A;  2B5J A;  3O3G A;  4O55 A;  3ZCM A;  2KZM A;  3CFO A;  2E4L A;  4DU1 A;  3SCX A;  1WSI A;  1BCM A;  4B9M A;  1IH7 A;  3BDP A;  3KTQ A;  1VRU A;  1SKW A;  3VQ8 A;  1JLE A;  1HPZ A;  1JLC A;  1ZYQ A;  1IKX A;  4IDK A;  4WE1 A;  4JRQ A;  1NK7 A;  4JS5 A;  4BDP A;  3DRS A;  4F3T A;  3QEX A;  4CGG A;  1A5X A;  1BIU A;  3AVK A;  3QIN A;  3KLG A;  4FM0 A;  3TAM A;  4M3Y A;  1KFS A;  4FVM A;  3TR8 A;  3HST B;  3HT3 A;  3WNF A;  4O4G A;  3AVJ A;  4E19 A;  2GBZ A;  3FFI A;  1RCH A;  4FLY A;  3QNN A;  3L2R A;  4FW2 A;  3T3F A;  2OZS A;  3CQ8 A;  4PUO A;  1KFD A;  3OYH A;  1RDD A;  4CES A;  4FYD A;  3THV A;  1SKS A;  1TKD A;  2YNI A;  1S5J A;  3ITH A;  3V9X A;  5SWM A;  1GOA A;  4CJW A;  4Z0U A;  1Q9X A;  4RW6 A;  3SUO A;  3OYG A;  4E7H A;  3ZT1 A;  2HHS A;  4PA1 A;  2OZM A;  4DTP A;  5KRT A;  2ATQ A;  2ETJ A;  4KRE A;  4DFJ A;  3ISN C;  3CYM A;  1QSY A;  1CZB A;  2DFE A;  1BQM A;  1LWF A;  4Z4I A;  1NK5 A;  3CFP A;  4ELU A;  1WN7 A;  1JLB A;  3AVB A;  4BDY A;  2QXF A;  3D45 A;  2HHU A;  1RT2 A;  4CFC A;  4KI4 A;  3AO5 A;  1T7P A;  1VSE A;  3M8Q A;  1RIL A;  3RWU A;  3ZT3 A;  4FZX C;  4GVM A;  3V1Q A;  4DLE A;  2P5G A;  1L5U A;  3VQ6 A;  2KFN A;  4OKK A;  2KQ2 A;  4CEB A;  2DFH A;  1C1C A;  2IC3 A;  4KFB A;  4OVL A;  4H8K A;  3U3G A;  3OYC A;  1Q9Y A;  3KD5 E;  2HHX A;  2VWJ A;  1WNS A;  1ASV A;  1L3V A;  2G8K A;  3MAQ A;  1ASW A;  4LY7 A;  3RRH A;  4CIE A;  3AO4 A;  4RW7 A;  5CZ1 A;  4YNQ A;  1Q8I A;  3CG7 A;  3V9U A;  3VQC A;  4BWM A;  3CFR A;  4QOZ B;  5DK5 A;  1LAV A;  3NHG A;  1HYV A;  3K5L A;  4KRF A;  1FK9 A;  4DQQ A;  1JLF A;  2FBX A;  4JLH A;  4LH5 A;  4RW4 A;  3VQ7 A;  4JRP A;  4AHS A;  5J2M A;  3SV4 A;  4B8C A;  1IKY A;  3TAG A;  4CHP A;  3TWH A;  2FBV A;  1UAX A;  1HRH A;  1IKW A;  4Y1C A;  1G15 A;  3QNO A;  3LAM A;  2HHV A;  1HJR A;  3LAN A;  1NJW A;  1BIS A;  3NF6 A;  4LD0 A;  3HVR A;  3AO1 A;  1NK8 A;  4HCC A;  4DTR A;  4CJV A;  3OY9 A;  4DS5 A;  4EP5 A;  1TGO A;  2GUI A;  3ZSX A;  2GV9 A;  3DOK A;  5HRS A;  4F2S A;  1IO2 A;  3D0P A;  2IOC A;  3O3H A;  3O4Q A;  4CGF A;  3O3F A;  4IKF A;  5HBM A;  3SZ2 A;  4C8M A;  3SI6 A;  3OYD A;  2PY5 A;  3V81 A;  4ELT A;  5HLF A;  4CFD A;  3NF9 A;  4DTO A;  3LZJ A;  1NK0 A;  1QSS A;  1WSF A;  3AV9 A;  4CEO A;  4CGJ A;  2D0A A;  5C25 A;  2XY6 A;  2QKK A;  4J2A A;  1J53 A;  1NJZ A;  3SJJ A;  3DRP A;  4AHC A;  1T8E A;  3IS9 A;  1KLN A;  2XY8 A;  1YVU A;  4OGC A;  4F2R A;  4BWJ A;  1W0H A;  3AVA A;  4MFB A;  3HP9 A;  3QLH A;  3OYM A;  1TL3 A;  3ZT2 A;  3RMA A;  1L3U A;  1GOB A;  1S1X A;  3RMC A;  4DTN A;  2HND A;  3HPO A;  4N47 A;  4ICL A;  4KTW A;  1D8Y A;  4DTX A;  1RBR A;  3P5J A;  2YV0 X;  4AHU A;  3VQQ A;  4CJL A;  1S1W A;  4M3R A;  3SQ4 A;  3CM5 A;  1WSE A;  4CJ5 A;  4KHN A;  4DF8 A;  5HRP A;  1NK6 A;  4DTM A;  3ZSZ A;  3P1G A;  1LW0 A;  4B8A B;  5E41 A;  4M3U A;  2DTU A;  4F3O A;  1I3A A;  1Z25 A;  4CHQ A;  1VSK A;  4G1Q A;  2EHG A;  1BL3 A;  3G0Z A;  4TSX A;  4LSN A;  4M45 A;  1EET A;  4CGH A;  1KVB A;  1XC9 A;  2P51 A;  4M42 A;  1SL1 A;  3LAL A;  4E7I A;  1NKC A;  1ZBH A;  4CJ4 A;  1C6V A;  1RDB A;  2RPI A;  1U48 A;  4KHW A;  4K8X A;  3O4N A;  1L3S A;  2Z1J A;  1RBS A;  3AO2 A;  3OS2 A;  5FDL A;  1MU2 A;  3VQ5 A;  2XRI A;  4IFY A;  3OYI A;  3L2Q A;  2G8U A;  3V6D A;  3TAP A;  2F8T A;  1SV5 A;  3RMB A;  4DSI A;  4E7J A;  3L2W A;  4KB1 A;  4CFA A;  1EXQ A;  1S6P A;  3OS0 A;  3C94 A;  4FLU A;  4FJK A;  4K8Z A;  1RTD A;  3TAB A;  1LWE A;  4FJ7 A;  1TKZ A;  2HHW A;  1LAW A;  3HXM A;  1U45 A;  3TI0 A;  3SUP A;  1HYZ A;  4FJN A;  4ZTF A;  1KSP A;  1FXX A;  4CGI A;  5SZT A;  2P5O A;  3SPZ A;  4NCB A;  2A1S A;  5J1E A;  3AA2 A;  3WNG A;  5HRN A;  5KGX A;  3KK3 A;  5KTQ A;  4FK0 A;  4AH9 A;  4KHU A;  4C8N A;  1D9D A;  2ZD1 A;  3LWL A;  4BDZ A;  1GOC A;  3HVT A;  1NJY A;  4HTU A;  3V4I A;  4FZZ A;  3KD1 E;  2YNH A;  3PO5 A;  2YKM A;  1WAF A;  3NCI A;  5KRS A;  3T19 A;  3NF8 A;  4W5Q A;  4KTQ A;  4I9L A;  2ITG A;  4OKE A;  3RMD A;  3OJS A;  1J9A A;  1RT5 A;  1T03 A;  1ZBF A;  4KB0 A;  3QO9 A;  1UA1 A;  4LH4 A;  3KLI A;  4CE9 A;  3LAK A;  2JLE A;  4B9V A;  4F4K A;  3E01 A;  2D0C A;  4OGE A;  3AVL A;  3F73 A;  2YNF A;  2Y1J A;  2A1R A;  1C0U A;  3LP1 A;  4GW6 A;  1X9W A;  1X9M A;  1LV5 A;  4O44 A;  1TAQ A;  1BIZ A;  4QCL A;  4FLZ A;  4FJH A;  1BHL A;  4B08 A;  2X6S A;  3VN5 A;  4XIU A;  2Z1G A;  1VSH A;  3MEE A;  2G8F A;  4LSL A;  2VWK A;  4CEE A;  4J2B A;  4CK3 A;  1U49 A;  3NGZ A;  2W42 A;  1FKO A;  1B92 A;  4DG1 A;  3OYL A;  1QSL A;  4UQG A;  1NJX A;  4HUF A;  1XHZ A;  4DFM A;  4PQU A;  1LW2 A;  5KGW A;  3ZSV A;  3HPG A;  3T1A A;  3AVH A;  2G8I A;  3TAE A;  4IBN A;  1RT4 A;  4FM2 A;  5I42 A;  3NBP A;  4CJF A;  3UIQ A;  3K5M A;  4CHO A;  4DTS A;  1Y97 A;  3K58 A;  2G8H A;  2PYL A;  1TV6 A;  1LWC A;  4H4M A;  4I7F A;  3QET A;  3NE6 A;  4B9U A;  1RT3 A;  2B6A A;  3DRR A;  4CJE A;  5K14 A;  2VG5 A;  2QK9 A;  2VG7 A;  4KTZ A;  3VQD A;  1BCO A;  3S3N A;  1IKV A;  3I0S A;  4CF0 A;  3DM2 A;  4E3S A;  4FZY A;  3QEW A;  4EZ9 A;  1ASU A;  4JS4 A;  4NCA A;  4FK4 A;  3EY1 A;  2HVI A;  4Z4F A;  3DLR A;  4FW1 A;  1RNH A;  3V1O A;  4E1N A;  3ZSQ A;  3DLH A;  1WAJ A;  2HNY A;  4BE1 A;  1VSF A;  4IG0 A;  4KHQ A;  4Z4G A;  1NOY A;  3F9K A;  5DMR A;  2E6L A;  2P1J A;  2ZQB A;  4CED A;  4PY5 A;  4FLT A;  3NAE A;  4W5N A;  2YHB A;  3VQE A;  3OS1 A;  1KLM A;  3A2F A;  2G8V A;  1TVR A;  4MQ3 A;  4CJS A;  4AHV A;  4L8R B;  4M3T A;  4CJR A;  1YTU A;  4RW8 A;  1BQN A;  3ALY A;  3NFA A;  3K2P A;  1JXB A;  2XHB A;  4DFP A;  1N6Q A;  3OYN A;  3ASM A;  1JL2 A;  1VSD A;  2E6M A;  1C1A A;  3V9Z A;  3K5N A;  1VSJ A;  1CXQ A;  4B9S A;  1CXU A;  1SUQ A;  4W5R A;  4CF9 A;  4B9L A;  2HW3 A;  4CEZ A;  4DLG A;  1TL1 A;  2G8W A;  1HMV A;  3LWM A;  4KHY A;  1NK9 A;  3JYT A;  1NKB A;  1QQC A;  4CEQ A;  2OYQ A;  1N5Y A;  5CYM A;  3MXM A;  3HL8 A;  4OKJ A;  2X74 A;  3ZSW A;  1U4B A;  1D5A A;  1REV A;  1B9D A;  2XY5 A;  4B9N A;  4Q0B A;  3NDK A;  2EX3 A;  1KRP A;  1WSH A;  3S3O A;  3AO3 A;  2DY4 A;  4AHR A;  4FK2 A;  1JLG A;  1QS4 A;  2BGG A;  3DLB A;  1S6Q A;  1VK0 A;  3LDS A;  3ZSO A;  4E89 A;  4HCB A;  2O4G A;  3ZSR A;  2AJQ A;  1S1U A;  3OYJ A;  1F21 A;  4FLW A;  1YTA A;  4CJ3 A;  4CCH A;  3MXJ A;  4CF1 A;  1RBU A;  3CM6 A;  4CJT A;  3LPT A;  4N5S A;  3NGI A;  4OPJ A;  4DSL A;  3M8P A;  1BGX T;  1L3T A;  4FCY A;  3SYZ A;  3IAY A;  2D5R A;  3AVI A;  5C24 A;  1SL0 A;  5C42 A;  3DI6 A;  3AVN A;  3DOL A;  2D0B A;  3KLF A;  4CIG A;  1JLA A;  1X1P A;  2F8S A;  3DLE A;  3DMJ A;  4FJ8 A;  4E7L A;  4DQI A;  4W5O A;  3I8D A;  2R7Y A;  3KLE A;  4F8R A;  4FJL A;  1SL2 A;  4EZ6 A;  4DWI A;  3KLH A;  4CK1 A;  3AVC A;  1KVA A;  1FKP A;  2IGI A;  3IRX A;  5KI6 A;  4HVJ A;  3PV8 A;  4NCG A;  2OPP A;  3KK2 A;  2XO7 A;  1TK8 A;  1WLJ A;  3AVM A;  1IG9 A;  4BE2 A;  2WON A;  1Z26 A;  3PO4 A;  3QIO A;  3OYB A;  1C1B A;  2B4J A;  1JL1 A;  2OPQ A;  3LP0 A;  3M8S A;  4DQP A;  4DU3 A;  4FJ9 A;  5CYQ A;  3NH0 A;  4FM1 A;  3PUF A;  2Y1I A;  4YFU A;  2HB5 A;  3TAQ A;  4M3W A;  1A5V A;  1QE1 A;  4FJI A;  1TAU A;  1UWB A;  3G10 A;  5FRM A;  4C8K A;  4CHY A;  4HUE A;  4DF4 A;  4M3Z A;  2ZE2 A;  4FJJ A;  4CJK A;  1HNV A;  4DSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...