2KQ2A

Solution nmr structure of the apo form of a ribonuclease h domain of protein dsy1790 from desulfitobacterium hafniense, northeast structural genomics target dhr1a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
147
structure length
147
Chain Sequence
MDDRTEYDVYTDGSYVNGQYAWAYAFVKDGKVHYEDADVGKNPAAATMRNVAGEIAAALYAVKKASQLGVKIRILHDYAGIAFWATGEWKAKNEFTQAYAKLMNQYRGIYSFEKVKAHSGNEFNDYVDMKAKSALGIRDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the apo form of a ribonuclease H domain of protein DSY1790 from Desulfitobacterium hafniense, Northeast Structural Genomics target DhR1A
rcsb
source organism Desulfitobacterium hafniense dcb-2
molecule tags Hydrolase
molecule keywords Ribonuclease H-related protein
total genus 30
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2009-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2kq2A01
3OS0A 4DMNA 4XIUA 1S1UA 1FKPA 3LP1A 1LWFA 1DLOA 1JLCA 4JS4A 3I8DA 4CF1A 2VWJA 3VQ6A 3QETA 4FJXA 2FBXA 1WSFA 2VG5A 4CGDA 1U47A 2G8HA 4Z4FA 1JL1A 3V1QA 1TAUA 4J2BA 3AV9A 3CG7A 4AH9A 1S9GA 4JS5A 4DSJA 1VSFA 3DRRA 3OYFA 2E6LA 1GOBA 1MU2A 2O4IA 1ZBIA 4G1QA 4HUEA 3WNEA 3NBPA 3AA3A 3TAFA 3AA4A 4CFCA 4KHSA 4FYDA 5HP1A 2HB5A 1ASVA 3K2PA 4NYFA 4M3WA 2BANA 1BHLA 3LP2A 5J1EA 4IKFA 2QKBA 4BACA 1HPZA 2ZQBA 3DMJA 3NDKA 5J2NA 3K5NA 1XHZA 1XC9A 3SUQA 2HVIA 3UIQA 1WAFA 3KD1E 4CF2A 4CHOA 1T05A 3RWUA 3PX6A 4CJUA 4DS5A 4Z4HA 3T1AA 3MXIA 1A5XA 3DM2A 3OY9A 4F4KA 3ALYA 4IG3A 4IBNA 1XI1A 3TAGA 4E0DA 3AVMA 1BISA 2VG6A 3LANA 3VA3A 1RBSA 4IFYA 2Z1JA 3ZSXA 1TK0A 4FJ8A 4PQUA 1B9DA 3LAKA 4DG1A 3NE6A 4OGEA 3L2WA 4ID1A 1VSJA 4M41A 3CFRA 2G8UA 1VSDA 2OYQA 1HQEA 1JXEA 4I2PA 5C25A 3NGZA 3AVKA 4DQQA 2KTQA 1D9DA 4DSFA 4AHUA 3V9XA 1YTUA 2VWKA 4W5NA 4JRPA 2B6AA 1I39A 3BGRA 3V9SA 4E7HA 4FLYA 1RILA 1QS4A 2HNDA 2QKKA 1NKBA 1XWLA 4CJ4A 4BE2A 3NF9A 1VSHA 3AVCA 1RT5A 3LP0A 4RW8A 4BWJA 1TL3A 3K5OA 4CJSA 5CZ1A 1JLBA 4M3RA 3NAEA 3HPOA 4ELVA 1UA0A 2HHWA 3VQPA 4OGCA 1JLEA 2ATQA 4HCCA 1F21A 5C24A 3I0RA 4PWDA 1TK5A 4B9SA 2YHAA 1BQNA 2KFNA 3ULDA 3SQ2A 3V1RA 4DU4A 3OYMA 4O0JA 3DLHA 4B9VA 4KI4A 1JKHA 5KRSA 4E7LA 3C95A 3OYJA 4CE9A 3V6DA 4FCYA 2G8WA 3SQ4A 2FBYA 3NH2A 4O5BA 2YNIA 1HRHA 4F3TA 1Z26A 1SKWA 3L3UA 2ITGA 3NFAA 4Q0BA 4FK2A 3JSMA 3RMDA 1ZBFA 5KI6A 1RTJA 3TAPA 3RRHA 2GBZA 3HJFA 4KREA 3CM6A 3QLHA 3VQ7A 4FK0A 1KFSA 4QCLA 3AVAA 3LZIA 3V9WA 1UA1A 2R7YA 1QSLA 4CEQA 4Z4EA 4J2EA 2HHUA 3O4NA 4KPYA 4CGHA 2YNHA 1REVA 5I42A 1WN7A 2IDOA 4F8RA 4DS4A 1T03A 4Y1DA 3TAQA 1QTMA 1WSGA 4DTUA 4AHVA 5DK5A 1Y97A 3TI0A 3RR8A 2OPRA 3LPUA 1RT1A 3NGYA 2A1RA 4ELTA 4CJTA 3AVJA 1CZBA 1G15A 1T8EA 5FDLA 1QSYA 4TSXA 4DTMA 1RDAA 4DFMA 2Z1GA 2BE2A 4CGIA 4HHTA 3PY8A 3OS2A 3CQ8A 3SZ2A 1S1WA 3TARA 3KLGA 3S3NA 2IGIA 4CESA 1RBRA 3AO5A 1RT7A 1L5UA 2HHVA 1X1PA 4CHZA 1S1XA 4FVMA 3THVA 1S9EA 4E7JA 3KTQA 4CJFA 2RF2A 1GOCA 4PA1A 4DLEA 3SNNA 3WNFA 4PUOA 2YV0X 1RBTA 3IS9A 1TKXA 2JGUA 3E01A 3AA5X 3KK3A 1JL2A 2ETJA 2AJQA 4E19A 3C6TA 3KLIA 4C8NA 4ZTFA 1WNSA 5HBMA 3C94A 4CEAA 3HK2A 3G10A 3HL8A 2PYLA 2DFFA 3AVIA 1JLFA 4CFDA 2HHXA 3KLEA 4CEBA 3QEPA 2RPIA 1EETA 1LWCA 3HPHA 1ASUA 3VQ5A 4B08A 3PUFA 1RT3A 1WLJA 3ITHA 4CHYA 3QEIA 4H4OA 4RG8A 3ZT3A 1VSIA 1LW0A 4CGFA 3O3FA 3EY1A 4DSIA 1TKTA 4DTPA 3M8QA 3RTVA 3ZSOA 4AILC 2NUBA 4ICLA 3SQ0A 3D0PA 3DLBA 1S1TA 2KFZA 3O3GA 4F2SA 1B9FA 1A5WA 3K57A 3MXMA 1J54A 1RNHA 4Z0UA 3OYEA 4CHPA 3K5MA 4FZYA 2KQ2A 4OPKA 4CEDA 4KHUA 2KZZA 2XY6A 2W42A 4FZZA 3VQ8A 1C1CA 1ZBLA 4QAGA 4NCBA 1HYVA 4OVLA 4DSEA 4RW4A 1NK6A 4FJ9A 4CFBA 1DTQA 1ZBUA 2P51A 3HYFA 3QINA 4ID5A 2P5OA 1C0TA 1D5AA 4LY7A 1ASWA 2E6MA 2O4GA 3M8SA 4DLGA 4I9QA 4CEFA 4I7FA 2G8VA 3HO1A 1JXBA 3DLRA 1BQMA 1TKZA 4C8KA 3LWLA 3QNOA 4DFPA 1VRUA 3QERA 1LV5A 3IG1A 4HUGA 5KGWA 1O1WA 2HNYA 2Z1HA 4NYNA 3CFPA 3QEVA 3MXJA 3LPTA 1KCFA 4DU1A 3OYLA 4J2DA 2YNFA 1NKCA 4KO0A 2G8KA 1S6QA 3F9KA 4BDZA 4B9UA 1BCMA 3IRXA 3NF8A 3PX0A 5J2PA 1VSMA 4FM0A 2DFEA 4CJWA 3ASMA 1W9HA 4C8LA 3RMAA 1K6YA 2Z1IA 4DTJA 3L2VA 3HP9A 1QE1A 4OKKA 4KAZA 3ZSVA 1SKSA 1NKEA 2DFHA 1J53A 2RN2A 4EZ6A 1IKVA 2F8TA 3OVNA 4AHRA 1IH7A 4LH4A 3PV8A 2YNGA 1SL0A 3KIOA 1WSHA 4DF4A 1SL1A 3OYAA 4HCBA 4Z4IA 3NGIA 3RMCA 4KHWA 4FM1A 2HNZA 3VQQA 2PY5A 1RTIA 1JLQA 2D0AA 4E1MA 4FJIA 2DTUA 3L2UA 4DQIA 4F2RA 3VQCA 3PO5A 5JS2A 4CJRA 4DFJA 4LH5A 1TL1A 4CECA 4CK2A 5KTQA 1NK9A 4GMJB 4CJEA 4CJVA 5T7BA 1KRPA 4B9LA 4QOZB 2ZE2A 4CEOA 3RR7A 3KD5E 2B4JA 3OJSA 3QIPA 3OYIA 5K14A 4LSNA 3QESA 3LALA 2IC3A 5HRNA 1RCHA 4I2QA 3TAEA 3S3OA 1TV6A 2EX3A 3SV3A 1ZYQA 4ZTJA 3SPZA 4FK4A 3ISNC 3K59A 4CF8A 2GUIA 3HPGA 4FLTA 4K8XA 1W0HA 2D5RA 3ZSZA 4CFAA 4Z4CA 2JLEA 1U45A 1NK8A 1N5YA 2OZMA 5FRNA 4CJKA 3ZSQA 1UAXA 3L2QA 3KKRA 4IDKA 4N5SA 2YKMA 2ZD1A 2HVHA 2B5JA 4BWMA 3V9ZA 2HHTA 4EP4A 1JLAA 4DU3A 4YNQA 2Y1JA 3P1GA 3SQ1A 1HYSA 4HVJA 3CFOA 3OYKA 3KK2A 1S1VA 4C8MA 3HSTB 4C8OA 3SI6A 1A5VA 3NH0A 4NCAA 4KFBA 1S6PA 1IG9A 2D0CA 1J5OA 3IAYA 3EZ5A 1I3AA 3T19A 4B3OA 2I5JA 3ZT4A 3ZT2A 1S5JA 4FJLA 1LWEA 1RT6A 3AVBA 4O44A 2D0BA 3ZSRA 4CIGA 1KLNA 4FJMA 1J9AA 3TAMA 5JS1A 1YVUA 1R0AA 1L3VA 4FJHA 1CLQA 1U48A 3KLFA 4CEEA 2Y1IA 3DI6A 1U4BA 4W5TA 1C1BA 4DWIA 1UOCA 3SUNA 3OYHA 1SKRA 4FXDA 2IOCA 3G0ZA 2FBTA 5CYQA 1DTTA 5KGXA 4KB1A 3M8RA 1NOZA 4CK1A 3AVHA 4FJJA 4GVMA 4O4GA 2E4LA 4FM2A 4OPJA 4FLVA 3MEDA 4Z4GA 3BDPA 3D45A 3L3VA 2HW3A 1WSJA 4CIEA 4CEZA 4CJLA 2OPPA 3AVGA 4CGJA 4E89A 3LP3A 3AA2A 5DMRA 5E41A 1JLGA 1HNVA 3AVNA 3PX4A 1TK8A 4KTZA 3LWMA 1SV5A 2BDPA 1C0UA 4DTOA 4JRQA 4CIFA 1X9SA 1NOYA 4OKJA 1KFDA 2IAJA 4I9LA 2IS3A 1UWBA 2EHGA 2XO7A 1U04A 1CXQA 3VQ9A 1IKWA 4IFVA 1C0MA 4Y1CA 4CHQA 4E1NA 3O3HA 1SUQA 2XHBA 3TWHA 4OJRA 1NJXA 3AO1A 4W5RA 1HQUA 1TGOA 1NK5A 3DOLA 5C42A 1IO2A 2HMIA 2FC0A 2XRIA 4B9NA 4BE0A 4KHQA 2DY4A 3QEXA 3O4QA 4FJ5A 5J2MA 3LAMA 1L3SA 2OPSA 1HYZA 2XY7A 3SUPA 2F8SA 4DF8A 4O55A 1FK9A 2OPQA 3P5JA 1KVBA 3HVRA 3SCXA 3S9HA 3MECA 3NHGA 1LAWA 4RW6A 4FJGA 4B9TA 4DTRA 3KK1A 3QIOA 3VQAA 1RDBA 5HROA 3SJJA 1RDDA 1Q9XA 1Z25A 4M3ZA 3C6UA 3DLGA 1B92A 4AHCA 5CYMA 4GW6A 1NJYA 3OYGA 1RTDA 4DTXA 3ZCMA 2OZSA 4AHTA 3TR8A 1RT4A 3MAQA 3LZJA 4M3UA 1QSSA 4DTNA 4CJ5A 1U49A 4O0IA 4J2AA 4FJ7A 3OYDA 5CY4A 3QEWA 4CCHA 4FLXA 4PY5A 2X6NA 4FJNA 3HM9A 1KSPA 2KW4A 3AO2A 5D3GA 3K58A 4DQRA 3M8PA 3ZSYA 3NCIA 3U3GA 4IG0A 3DYAA 3I0SA 4KTWA 4CF9A 3OJUA 1GOAA 4CGGA 2G8FA 1BI4B 2PYJA 2P1JA 1N6QA 4KRFA 1RBVA 1BGXT 3SYZA 4JLHA 3RMBA 3SV4A 1T7PA 5HLFA 4DQPA 4EZ9A 4BE1A 4N76A 1C1AA 1EX4A 4BDPA 4KI6A 3PO4A 3VQEA 4OLBA 4OLAA 4DTSA 2X78A 4M3XA 1KVCA 2WONA 1QQCA 1BIZA 2F96A 1YT3A 3CM5A 3VQ4A 2QXFA 3T3FA 1LAVA 1RTHA 4E3SA 1X9WA 2HHQA 4ELUA 1HMVA 4H4MA 1HJRA 3VA0A 4L8RB 3H08A 4HUFA 2X6SA 3AO4A 1L3TA 4N47A 1BIUA 4K8ZA 4FW2A 4FLWA 2HHSA 1HNIA 4FW1A 4UQGA 1VRTA 3V81A 4MFBA 4LD0A 4FLUA 3AO3A 3S3MA 3HT3A 3TABA 3HXMA 1VSLA 4N56A 1EP4A 4H8KA 5SWMA 3NF6A 4NCGA 4HTUA 2XY5A 1D9FA 4CERA 1RBUA 1TAQA 1VK0A 3HVTA 3VQDA 1Q9YA 5FRMA 2X74A 4MQ3A 1KTQA 2FBVA 1QHTA 3L2RA 2G8IA 4B8AB 4CJQA 2Q3SA 1KVAA 4E7IA 1TKDA 2PZSA 4KKOA 4CK3A 1D8YA 3OYCA 2BGGA 3OS1A 3MEEA 1LW2A 3CYMA 4R5PA 4E7KA 1SL2A 4M42A 1RDCA 4F3OA 4KV8A 1EXQA 1NK7A 2XY8A 2LSNA 2RKIA 4RW9A 5KRTA 3DRPA 4FJKA 5HRRA 1ITGA 3AVLA 3TANA 1NJWA 1X9MA 2QK9A 3FFIA 1WSEA 3AVFA 4DSKA 4CF0A 1NJZA 3ZT0A 4WE1A 3V1OA 5J2QA 3U3YA 1VSEA 4DQSA 1NK4A 4YFUA 4B8CA 3VQBA 3QO9A 2KZMA 1BL3A 1WAJA 5EU7A 3OYBA 1L3UA 4M45A 3NF7A 4ZHRA 4CHNA 1RT2A 4FLZA 5HRPA 1Q8IA 1IKXA 1C6VA 1ZBHA 3LDSA 3RRGA 3OYNA 3A2FA 1FKOA 1EKEA 1VSKA 1XHXA 2YHBA 3B6PA 1BI4A 4EP5A 3NH1A 3F73A 3KKSA 3V4IA 1YTAA 3SUOA 2P5GA 3ZT1A 4B9MA 3U6FA 3WNGA 4KTQA 3L8BA 5SZTA 2YKNA 4CJ3A 4BDYA 2WOMA 3KLHA 4KHNA 1WSIA 3V9UA 1IKYA 1CZ9A 4RW7A 4M3YA 5FROA 4W5QA 3DLKA 1NK0A 1BCOA 4DSLA 4KB0A 3HP6A 4Q5VA 3EYZA 2GV9A 4OKEA 3B6OA 5CZ2A 3SPYA 4N41A 2OA8A 1CXUA 4M3TA 3DLEA 4KHYA 1TVRA 4DFKA 2VG7A 3K5LA 3VN5A 2A1SA 3QNNA 3DRSA 1FXXA 3P83D 3JYTA 4AHSA 3DOKA 3MEGA 4FZXC 3KJVA 5I3UA 4CJPA 3WNHA 3ZSWA 1KLMA 5HRSA 4LSLA 4W5OA
chains in the Genus database with same CATH superfamily
1W2BM 4BR2A 1S1UA 4DQ8A 3OBWA 1N34K 4CF1A 4DV1K 2GUPA 3R3LA 4CGDA 4ILGB 3AV9A 4ISGA 1XUPO 3DRRA 3OYFA 3THYB 2O4IA 1ZBIA 5H1SQ 3WNEA 3CPEA 5EX5A 3TAFA 3AA4A 4JI1K 4JKDA 3LP2A 4PKHA 4KHWA 1XHZA 3NDKA 2NRTA 3UIQA 3KD1E 4RWTA 4CHOA 1T05A 3RWUA 5BN9A 3PX6A 3T1AA 3I8BA 1A5XA 3DM2A 1BDGA 4Z94A 4IG3A 3LL3A 4IBNA 1BOTO 2VG6A 3VA3A 2O8FB 3ZSXA 4B3TK 4PL8A 3ZEUA 4DG1A 3NE6A 4OGEA 3CFRA 4M41A 3K9JA 2D4WA 1JXEA 5C25A 4O5FA 3H45C 2VWKA 4JK7A 3W0LA 1GLBG 1HX1A 3MCPA 4H5VA 4FLYA 5C12A 2QKKA 4CJ4A 1X9JA 4BE2A 1VSHA 3AVCA 4CJSA 1JLBA 1UA0A 2VGMA 4OGCA 3N4QA 4DUYK 2CGLA 2ATQA 4GV3A 5C24A 4DKWA 1TK5A 2YHAA 5BN8A 2FLOA 2KFNA 3DXMA 4ISFA 3DLHA 4B9VA 4BR4A 5KRSA 4RCHA 2G8WA 3HZ6A 3NH2A 4F3TA 1Z26A 1VQPN 3JSMA 4CBXA 3TAPA 3RRHA 3CM6A 1KFSA 4QCLA 3VTHA 4PKGA 3AVAA 1HNWK 2R7YA 2HHUA 4Z4EA 3VTIA 3O4NA 4CGHA 2NLXA 1WN7A 2QWQA 4WCEL 1HKCA 4DTUA 2WBNA 3JAMO 3RR8A 3NGYA 1BWFO 3AVJA 5LJWA 1T6DA 4B1VA 1N33K 3WXLA 2FF3B 1IBMK 4CD1A 3PY8A 3BP8A 4I6MA 3OS2A 3M6GA 3D2EA 5DM7L 3THWB 1XMOK 3TPQA 3O8MA 4E7JA 3O08A 3CXCM 3WNFA 2A41A 3H3OB 4MO4A 4CZKA 5AQQA 3VEXA 3E01A 4B3MK 3KK3A 2AJQA 4E19A 4KH4A 3C6TA 2HHXA 2UXCK 4CEBA 2QTDA 1EETA 4FWPA 1ASUA 1RT3A 4CGFA 3O3FA 4DTPA 3I55N 4ICLA 3SQ0A 3DLBA 5BREA 2UU9K 3E66A 4F2SA 2ZF5O 1B9FA 3EL2A 3K57A 4KHUA 3ULEA 4CEDA 2XY6A 4EHUA 3VQ8A 4DR4K 4BY9C 1HYVA 4OVLA 4H0VB 3Q7CA 4CZIA 2P51A 4ID5A 1C0TA 3CERA 4LY7A 4A61A 4DLGA 3VGKA 4I7FA 3KK7A 3HO1A 1BQMA 1ILYA 5FPMA 1OH7A 2HNYA 4NYNA 3CFPA 1QQMA 5GAEP 3CETA 3F9KA 4B9UA 3FLCO 3NF8A 4Y0WA 4JI6K 4FM0A 1W9HA 4C8LA 3RMAA 1K6YA 4DTJA 3HP9A 1QE1A 4OKKA 4C23A 1SKSA 1NGCA 4O8KA 2RN2A 2GWJA 4EZ6A 2F8TA 3OVNA 4LH4A 1SL0A 1WSHA 4LFCK 3OYAA 3NGIA 4FM1A 3VQQA 4DR2K 1JLQA 4FJIA 3BUZB 3CJAA 1IBKK 4DQIA 3VQCA 5JS2A 4B9LA 4CK2A 5T7BA 3A5NC 3DWLA 3OYIA 1NNEA 4LSNA 3QESA 3TAEA 4BRDA 3EKSA 1TV6A 2EX3A 3SPZA 5LMNK 5BPLA 1ATSA 3ZSZA 1N5YA 3ZEUB 3L2QA 3KKRA 4N5SA 2JWKA 4DU3A 1NWKA 4YNQA 3P1GA 4HVJA 3GG4A 5GINA 2CH5A 4C8MA 2KLAA 3ZYYX 2NRXA 4NCAA 3SK3A 1IG9A 3O9TA 1DKGD 2D0CA 5BRDA 5JICA 1J5OA 3IAYA 4FJLA 3LM2A 2D0BA 1GLDG 4IO9L 4FJMA 2V7ZA 4B1YB 4DR7K 1YVUA 3T1HK 1L3VA 1U48A 2Q31A 1UOCA 1E4GT 3AY9A 3SUNA 3TTCA 1SKRA 5IWAK 4JKHA 1DTTA 1YJWN 1VQ4N 4Z4GA 4FM2A 4JK8A 3QFPA 2OPPA 4CGJA 3LP3A 3DXKA 1JLGA 1HNVA 2D0PA 4KTZA 2BDPA 4DTOA 4CIFA 1S22A 1NOYA 4OKJA 2IAJA 4IOAL 2IS3A 2XO7A 1U04A 1CXQA 3O3HA 3TWHA 2VGNA 1HQUA 2DY4A 2FF6A 5EXWA 4BE0A 1T6CA 1CZAN 4FWNA 3QEXA 3HOSA 1K9MO 3VOVA 4BRQA 1YAGA 5J2MA 1HYZA 2F8SA 2OPQA 3P5JA 3SCXA 3VGMA 3MECA 4RW6A 5ELZA 4B9TA 1RDBA 3VENA 5HROA 4YOYA 3P38A 4M3ZA 4AF1A 3C6UA 1B92A 3OYGA 1YIJN 1RT4A 1QSSA 4O0IA 4J8FA 5CY4A 3QEWA 3U4LA 3SAGA 2QWRA 2X6NA 2ZJRL 3B8AX 3DYAA 1DGKN 2G8FA 3CC2N 2P1JA 4JLHA 3AAPA 3SV4A 5HLFA 4N76A 4KI6A 3VQEA 5JLFA 4LF6K 4CJ7A 4OLBA 3O9SA 2QXFA 3D2FB 1X9WA 4BRIA 1HJRA 3J7ZO 1HNZK 3WXMB 3C7NB 1WOQA 3AO4A 1NGHA 4YOUA 2VQFK 1QZ6A 4FLWA 4FW1A 3HRGA 3V81A 4LD0A 1KAYA 5C10A 3S3MA 2YHYA 3HXMA 4H0YB 4H8KA 1WBDA 4HTUA 4JD2A 4CERA 1TAQA 1VK0A 3VQDA 1OVYA 5FRMA 5KPTA 2X74A 4B1ZA 2G8IA 4CJQA 4CK3A 3MEEA 4M42A 4R5PA 4F3OA 3UKUA 1WSEA 4YOXA 5M1PA 1NJZA 3ZT0A 3R8EA 4M7YA 3RSEB 5J2QA 3U3YA 5FPEA 1VSEA 4CZGA 4H0PA 4DUZK 3UKRB 3QO9A 4IXCA 3CCRN 4IWVA 2KZMA 1BL3A 5EOYA 3OYBA 1L3UA 3MDQA 3IUCA 3G4SN 4ZHRA 4CHNA 4BRFA 2ZGZA 3CPWM 3A2FA 1FKOA 3ZX3A 1VSKA 4EP5A 3NH1A 5FPNA 3F73A 3ZX0A 3CJ7A 1IBLK 1SQKA 3FZFA 4B9MA 3WNGA 4BDYA 3PLAA 4KHNA 1CZ9A 3WQUA 4KH6A 1NK0A 4DSLA 5FPDA 3HP6A 4Q5VA 1VQKN 3B6OA 3ZX2A 5JMVA 4BRAA 4N41A 2O8BA 2O8BB 3WXJA 3QNNA 3MK6A 3A8YA 1YJ9N 4FVUA 4BRCA 5I3UA 2E20A 2P9UB 4LSLA 4W5OA 2YX6A 4XIUA 3A5LC 3QBXA 1DLOA 3VQ6A 1TAUA 1NU0A 4FPAA 1GLCG 4F9OA 2FXUA 1MWKA 3IMXA 3NBPA 3AA3A 1QQOA 4L3QA 4KHSA 3SMPA 4NB4A 1ASVA 4JEPA 3HOTA 2BANA 1BHLA 5J1EA 3VEYA 5GIPA 2QKBA 1EWRA 1HPZA 3DMJA 4GKKK 1XC9A 2E5LK 4WFAL 1V4TA 4DR5K 4CJUA 2UUCK 1JCGA 4E0DA 1RBSA 4IFYA 4WFNL 3CCJN 3THXB 1B9DA 3LAKA 2GEMA 3T7ZA 3L2WA 2G8UA 4IEEA 4K41A 2OYQA 3AVKA 4DQQA 3V9XA 1KC8O 4PL7A 1I39A 3BGRA 3V9SA 4E7HA 1RILA 1QS4A 2HNDA 1NKBA 1XWLA 3O1BA 4RW8A 3NF9A 1QQNA 1RT5A 4MO5A 1LV5A 5FRNA 4M3RA 3BY5A 4DR1K 4HCCA 4H0TB 2A40A 1OH5A 3O9UA 4DU4A 4JKBA 3OYMA 4O0JA 4KI4A 3I56N 2IVOA 4E7LA 3C95A 3OYJA 3WXIA 5BR9A 3KZBA 1KQSM 4JKAA 2ITGA 5AQUA 4WQ4C 1GLJO 1RTJA 2GBZA 1K8KB 3QLHA 3LZIA 2D1KA 4CBUA 5I42A 1REVA 2IDOA 4DS4A 4FWLA 4Y1DA 3TAQA 5LMUK 2O8DB 4CJTA 1T8EA 5FDLA 4TSXA 2HBJA 4WF9L 4CGIA 4HHTA 1BU6O 3Q7BA 5MLCQ 2IGIA 4CESA 1RBRA 1RT7A 1L5UA 3CC7N 3KTQA 1NBWA 5ADXA 2UXDK 3SNNA 1JJ2M 3AA5X 2O8CA 2HBMA 5HBMA 3C94A 4CEAA 2PYLA 3AVIA 3E9OA 2RPIA 1LWCA 3HPHA 3VQ5A 3PUFA 1WLJA 1VSIA 1LW0A 4DSIA 2YJEA 3M8QA 3ZSOA 3ZLJA 1NGIA 1A5WA 3K5MA 4CHPA 4FZYA 2F9TA 1U2VA 1C1CA 1TYQA 3BF1A 2HF3A 4DSEA 4RW4A 3OHRA 1NK6A 2ITMA 3QINA 5AQGA 3G25A 3MN9A 4LF4K 2E6MA 4NLCA 4I9QA 4CEFA 4QS7A 3LM9A 3FGUA 4BQLA 3QB0A 3LWLA 3QNOA 3QERA 1VRUA 3DXMB 4HUGA 1O1WA 4BREA 3FE1A 4FWRA 1NMDA 3LPTA 1D4XA 4J2DA 1NKCA 2G8KA 1VQ8N 1YJNN 1ATRA 4JI4K 3WQTA 2Z1IA 3L2VA 5LJVA 3ID6A 4CVNE 3ZSVA 1NKEA 2DFHA 1JCEA 3KIOA 3VGLA 4DF4A 1SL1A 1EWQA 4HCBA 4Z4IA 2HNZA 1RTIA 2P9NA 4E1MA 3VF4A 2DTUA 3O5BA 5AZJA 5FLXO 4LH5A 5KTQA 3THWA 3MWTA 1HKGA 3O80A 4QOZB 4CJVA 5AQMA 1KRPA 4CEOA 2EWSA 2VWBA 3AGRA 3QIPA 3T1YK 2IC3A 2NRZA 4DV4K 5M1QA 2NRHA 3ISNC 4CF8A 2GUIA 4K8XA 4Z4CA 1NK8A 1U45A 3ZSQA 1UAXA 2HVHA 2HHTA 4EP4A 1JLAA 1X3NA 2O8EA 2O8EB 3U9ZA 2IVNA 2Q97A 2Y1JA 5AQFA 4BVOA 3KK2A 1S1VA 4C8OA 1FJGK 3NH0A 2E2PA 4CZHA 4X66K 5BPNA 4NXMK 4B3OA 2I5JA 3ZT4A 2OANA 3HM8A 4OX9K 4O44A 3AVBA 5BPMA 3H3NO 3ZSRA 4O8UA 1J9AA 3TAMA 2P9LA 4BG8A 5AQIA 1CLQA 1H1VA 1YUWA 3KLFA 2I7NA 4W5TA 2V52B 3VERA 1XMQK 4EIAA 5CYQA 4KB1A 1NOZA 4OO1J 4MLEA 4FLVA 4IJAA 4NO7A 3D45A 3L3VA 4A5AA 5AFUH 5AR0A 1T3VA 2QWPA 2AA4A 5E41A 3PX4A 4QS8A 4XH5A 3LWMA 1SV5A 3L4IA 4JRQA 4BC2A 1N32K 3VQ9A 4PKIA 4E1NA 2XHBA 1NJXA 5EY4A 2NNWA 3H1QA 3GL1A 3TU5A 4DR6K 2FC0A 4GV6A 2DPNA 1ZBSA 3RVCA 1L3SA 5C0YA 3SUPA 3CCQN 2UXBK 1FK9A 3S9HA 3OW2M 4LF8K 5B8HA 3A5MC 3C6AA 5CYMA 1NJYA 1RTDA 4DTXA 5HOOA 3CCUN 4A62A 4XH4A 3LZJA 2A6AA 1ZXOA 4DTNA 4CJ5A 1U49A 1XNRK 4JKFA 4QS9A 4BROA 1BG3A 1KSPA 1VQ6N 5D3GA 3KWIA 4DQRA 3M8PA 3U3GA 4CF9A 1N6QA 1BGXT 4DQPA 4EZ9A 3CMAN 3P39A 2P9IA 1EX4A 4JD2B 2ZM6K 1R59O 4OLAA 4DTSA 2HSTA 4U7BA 3VQ4A 3VPZA 3SJHA 3T3FA 1RTHA 4EHTA 1HR0K 4H4MA 2E1ZA 3VA0A 4HUFA 4IEIA 1BIUA 4K8ZA 5AQKA 3MX5A 1OH6A 1RFQA 4IDHA 4FLUA 3THYA 3TABA 4N56A 4FOEA 4BRKA 1D9FA 3HVTA 1Q9YA 4YOVA 3L2RA 1KTQA 2FBVA 5M1KA 2E8AA 2A3ZA 3N4PA 2PZSA 1TKDA 2BGGA 4KKOA 1HPMA 4X64K 4E7KA 1DT9A 3O9QA 2LSNA 4FL9A 1EQYA 1W7AA 5HRRA 1ITGA 5A2QO 1QZ5A 4CD3A 3AVFA 4DSKA 2O8CB 3D6RA 2E1YA 3ULEB 1NK4A 4YFUA 4B8CA 3VQBA 1XC3A 4M45A 4C1NK 3QICA 4FLZA 5HRPA 2YI1A 1C6VA 1ZBHA 2GX9A 3CHWA 3LDSA 2NRWA 2ZGYA 1YITN 2YHBA 2W40A 3SUOA 4LFBK 3ZT1A 3U6FA 1YI2N 3H6EA 2YKNA 4WQ5C 2WOMA 4M3YA 2WC9A 5AQLA 3DLKA 4KB0A 3IKMA 1LOTB 3VESA 4JI8K 3DLEA 4BRNA 2VG7A 3FFKB 4B9QA 2A1SA 4JHDB 3JYTA 4B3RK 4B3SK 1FW6A 3KJVA 4CJPA 1MA9B 3WNHA 3O6WA 3E1YA 3OS0A 4JKGB 3I33A 3NVMA 1TYQB 3A0IX 3LP1A 1LWFA 3JXUA 1JLCA 4JS4A 2VWJA 3QETA 3CJ1A 4Z4FA 5M1OA 1U47A 2G8HA 1JL1A 1YVNA 4DV3K 2W41A 3CG7A 1S9GA 4JS5A 1GOBA 1K8AO 4G1QA 4HUEA 4FWOA 1GLEG 3F9MA 2BH1A 2Q0RA 3LDQA 4FYDA 2HB5A 4ILJA 4NYFA 4M3WA 1G99A 2YCHA 3FZHA 5J2NA 3K5NA 2HVIA 3SUQA 1WAFA 3SBGA 3PIOL 4DS5A 3AAQA 4BRGA 3OY9A 1KD1O 3DJCA 3SMSA 2Z1JA 1IG8A 1KAZA 4ID1A 1VSDA 1VQLN 2KTQA 1D9DA 4LF9K 4JRPA 2B6AA 1MWMA 3EO3A 4ISEA 3ENOA 2QEXN 1Z05A 3WXKA 3LP0A 4GV9A 1TL3A 3K5OA 3DLLL 5CZ1A 3NAEA 3LDNA 3VQPA 1JLEA 4IO8A 1F21A 3I0RA 4PWDA 4B9SA 2ASMA 3ULDA 3SQ2A 2AP1A 3H46O 2GELA 4CE9A 4FCYA 1N36K 3SQ4A 1EO1A 3R9PA 3C65A 2H3GX 1Z6RA 3NFAA 3RMDA 5AQNA 5KI6A 4JKCA 3LDLA 4KREA 1NGEA 4FK0A 4R79A 3V9WA 1QSLA 4CEQA 2YNHA 3CMEN 4E1JA 2O8FA 3O9RA 1WSGA 4U67L 4AHVA 5DK5A 2OPRA 3LPUA 5GAHP 4ELTA 1CZBA 1G15A 4CZEA 4DTMA 1RDAA 3CIPA 2Z1GA 2BE2A 3A5OC 3SZ2A 3TARA 3KLGA 3PSFA 3VF6A 1WB9A 3AO5A 1O13A 1X1PA 1S1XA 4FVMA 3THVA 1S9EA 3THXA 2RF2A 1GOCA 4PUOA 5BRFA 1GLFO 2YV0X 4YOWA 1RBTA 2HHHK 1TKXA 3F5TA 2ETJA 5AJ3K 4C8NA 1WNSA 3QDKA 3ENHA 3G10A 3HL8A 3M1FA 1JLFA 2D0OA 4WFBL 3M5RA 3TAGA 4CHYA 3QEIA 4H4OA 3EY1A 1TKTA 2J4RA 3R1XA 4CZFA 3VETA 3RTVA 4JHDA 3BEXA 2BTFA 2P9SA 2Q36A 3MXMA 3SBTA 2P9IB 2P9SB 1RNHA 2QXLA 4Z0UA 4OPKA 4FZZA 5CR4A 1ZBLA 4K25A 4QAGA 4YOTA 2F7TA 4CFBA 1ZBUA 3VEOA 3GOIA 2P5OA 3M8SA 2P9KA 2G8VA 3KWGA 1VQMN 4H0XB 2ASOA 4C8KA 4BGBA 4DFPA 4JN4A 3IG1A 1P90A 5KGWA 3VEWA 3TTDA 2Z1HA 3QEVA 3MXJA 1N8RO 3OYLA 2YNFA 3UE5A 3P31A 4BDZA 5J2PA 1VSMA 3M3ZA 4K0KK 1HLUA 4KAZA 1WUAA 3CCLN 1GLLO 3J7AP 1J53A 2HOEA 3WUHA 1IH7A 2PFUA 2YNGA 3PV8A 3OTOK 5I9EB 2OTJN 4GKJK 2D0AA 3BF3A 3UKRA 4X65K 3G6EN 5F2RA 4DFJA 4CECA 1NK9A 4GMJB 5CHIA 3KD5E 2B4JA 3OJSA 5AQSA 1RDWX 5K14A 2E88A 4I2QA 3S3OA 3SV3A 2P9UA 1ZYQA 3K59A 3HPGA 2RE2A 1U2VB 2IIRA 1W0HA 2D5RA 4ELUA 4CFAA 2OZMA 4XH1A 4WQ4A 2YKMA 2ZD1A 3EN9A 1M90O 3SQ1A 1HYSA 2PAVA 4PHTX 3OYKA 4OPAA 3HSTB 1A5VA 4BVPA 3L6QA 3EZ5A 1I3AA 3T19A 1S5JA 1LWEA 1RT6A 1GLAG 1VHXA 4CIGA 3D2FA 5JS1A 2WUSA 5TKYA 1KAXA 1VQ7N 4GNIA 5AQJA 4CEEA 3DI6A 2Y1IA 3J81O 1C1BA 5AQXA 4FXDA 3OYHA 5IT9O 3G0ZA 5KGXA 2W6KA 3M8RA 3VF2A 1HJOA 4CK1A 4FJJA 3MWPA 4OPJA 3MEDA 4LF5K 3K0SA 4CIEA 2QWNA 4CEZA 2HW3A 4CJLA 3G71N 3AVGA 3CJBA 4E89A 1TK8A 3AVNA 3S41A 3J7YP 3CF5L 1C0UA 5GIOA 5AFUA 1YXQA 2HF4A 3MN7A 1ESVA 1BA0A 2P9NB 1S3XA 1UWBA 2EHGA 3IFRA 1IKWA 4IFVA 1C0MA 4OJRA 4W5RA 1NGFA 1TGOA 4FWMA 1NK5A 3DOLA 1IO2A 2XRIA 3J80O 1QVGM 4K43A 3IDHA 2OPSA 2ZJQL 4NXNK 3E9LA 4FSVA 2XY7A 4DF8A 4O55A 1KVBA 4KHPK 4FJGA 1IJJA 3CCSN 4DTRA 3KK1A 3VQAA 2WTUA 3SJJA 3MX2A 1NGAA 1Z25A 2JWLA 4GW6A 3ZCMA 4YHHK 4AHTA 3CQYA 2E2QA 1E4FT 4M3UA 5AQZA 5AQVA 1NM1A 3FZMA 4FLXA 4PY5A 3HM9A 3AO2A 3C7NA 2F9WA 3K58A 4A2BA 3CJ9A 3R6MA 4KTWA 3OJUA 3I0SA 5M1FA 4CGGA 2PYJA 1RBVA 4OPHA 4H5NA 5AZJB 2GTDA 3VMFB 4BDPA 5AZIB 4CW7B 3PO4A 2X78A 2WONA 1QQCA 4IOCL 3CM5A 3GDQA 4IZ9A 4BG9A 3OA9A 4AM7A 4E3SA 1HMVA 4LF7K 3WT0A 3H08A 4FW2A 2HHSA 4UQGA 1K73O 1EP4A 5SWMA 1RBUA 4B8AB 4E7IA 1KVAA 1LCUA 3OYCA 3DXKB 3CYMA 1SL2A 4X62K 5AQWA 1NK7A 4FOIA 2RKIA 3CQXA 4RW9A 5KRTA 2FSNA 3AVLA 4CZLA 1J5EK 1I94K 4WE1A 4BR0A 1SAZA 4DQSA 4BRLA 5LL6Z 3CI5A 1WAJA 3NF7A 2OTLN 1Q8IA 4JYAK 3GE1A 3LDPA 1VAZA 2OCEA 1EKEA 1XHXA 1BI4A 3V4IA 1YTAA 4JKEA 1BA1A 4I6MB 5SZTA 4IJNA 2VQEK 1WSIA 1IKYA 4RW7A 3QMLA 5FROA 3LDOA 4W5QA 1BCOA 1Y64A 3AARA 3ATVA 2W6LA 1NGJA 4BR9A 3EYZA 4M63C 3SPYA 4BGAA 1CXUA 3CCMN 1TVRA 4DFKA 3VN5A 2CGKA 1FXXA 5CE3A 4AHSA 3DOKA 3EZWA 3RSEA 2HBLA 2ASPA 4YDUC 3ZSWA 1KLMA 5DM6L 1KLNA 3W3DA 2FSKA 4DMNA 2QW9A 2V7YA 4DR3K 2QI2A 3FZKA 2O8DA 1FKPA 4YORA 3I8DA 2QM1A 3WEEA 1Q81O 4FJXA 2FBXA 1WSFA 2VG5A 1NMNA 3UB5A 3V1QA 4J2BA 4BRMA 5C2DA 4AH9A 4DSJA 5C15A 1VSFA 2E6LA 3CC4N 3CCEN 1MU2A 3D7EO 2F4VK 4CFCA 5HP1A 3K2PA 4DHYA 4IKFA 4BQZA 1ZC6A 3EE8A 3UKUB 4BACA 2ZQBA 5JLHA 5TKWA 4CF2A 4WQ5A 4JNEA 4Z4HA 4JV5K 4XEIA 3MXIA 4F4KA 3ALYA 3QFUA 4A2AA 1XI1A 3TSQA 3AVMA 1BISA 3LANA 3MCAB 2Q0UA 1TK0A 5AZIA 4AQYK 4FJ8A 4PQUA 2QWMA 4MDBA 1HKBA 1VSJA 1XNQK 1HQEA 4I2PA 4DSFA 4AHUA 1YTUA 4W5NA 2YJFA 3ENBA 1Q86O 2UUAK 1Q7YO 2Q2RA 1X3MA 4GY2B 4BWJA 4ELVA 1TUUA 3HPOA 3HBTA 2HHWA 4M7XA 5BR8K 4JI2K 1BQNA 4IFEA 3V1RA 4DV6K 1JKHA 4A5BA 1HNXK 4KH5A 3VEZA 3V6DA 4DV0K 2FBYA 4FWQA 4O5BA 2YNIA 1HUXA 5GADP 1HRHA 3KVGA 3L3UA 1SKWA 4Q0BA 4FK2A 1ZBFA 3DAWA 3HJFA 3VQ7A 1QVFM 1UA1A 4J2EA 4KPYA 4IOXA 1T03A 5KPZA 2P9PB 1QTMA 1XQSC 1Y97A 4H03B 3TI0A 4WYBA 1RT1A 2A1RA 4A59A 5HL7L 4YY3K 2VCPA 5KPRA 1QSYA 3EKUA 1BO5O 4NLBA 4CI6A 4DFMA 2NRRA 2NRVA 4ILHA 3GBTA 3CQ8A 1IV0A 1S1WA 4DB3A 3S3NA 1MDUB 3O4WA 4LFAK 1C0FA 2HHVA 4H0OA 4CHZA 4EAHD 5JVGL 4CJFA 4DLEA 4PA1A 3TSPA 2HBKA 3IS9A 4DV5K 2JGUA 1VQNN 5E26A 1JL2A 3F2KA 3KLIA 4ZTFA 5BRHA 3HK2A 4EFHA 3H1VX 4JK9A 2HMPA 2DFFA 1NLVA 4CFDA 2E2NA 4B1UB 3PIPL 3KLEA 3QEPA 5HRSA 3NGZA 4B08A 3ITHA 4RG8A 3EEQA 3ZT3A 2QA4N 5KQ8A 4AILC 2E2OA 2NUBA 1KXPA 3D0PA 1S1TA 2KFZA 5E84A 3O3GA 3EE9A 1J54A 3OYEA 4UY8O 3VEVA 2KQ2A 2KZZA 4H5RA 2W42A 4BRPA 4NCBA 3BZCA 3L0QA 4FJ9A 2CH6A 1DTQA 3HYFA 4HWIA 1D5AA 1ASWA 2O4GA 4C1NI 1U6ZA 3OBYA 1JXBA 3DLRA 1TKZA 1NJIO 2A5XA 4V19S 2GWKA 1KCFA 4A57A 4DU1A 2BUPA 4KO0A 1K8KA 1S6QA 2P9LB 1BCMA 4JI0K 3IRXA 1OKJA 3PX0A 1M1KO 2DFEA 1V4SA 4BRHA 4CJWA 5KQDA 3ASMA 1NGBA 2Q1NA 2UYTA 4BR5A 3PSIA 1IKVA 4AHRA 2UUBK 1T44A 1NGDA 3RMCA 2PY5A 3L2UA 1RGIA 4CZMA 4F2RA 3PO5A 2ZWHA 4FPBA 3U8XA 4B1WB 4CJRA 1Q18A 3ZETA 1TL1A 5AQHA 3SAHA 4CJEA 2ZE2A 3RR7A 1W97L 5AQRA 4BC4A 2FSJA 3LALA 5HRNA 1RCHA 3HTVA 5C2FA 4ZTJA 4FK4A 4H5TA 3O1WA 5AQPA 4FLTA 2JLEA 4CJKA 1WBBA 4IDKA 2B5JA 4BWMA 3V9ZA 3BZKA 1S72N 3CFOA 2WFBA 3SI6A 4KFBA 1S6PA 4CBWA 3HSCA 3MN5A 3ZT2A 3TTFA 2QWLA 4LC9B 3TSUA 3ZETB 3NVKA 1R0AA 4FJHA 1U4BA 3U9DA 4DWIA 1OH8A 2IOCA 2FBTA 3WEEB 1P8ZA 3AVHA 4GVMA 4O4GA 1QHAA 2E4LA 2YHWA 3BDPA 4FWSA 3P4IA 1WSJA 3SLCA 4BC3A 1VQ9N 3AA2A 5DMRA 4JI3K 4H5WA 4GVEA 1X9SA 4HTLA 1KFDA 4I9LA 4AM6A 4K42A 4Y1CA 1NGGA 4MDAA 4CHQA 1SUQA 3AO1A 3JS6A 4G9ZA 2VYPA 5C42A 4YDUA 5JVHL 2HMIA 4B9NA 4KHQA 3O4QA 4FJ5A 3D2EB 2YHXA 3LAMA 3SAFA 3HVRA 5AQTA 3NHGA 1LAWA 1RDUA 4MLHA 3QIOA 1VQON 1JCFA 3HI0A 1RDDA 5EVZA 3C0BA 1Q9XA 1SZ2A 3DLGA 4AHCA 4DV2K 3ATUA 2OZSA 2A42A 1VQ5N 3MAQA 4FJ7A 4J2AA 3OYDA 4BC5A 3NMUA 4CCHA 3CD6N 4FO0A 4JKGA 4FJNA 5AQOA 2KW4A 3E9PA 2IVPA 1E3MA 3ZSYA 3QBWA 3NCIA 4IG0A 5AQYA 5ADXH 3AGKA 1GOAA 1BI4B 4KRFA 2CGJA 3SYZA 3RMBA 1T7PA 4BE1A 1C1AA 2ZJPL 2I7PA 3K9KA 3FR0A 1YF5L 2V51B 4M3XA 1KVCA 1C0GA 1BIZA 2F96A 1YT3A 4DCHA 1Q82O 1LAVA 1SS6A 1OVQA 2PBDA 2HHQA 4L8RB 2X6SA 1L3TA 2RHKA 4N47A 3MN6A 3CCVN 3CJCA 1HNIA 1VRTA 4MFBA 3AO3A 3HT3A 1VSLA 2P9PA 3NF6A 1DEJA 4NCGA 2XY5A 4F8RA 4JI7K 4MQ3A 1TUYA 1QHTA 5F0XA 3KHYA 2Q3SA 1D8YA 3OS1A 2P9KB 1LW2A 4KBOA 3MMVA 1RDCA 2KKZA 4DV7K 4KV8A 1EXQA 1J6ZA 2XY8A 3DRPA 4FJKA 3TANA 1ATNA 3L4QA 1NJWA 2QWOA 3FFIA 1X9MA 2QK9A 4CF0A 3V1OA 5M1NA 4FWKA 5LY3A 4CZJA 3FZLA 5EU7A 3C6HA 1RT2A 2NZTA 1IKXA 4B1XB 3OYNA 3RRGA 5F1XA 3B6PA 3KKSA 3ID8A 2P5GA 4JI5K 4KTQA 3L8BA 4BR7A 4CJ3A 3KLHA 3V9UA 4JAXA 1NG9A 2GV9A 4OKEA 2KHOA 5CZ2A 2OA8A 4M3TA 5GAGP 4KHYA 3T69A 3K5LA 1BUPA 1YHQN 3DRSA 3P83D 3MEGA 4FZXC 4RTFD 3TR8A 3J8AA
chains in the Genus database with same CATH topology
3OS0A 4DMNA 4XIUA 1S1UA 1FKPA 3LP1A 1LWFA 1DLOA 1JLCA 4JS4A 3I8DA 4CF1A 2VWJA 3VQ6A 3QETA 4FJXA 2FBXA 1WSFA 2VG5A 4CGDA 1U47A 2G8HA 4Z4FA 1JL1A 3V1QA 1TAUA 4J2BA 3AV9A 3CG7A 4AH9A 1S9GA 4JS5A 4DSJA 1VSFA 3DRRA 3OYFA 2E6LA 1GOBA 1MU2A 2O4IA 1ZBIA 4G1QA 4HUEA 3WNEA 3NBPA 3AA3A 3TAFA 3AA4A 4CFCA 4KHSA 4FYDA 5HP1A 2HB5A 1ASVA 3K2PA 4NYFA 4M3WA 2BANA 1BHLA 3LP2A 5J1EA 4IKFA 2QKBA 4BACA 1HPZA 2ZQBA 3DMJA 3NDKA 5J2NA 3K5NA 1XHZA 1XC9A 3SUQA 2HVIA 3UIQA 1WAFA 3KD1E 4CF2A 4CHOA 1T05A 3RWUA 3PX6A 4CJUA 4DS5A 4Z4HA 3T1AA 3MXIA 1A5XA 3DM2A 3OY9A 4F4KA 3ALYA 4IG3A 4IBNA 1XI1A 3TAGA 4E0DA 3AVMA 1BISA 2VG6A 3LANA 3VA3A 1RBSA 4IFYA 2Z1JA 3ZSXA 1TK0A 4FJ8A 4PQUA 1B9DA 3LAKA 4DG1A 3NE6A 4OGEA 3L2WA 4ID1A 1VSJA 4M41A 3CFRA 2G8UA 1VSDA 2OYQA 1HQEA 1JXEA 4I2PA 5C25A 3NGZA 3AVKA 4DQQA 2KTQA 1D9DA 4DSFA 4AHUA 3V9XA 1YTUA 2VWKA 4W5NA 4JRPA 2B6AA 1I39A 3BGRA 3V9SA 4E7HA 4FLYA 1RILA 1QS4A 2HNDA 2QKKA 1NKBA 1XWLA 4CJ4A 4BE2A 3NF9A 1VSHA 3AVCA 1RT5A 3LP0A 4RW8A 4BWJA 1TL3A 3K5OA 4CJSA 5CZ1A 1JLBA 4M3RA 3NAEA 3HPOA 4ELVA 1UA0A 2HHWA 3VQPA 4OGCA 1JLEA 2ATQA 4HCCA 1F21A 5C24A 3I0RA 4PWDA 1TK5A 4B9SA 2YHAA 1BQNA 2KFNA 3ULDA 3SQ2A 3V1RA 4DU4A 3OYMA 4O0JA 3DLHA 4B9VA 4KI4A 1JKHA 5KRSA 4E7LA 3C95A 3OYJA 4CE9A 3V6DA 4FCYA 2G8WA 3SQ4A 2FBYA 3NH2A 4O5BA 2YNIA 1HRHA 4F3TA 1Z26A 1SKWA 3L3UA 2ITGA 3NFAA 4Q0BA 4FK2A 3JSMA 3RMDA 1ZBFA 5KI6A 1RTJA 3TAPA 3RRHA 2GBZA 3HJFA 4KREA 3CM6A 3QLHA 3VQ7A 4FK0A 1KFSA 4QCLA 3AVAA 3LZIA 3V9WA 1UA1A 2R7YA 1QSLA 4CEQA 4Z4EA 4J2EA 2HHUA 3O4NA 4KPYA 4CGHA 2YNHA 1REVA 5I42A 1WN7A 2IDOA 4F8RA 4DS4A 1T03A 4Y1DA 3TAQA 1QTMA 1WSGA 4DTUA 4AHVA 5DK5A 1Y97A 3TI0A 3RR8A 2OPRA 3LPUA 1RT1A 3NGYA 2A1RA 4ELTA 4CJTA 3AVJA 1CZBA 1G15A 1T8EA 5FDLA 1QSYA 4TSXA 4DTMA 1RDAA 4DFMA 2Z1GA 2BE2A 4CGIA 4HHTA 3PY8A 3OS2A 3CQ8A 3SZ2A 1S1WA 3TARA 3KLGA 3S3NA 2IGIA 4CESA 1RBRA 3AO5A 1RT7A 1L5UA 2HHVA 1X1PA 4CHZA 1S1XA 4FVMA 3THVA 1S9EA 4E7JA 3KTQA 4CJFA 2RF2A 1GOCA 4PA1A 4DLEA 3SNNA 3WNFA 4PUOA 2YV0X 1RBTA 3IS9A 1TKXA 2JGUA 3E01A 3AA5X 3KK3A 1JL2A 2ETJA 2AJQA 4E19A 3C6TA 3KLIA 4C8NA 4ZTFA 1WNSA 5HBMA 3C94A 4CEAA 3HK2A 3G10A 3HL8A 2PYLA 2DFFA 3AVIA 1JLFA 4CFDA 2HHXA 3KLEA 4CEBA 3QEPA 2RPIA 1EETA 1LWCA 3HPHA 1ASUA 3VQ5A 4B08A 3PUFA 1RT3A 1WLJA 3ITHA 4CHYA 3QEIA 4H4OA 4RG8A 3ZT3A 1VSIA 1LW0A 4CGFA 3O3FA 3EY1A 4DSIA 1TKTA 4DTPA 3M8QA 3RTVA 3ZSOA 4AILC 2NUBA 4ICLA 3SQ0A 3D0PA 3DLBA 1S1TA 2KFZA 3O3GA 4F2SA 1B9FA 1A5WA 3K57A 3MXMA 1J54A 1RNHA 4Z0UA 3OYEA 4CHPA 3K5MA 4FZYA 2KQ2A 4OPKA 4CEDA 4KHUA 2KZZA 2XY6A 2W42A 4FZZA 3VQ8A 1C1CA 1ZBLA 4QAGA 4NCBA 1HYVA 4OVLA 4DSEA 4RW4A 1NK6A 4FJ9A 4CFBA 1DTQA 1ZBUA 2P51A 3HYFA 3QINA 4ID5A 2P5OA 1C0TA 1D5AA 4LY7A 1ASWA 2E6MA 2O4GA 3M8SA 4DLGA 4I9QA 4CEFA 4I7FA 2G8VA 3HO1A 1JXBA 3DLRA 1BQMA 1TKZA 4C8KA 3LWLA 3QNOA 4DFPA 1VRUA 3QERA 1LV5A 3IG1A 4HUGA 5KGWA 1O1WA 2HNYA 2Z1HA 4NYNA 3CFPA 3QEVA 3MXJA 3LPTA 1KCFA 4DU1A 3OYLA 4J2DA 2YNFA 1NKCA 4KO0A 2G8KA 1S6QA 3F9KA 4BDZA 4B9UA 1BCMA 3IRXA 3NF8A 3PX0A 5J2PA 1VSMA 4FM0A 2DFEA 4CJWA 3ASMA 1W9HA 4C8LA 3RMAA 1K6YA 2Z1IA 4DTJA 3L2VA 3HP9A 1QE1A 4OKKA 4KAZA 3ZSVA 1SKSA 1NKEA 2DFHA 1J53A 2RN2A 4EZ6A 1IKVA 2F8TA 3OVNA 4AHRA 1IH7A 4LH4A 3PV8A 2YNGA 1SL0A 3KIOA 1WSHA 4DF4A 1SL1A 3OYAA 4HCBA 4Z4IA 3NGIA 3RMCA 4KHWA 4FM1A 2HNZA 3VQQA 2PY5A 1RTIA 1JLQA 2D0AA 4E1MA 4FJIA 2DTUA 3L2UA 4DQIA 4F2RA 3VQCA 3PO5A 5JS2A 4CJRA 4DFJA 4LH5A 1TL1A 4CECA 4CK2A 5KTQA 1NK9A 4GMJB 4CJEA 4CJVA 5T7BA 1KRPA 4B9LA 4QOZB 2ZE2A 4CEOA 3RR7A 3KD5E 2B4JA 3OJSA 3QIPA 3OYIA 5K14A 4LSNA 3QESA 3LALA 2IC3A 5HRNA 1RCHA 4I2QA 3TAEA 3S3OA 1TV6A 2EX3A 3SV3A 1ZYQA 4ZTJA 3SPZA 4FK4A 3ISNC 3K59A 4CF8A 2GUIA 3HPGA 4FLTA 4K8XA 1W0HA 2D5RA 3ZSZA 4CFAA 4Z4CA 2JLEA 1U45A 1NK8A 1N5YA 2OZMA 5FRNA 4CJKA 3ZSQA 1UAXA 3L2QA 3KKRA 4IDKA 4N5SA 2YKMA 2ZD1A 2HVHA 2B5JA 4BWMA 3V9ZA 2HHTA 4EP4A 1JLAA 4DU3A 4YNQA 2Y1JA 3P1GA 3SQ1A 1HYSA 4HVJA 3CFOA 3OYKA 3KK2A 1S1VA 4C8MA 3HSTB 4C8OA 3SI6A 1A5VA 3NH0A 4NCAA 4KFBA 1S6PA 1IG9A 2D0CA 1J5OA 3IAYA 3EZ5A 1I3AA 3T19A 4B3OA 2I5JA 3ZT4A 3ZT2A 1S5JA 4FJLA 1LWEA 1RT6A 3AVBA 4O44A 2D0BA 3ZSRA 4CIGA 1KLNA 4FJMA 1J9AA 3TAMA 5JS1A 1YVUA 1R0AA 1L3VA 4FJHA 1CLQA 1U48A 3KLFA 4CEEA 2Y1IA 3DI6A 1U4BA 4W5TA 1C1BA 4DWIA 1UOCA 3SUNA 3OYHA 1SKRA 4FXDA 2IOCA 3G0ZA 2FBTA 5CYQA 1DTTA 5KGXA 4KB1A 3M8RA 1NOZA 4CK1A 3AVHA 4FJJA 4GVMA 4O4GA 2E4LA 4FM2A 4OPJA 4FLVA 3MEDA 4Z4GA 3BDPA 3D45A 3L3VA 2HW3A 1WSJA 4CIEA 4CEZA 4CJLA 2OPPA 3AVGA 4CGJA 4E89A 3LP3A 3AA2A 5DMRA 5E41A 1JLGA 1HNVA 3AVNA 3PX4A 1TK8A 4KTZA 3LWMA 1SV5A 2BDPA 1C0UA 4DTOA 4JRQA 4CIFA 1X9SA 1NOYA 4OKJA 1KFDA 2IAJA 4I9LA 2IS3A 1UWBA 2EHGA 2XO7A 1U04A 1CXQA 3VQ9A 1IKWA 4IFVA 1C0MA 4Y1CA 4CHQA 4E1NA 3O3HA 1SUQA 2XHBA 3TWHA 4OJRA 1NJXA 3AO1A 4W5RA 1HQUA 1TGOA 1NK5A 3DOLA 5C42A 1IO2A 2HMIA 2FC0A 2XRIA 4B9NA 4BE0A 4KHQA 2DY4A 3QEXA 3O4QA 4FJ5A 5J2MA 3LAMA 1L3SA 2OPSA 1HYZA 2XY7A 3SUPA 2F8SA 4DF8A 4O55A 1FK9A 2OPQA 3P5JA 1KVBA 3HVRA 3SCXA 3S9HA 3MECA 3NHGA 1LAWA 4RW6A 4FJGA 4B9TA 4DTRA 3KK1A 3QIOA 3VQAA 1RDBA 5HROA 3SJJA 1RDDA 1Q9XA 1Z25A 4M3ZA 3C6UA 3DLGA 1B92A 4AHCA 5CYMA 4GW6A 1NJYA 3OYGA 1RTDA 4DTXA 3ZCMA 2OZSA 4AHTA 3TR8A 1RT4A 3MAQA 3LZJA 4M3UA 1QSSA 4DTNA 4CJ5A 1U49A 4O0IA 4J2AA 4FJ7A 3OYDA 5CY4A 3QEWA 4CCHA 4FLXA 4PY5A 2X6NA 4FJNA 3HM9A 1KSPA 2KW4A 3AO2A 5D3GA 3K58A 4DQRA 3M8PA 3ZSYA 3NCIA 3U3GA 4IG0A 3DYAA 3I0SA 4KTWA 4CF9A 3OJUA 1GOAA 4CGGA 2G8FA 1BI4B 2PYJA 2P1JA 1N6QA 4KRFA 1RBVA 1BGXT 3SYZA 4JLHA 3RMBA 3SV4A 1T7PA 5HLFA 4DQPA 4EZ9A 4BE1A 4N76A 1C1AA 1EX4A 4BDPA 4KI6A 3PO4A 3VQEA 4OLBA 4OLAA 4DTSA 2X78A 4M3XA 1KVCA 2WONA 1QQCA 1BIZA 2F96A 1YT3A 3CM5A 3VQ4A 2QXFA 3T3FA 1LAVA 1RTHA 4E3SA 1X9WA 2HHQA 4ELUA 1HMVA 4H4MA 1HJRA 3VA0A 4L8RB 3H08A 4HUFA 2X6SA 3AO4A 1L3TA 4N47A 1BIUA 4K8ZA 4FW2A 4FLWA 2HHSA 1HNIA 4FW1A 4UQGA 1VRTA 3V81A 4MFBA 4LD0A 4FLUA 3AO3A 3S3MA 3HT3A 3TABA 3HXMA 1VSLA 4N56A 1EP4A 4H8KA 5SWMA 3NF6A 4NCGA 4HTUA 2XY5A 1D9FA 4CERA 1RBUA 1TAQA 1VK0A 3HVTA 3VQDA 1Q9YA 5FRMA 2X74A 4MQ3A 1KTQA 2FBVA 1QHTA 3L2RA 2G8IA 4B8AB 4CJQA 2Q3SA 1KVAA 4E7IA 1TKDA 2PZSA 4KKOA 4CK3A 1D8YA 3OYCA 2BGGA 3OS1A 3MEEA 1LW2A 3CYMA 4R5PA 4E7KA 1SL2A 4M42A 1RDCA 4F3OA 4KV8A 1EXQA 1NK7A 2XY8A 2LSNA 2RKIA 4RW9A 5KRTA 3DRPA 4FJKA 5HRRA 1ITGA 3AVLA 3TANA 1NJWA 1X9MA 2QK9A 3FFIA 1WSEA 3AVFA 4DSKA 4CF0A 1NJZA 3ZT0A 4WE1A 3V1OA 5J2QA 3U3YA 1VSEA 4DQSA 1NK4A 4YFUA 4B8CA 3VQBA 3QO9A 2KZMA 1BL3A 1WAJA 5EU7A 3OYBA 1L3UA 4M45A 3NF7A 4ZHRA 4CHNA 1RT2A 4FLZA 5HRPA 1Q8IA 1IKXA 1C6VA 1ZBHA 3LDSA 3RRGA 3OYNA 3A2FA 1FKOA 1EKEA 1VSKA 1XHXA 2YHBA 3B6PA 1BI4A 4EP5A 3NH1A 3F73A 3KKSA 3V4IA 1YTAA 3SUOA 2P5GA 3ZT1A 4B9MA 3U6FA 3WNGA 4KTQA 3L8BA 5SZTA 2YKNA 4CJ3A 4BDYA 2WOMA 3KLHA 4KHNA 1WSIA 3V9UA 1IKYA 1CZ9A 4RW7A 4M3YA 5FROA 4W5QA 3DLKA 1NK0A 1BCOA 4DSLA 4KB0A 3HP6A 4Q5VA 3EYZA 2GV9A 4OKEA 3B6OA 5CZ2A 3SPYA 4N41A 2OA8A 1CXUA 4M3TA 3DLEA 4KHYA 1TVRA 4DFKA 2VG7A 3K5LA 3VN5A 2A1SA 3QNNA 3DRSA 1FXXA 3P83D 3JYTA 4AHSA 3DOKA 3MEGA 4FZXC 3KJVA 5I3UA 4CJPA 3WNHA 3ZSWA 1KLMA 5HRSA 4LSLA 4W5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OS0 A;  4DMN A;  4XIU A;  1S1U A;  1FKP A;  3LP1 A;  1LWF A;  1DLO A;  1JLC A;  4JS4 A;  3I8D A;  4CF1 A;  2VWJ A;  3VQ6 A;  3QET A;  4FJX A;  2FBX A;  1WSF A;  2VG5 A;  4CGD A;  1U47 A;  2G8H A;  4Z4F A;  1JL1 A;  3V1Q A;  1TAU A;  4J2B A;  3AV9 A;  3CG7 A;  4AH9 A;  1S9G A;  4JS5 A;  4DSJ A;  1VSF A;  3DRR A;  3OYF A;  2E6L A;  1GOB A;  1MU2 A;  2O4I A;  1ZBI A;  4G1Q A;  4HUE A;  3WNE A;  3NBP A;  3AA3 A;  3TAF A;  3AA4 A;  4CFC A;  4KHS A;  4FYD A;  5HP1 A;  2HB5 A;  1ASV A;  3K2P A;  4NYF A;  4M3W A;  2BAN A;  1BHL A;  3LP2 A;  5J1E A;  4IKF A;  2QKB A;  4BAC A;  1HPZ A;  2ZQB A;  3DMJ A;  3NDK A;  5J2N A;  3K5N A;  1XHZ A;  1XC9 A;  3SUQ A;  2HVI A;  3UIQ A;  1WAF A;  3KD1 E;  4CF2 A;  4CHO A;  1T05 A;  3RWU A;  3PX6 A;  4CJU A;  4DS5 A;  4Z4H A;  3T1A A;  3MXI A;  1A5X A;  3DM2 A;  3OY9 A;  4F4K A;  3ALY A;  4IG3 A;  4IBN A;  1XI1 A;  3TAG A;  4E0D A;  3AVM A;  1BIS A;  2VG6 A;  3LAN A;  3VA3 A;  1RBS A;  4IFY A;  2Z1J A;  3ZSX A;  1TK0 A;  4FJ8 A;  4PQU A;  1B9D A;  3LAK A;  4DG1 A;  3NE6 A;  4OGE A;  3L2W A;  4ID1 A;  1VSJ A;  4M41 A;  3CFR A;  2G8U A;  1VSD A;  2OYQ A;  1HQE A;  1JXE A;  4I2P A;  5C25 A;  3NGZ A;  3AVK A;  4DQQ A;  2KTQ A;  1D9D A;  4DSF A;  4AHU A;  3V9X A;  1YTU A;  2VWK A;  4W5N A;  4JRP A;  2B6A A;  1I39 A;  3BGR A;  3V9S A;  4E7H A;  4FLY A;  1RIL A;  1QS4 A;  2HND A;  2QKK A;  1NKB A;  1XWL A;  4CJ4 A;  4BE2 A;  3NF9 A;  1VSH A;  3AVC A;  1RT5 A;  3LP0 A;  4RW8 A;  4BWJ A;  1TL3 A;  3K5O A;  4CJS A;  5CZ1 A;  1JLB A;  4M3R A;  3NAE A;  3HPO A;  4ELV A;  1UA0 A;  2HHW A;  3VQP A;  4OGC A;  1JLE A;  2ATQ A;  4HCC A;  1F21 A;  5C24 A;  3I0R A;  4PWD A;  1TK5 A;  4B9S A;  2YHA A;  1BQN A;  2KFN A;  3ULD A;  3SQ2 A;  3V1R A;  4DU4 A;  3OYM A;  4O0J A;  3DLH A;  4B9V A;  4KI4 A;  1JKH A;  5KRS A;  4E7L A;  3C95 A;  3OYJ A;  4CE9 A;  3V6D A;  4FCY A;  2G8W A;  3SQ4 A;  2FBY A;  3NH2 A;  4O5B A;  2YNI A;  1HRH A;  4F3T A;  1Z26 A;  1SKW A;  3L3U A;  2ITG A;  3NFA A;  4Q0B A;  4FK2 A;  3JSM A;  3RMD A;  1ZBF A;  5KI6 A;  1RTJ A;  3TAP A;  3RRH A;  2GBZ A;  3HJF A;  4KRE A;  3CM6 A;  3QLH A;  3VQ7 A;  4FK0 A;  1KFS A;  4QCL A;  3AVA A;  3LZI A;  3V9W A;  1UA1 A;  2R7Y A;  1QSL A;  4CEQ A;  4Z4E A;  4J2E A;  2HHU A;  3O4N A;  4KPY A;  4CGH A;  2YNH A;  1REV A;  5I42 A;  1WN7 A;  2IDO A;  4F8R A;  4DS4 A;  1T03 A;  4Y1D A;  3TAQ A;  1QTM A;  1WSG A;  4DTU A;  4AHV A;  5DK5 A;  1Y97 A;  3TI0 A;  3RR8 A;  2OPR A;  3LPU A;  1RT1 A;  3NGY A;  2A1R A;  4ELT A;  4CJT A;  3AVJ A;  1CZB A;  1G15 A;  1T8E A;  5FDL A;  1QSY A;  4TSX A;  4DTM A;  1RDA A;  4DFM A;  2Z1G A;  2BE2 A;  4CGI A;  4HHT A;  3PY8 A;  3OS2 A;  3CQ8 A;  3SZ2 A;  1S1W A;  3TAR A;  3KLG A;  3S3N A;  2IGI A;  4CES A;  1RBR A;  3AO5 A;  1RT7 A;  1L5U A;  2HHV A;  1X1P A;  4CHZ A;  1S1X A;  4FVM A;  3THV A;  1S9E A;  4E7J A;  3KTQ A;  4CJF A;  2RF2 A;  1GOC A;  4PA1 A;  4DLE A;  3SNN A;  3WNF A;  4PUO A;  2YV0 X;  1RBT A;  3IS9 A;  1TKX A;  2JGU A;  3E01 A;  3AA5 X;  3KK3 A;  1JL2 A;  2ETJ A;  2AJQ A;  4E19 A;  3C6T A;  3KLI A;  4C8N A;  4ZTF A;  1WNS A;  5HBM A;  3C94 A;  4CEA A;  3HK2 A;  3G10 A;  3HL8 A;  2PYL A;  2DFF A;  3AVI A;  1JLF A;  4CFD A;  2HHX A;  3KLE A;  4CEB A;  3QEP A;  2RPI A;  1EET A;  1LWC A;  3HPH A;  1ASU A;  3VQ5 A;  4B08 A;  3PUF A;  1RT3 A;  1WLJ A;  3ITH A;  4CHY A;  3QEI A;  4H4O A;  4RG8 A;  3ZT3 A;  1VSI A;  1LW0 A;  4CGF A;  3O3F A;  3EY1 A;  4DSI A;  1TKT A;  4DTP A;  3M8Q A;  3RTV A;  3ZSO A;  4AIL C;  2NUB A;  4ICL A;  3SQ0 A;  3D0P A;  3DLB A;  1S1T A;  2KFZ A;  3O3G A;  4F2S A;  1B9F A;  1A5W A;  3K57 A;  3MXM A;  1J54 A;  1RNH A;  4Z0U A;  3OYE A;  4CHP A;  3K5M A;  4FZY A;  2KQ2 A;  4OPK A;  4CED A;  4KHU A;  2KZZ A;  2XY6 A;  2W42 A;  4FZZ A;  3VQ8 A;  1C1C A;  1ZBL A;  4QAG A;  4NCB A;  1HYV A;  4OVL A;  4DSE A;  4RW4 A;  1NK6 A;  4FJ9 A;  4CFB A;  1DTQ A;  1ZBU A;  2P51 A;  3HYF A;  3QIN A;  4ID5 A;  2P5O A;  1C0T A;  1D5A A;  4LY7 A;  1ASW A;  2E6M A;  2O4G A;  3M8S A;  4DLG A;  4I9Q A;  4CEF A;  4I7F A;  2G8V A;  3HO1 A;  1JXB A;  3DLR A;  1BQM A;  1TKZ A;  4C8K A;  3LWL A;  3QNO A;  4DFP A;  1VRU A;  3QER A;  1LV5 A;  3IG1 A;  4HUG A;  5KGW A;  1O1W A;  2HNY A;  2Z1H A;  4NYN A;  3CFP A;  3QEV A;  3MXJ A;  3LPT A;  1KCF A;  4DU1 A;  3OYL A;  4J2D A;  2YNF A;  1NKC A;  4KO0 A;  2G8K A;  1S6Q A;  3F9K A;  4BDZ A;  4B9U A;  1BCM A;  3IRX A;  3NF8 A;  3PX0 A;  5J2P A;  1VSM A;  4FM0 A;  2DFE A;  4CJW A;  3ASM A;  1W9H A;  4C8L A;  3RMA A;  1K6Y A;  2Z1I A;  4DTJ A;  3L2V A;  3HP9 A;  1QE1 A;  4OKK A;  4KAZ A;  3ZSV A;  1SKS A;  1NKE A;  2DFH A;  1J53 A;  2RN2 A;  4EZ6 A;  1IKV A;  2F8T A;  3OVN A;  4AHR A;  1IH7 A;  4LH4 A;  3PV8 A;  2YNG A;  1SL0 A;  3KIO A;  1WSH A;  4DF4 A;  1SL1 A;  3OYA A;  4HCB A;  4Z4I A;  3NGI A;  3RMC A;  4KHW A;  4FM1 A;  2HNZ A;  3VQQ A;  2PY5 A;  1RTI A;  1JLQ A;  2D0A A;  4E1M A;  4FJI A;  2DTU A;  3L2U A;  4DQI A;  4F2R A;  3VQC A;  3PO5 A;  5JS2 A;  4CJR A;  4DFJ A;  4LH5 A;  1TL1 A;  4CEC A;  4CK2 A;  5KTQ A;  1NK9 A;  4GMJ B;  4CJE A;  4CJV A;  5T7B A;  1KRP A;  4B9L A;  4QOZ B;  2ZE2 A;  4CEO A;  3RR7 A;  3KD5 E;  2B4J A;  3OJS A;  3QIP A;  3OYI A;  5K14 A;  4LSN A;  3QES A;  3LAL A;  2IC3 A;  5HRN A;  1RCH A;  4I2Q A;  3TAE A;  3S3O A;  1TV6 A;  2EX3 A;  3SV3 A;  1ZYQ A;  4ZTJ A;  3SPZ A;  4FK4 A;  3ISN C;  3K59 A;  4CF8 A;  2GUI A;  3HPG A;  4FLT A;  4K8X A;  1W0H A;  2D5R A;  3ZSZ A;  4CFA A;  4Z4C A;  2JLE A;  1U45 A;  1NK8 A;  1N5Y A;  2OZM A;  5FRN A;  4CJK A;  3ZSQ A;  1UAX A;  3L2Q A;  3KKR A;  4IDK A;  4N5S A;  2YKM A;  2ZD1 A;  2HVH A;  2B5J A;  4BWM A;  3V9Z A;  2HHT A;  4EP4 A;  1JLA A;  4DU3 A;  4YNQ A;  2Y1J A;  3P1G A;  3SQ1 A;  1HYS A;  4HVJ A;  3CFO A;  3OYK A;  3KK2 A;  1S1V A;  4C8M A;  3HST B;  4C8O A;  3SI6 A;  1A5V A;  3NH0 A;  4NCA A;  4KFB A;  1S6P A;  1IG9 A;  2D0C A;  1J5O A;  3IAY A;  3EZ5 A;  1I3A A;  3T19 A;  4B3O A;  2I5J A;  3ZT4 A;  3ZT2 A;  1S5J A;  4FJL A;  1LWE A;  1RT6 A;  3AVB A;  4O44 A;  2D0B A;  3ZSR A;  4CIG A;  1KLN A;  4FJM A;  1J9A A;  3TAM A;  5JS1 A;  1YVU A;  1R0A A;  1L3V A;  4FJH A;  1CLQ A;  1U48 A;  3KLF A;  4CEE A;  2Y1I A;  3DI6 A;  1U4B A;  4W5T A;  1C1B A;  4DWI A;  1UOC A;  3SUN A;  3OYH A;  1SKR A;  4FXD A;  2IOC A;  3G0Z A;  2FBT A;  5CYQ A;  1DTT A;  5KGX A;  4KB1 A;  3M8R A;  1NOZ A;  4CK1 A;  3AVH A;  4FJJ A;  4GVM A;  4O4G A;  2E4L A;  4FM2 A;  4OPJ A;  4FLV A;  3MED A;  4Z4G A;  3BDP A;  3D45 A;  3L3V A;  2HW3 A;  1WSJ A;  4CIE A;  4CEZ A;  4CJL A;  2OPP A;  3AVG A;  4CGJ A;  4E89 A;  3LP3 A;  3AA2 A;  5DMR A;  5E41 A;  1JLG A;  1HNV A;  3AVN A;  3PX4 A;  1TK8 A;  4KTZ A;  3LWM A;  1SV5 A;  2BDP A;  1C0U A;  4DTO A;  4JRQ A;  4CIF A;  1X9S A;  1NOY A;  4OKJ A;  1KFD A;  2IAJ A;  4I9L A;  2IS3 A;  1UWB A;  2EHG A;  2XO7 A;  1U04 A;  1CXQ A;  3VQ9 A;  1IKW A;  4IFV A;  1C0M A;  4Y1C A;  4CHQ A;  4E1N A;  3O3H A;  1SUQ A;  2XHB A;  3TWH A;  4OJR A;  1NJX A;  3AO1 A;  4W5R A;  1HQU A;  1TGO A;  1NK5 A;  3DOL A;  5C42 A;  1IO2 A;  2HMI A;  2FC0 A;  2XRI A;  4B9N A;  4BE0 A;  4KHQ A;  2DY4 A;  3QEX A;  3O4Q A;  4FJ5 A;  5J2M A;  3LAM A;  1L3S A;  2OPS A;  1HYZ A;  2XY7 A;  3SUP A;  2F8S A;  4DF8 A;  4O55 A;  1FK9 A;  2OPQ A;  3P5J A;  1KVB A;  3HVR A;  3SCX A;  3S9H A;  3MEC A;  3NHG A;  1LAW A;  4RW6 A;  4FJG A;  4B9T A;  4DTR A;  3KK1 A;  3QIO A;  3VQA A;  1RDB A;  5HRO A;  3SJJ A;  1RDD A;  1Q9X A;  1Z25 A;  4M3Z A;  3C6U A;  3DLG A;  1B92 A;  4AHC A;  5CYM A;  4GW6 A;  1NJY A;  3OYG A;  1RTD A;  4DTX A;  3ZCM A;  2OZS A;  4AHT A;  3TR8 A;  1RT4 A;  3MAQ A;  3LZJ A;  4M3U A;  1QSS A;  4DTN A;  4CJ5 A;  1U49 A;  4O0I A;  4J2A A;  4FJ7 A;  3OYD A;  5CY4 A;  3QEW A;  4CCH A;  4FLX A;  4PY5 A;  2X6N A;  4FJN A;  3HM9 A;  1KSP A;  2KW4 A;  3AO2 A;  5D3G A;  3K58 A;  4DQR A;  3M8P A;  3ZSY A;  3NCI A;  3U3G A;  4IG0 A;  3DYA A;  3I0S A;  4KTW A;  4CF9 A;  3OJU A;  1GOA A;  4CGG A;  2G8F A;  1BI4 B;  2PYJ A;  2P1J A;  1N6Q A;  4KRF A;  1RBV A;  1BGX T;  3SYZ A;  4JLH A;  3RMB A;  3SV4 A;  1T7P A;  5HLF A;  4DQP A;  4EZ9 A;  4BE1 A;  4N76 A;  1C1A A;  1EX4 A;  4BDP A;  4KI6 A;  3PO4 A;  3VQE A;  4OLB A;  4OLA A;  4DTS A;  2X78 A;  4M3X A;  1KVC A;  2WON A;  1QQC A;  1BIZ A;  2F96 A;  1YT3 A;  3CM5 A;  3VQ4 A;  2QXF A;  3T3F A;  1LAV A;  1RTH A;  4E3S A;  1X9W A;  2HHQ A;  4ELU A;  1HMV A;  4H4M A;  1HJR A;  3VA0 A;  4L8R B;  3H08 A;  4HUF A;  2X6S A;  3AO4 A;  1L3T A;  4N47 A;  1BIU A;  4K8Z A;  4FW2 A;  4FLW A;  2HHS A;  1HNI A;  4FW1 A;  4UQG A;  1VRT A;  3V81 A;  4MFB A;  4LD0 A;  4FLU A;  3AO3 A;  3S3M A;  3HT3 A;  3TAB A;  3HXM A;  1VSL A;  4N56 A;  1EP4 A;  4H8K A;  5SWM A;  3NF6 A;  4NCG A;  4HTU A;  2XY5 A;  1D9F A;  4CER A;  1RBU A;  1TAQ A;  1VK0 A;  3HVT A;  3VQD A;  1Q9Y A;  5FRM A;  2X74 A;  4MQ3 A;  1KTQ A;  2FBV A;  1QHT A;  3L2R A;  2G8I A;  4B8A B;  4CJQ A;  2Q3S A;  1KVA A;  4E7I A;  1TKD A;  2PZS A;  4KKO A;  4CK3 A;  1D8Y A;  3OYC A;  2BGG A;  3OS1 A;  3MEE A;  1LW2 A;  3CYM A;  4R5P A;  4E7K A;  1SL2 A;  4M42 A;  1RDC A;  4F3O A;  4KV8 A;  1EXQ A;  1NK7 A;  2XY8 A;  2LSN A;  2RKI A;  4RW9 A;  5KRT A;  3DRP A;  4FJK A;  5HRR A;  1ITG A;  3AVL A;  3TAN A;  1NJW A;  1X9M A;  2QK9 A;  3FFI A;  1WSE A;  3AVF A;  4DSK A;  4CF0 A;  1NJZ A;  3ZT0 A;  4WE1 A;  3V1O A;  5J2Q A;  3U3Y A;  1VSE A;  4DQS A;  1NK4 A;  4YFU A;  4B8C A;  3VQB A;  3QO9 A;  2KZM A;  1BL3 A;  1WAJ A;  5EU7 A;  3OYB A;  1L3U A;  4M45 A;  3NF7 A;  4ZHR A;  4CHN A;  1RT2 A;  4FLZ A;  5HRP A;  1Q8I A;  1IKX A;  1C6V A;  1ZBH A;  3LDS A;  3RRG A;  3OYN A;  3A2F A;  1FKO A;  1EKE A;  1VSK A;  1XHX A;  2YHB A;  3B6P A;  1BI4 A;  4EP5 A;  3NH1 A;  3F73 A;  3KKS A;  3V4I A;  1YTA A;  3SUO A;  2P5G A;  3ZT1 A;  4B9M A;  3U6F A;  3WNG A;  4KTQ A;  3L8B A;  5SZT A;  2YKN A;  4CJ3 A;  4BDY A;  2WOM A;  3KLH A;  4KHN A;  1WSI A;  3V9U A;  1IKY A;  1CZ9 A;  4RW7 A;  4M3Y A;  5FRO A;  4W5Q A;  3DLK A;  1NK0 A;  1BCO A;  4DSL A;  4KB0 A;  3HP6 A;  4Q5V A;  3EYZ A;  2GV9 A;  4OKE A;  3B6O A;  5CZ2 A;  3SPY A;  4N41 A;  2OA8 A;  1CXU A;  4M3T A;  3DLE A;  4KHY A;  1TVR A;  4DFK A;  2VG7 A;  3K5L A;  3VN5 A;  2A1S A;  3QNN A;  3DRS A;  1FXX A;  3P83 D;  3JYT A;  4AHS A;  3DOK A;  3MEG A;  4FZX C;  3KJV A;  5I3U A;  4CJP A;  3WNH A;  3ZSW A;  1KLM A;  5HRS A;  4LSL A;  4W5O A; 
#chains in the Genus database with same CATH topology
 1W2B M;  4BR2 A;  1S1U A;  4DQ8 A;  3OBW A;  1N34 K;  4CF1 A;  4DV1 K;  2GUP A;  3R3L A;  4CGD A;  4ILG B;  3AV9 A;  4ISG A;  1XUP O;  3DRR A;  3OYF A;  3THY B;  2O4I A;  1ZBI A;  5H1S Q;  3WNE A;  3CPE A;  5EX5 A;  3TAF A;  3AA4 A;  4JI1 K;  4JKD A;  3LP2 A;  4PKH A;  4KHW A;  1XHZ A;  3NDK A;  2NRT A;  3UIQ A;  3KD1 E;  4RWT A;  4CHO A;  1T05 A;  3RWU A;  5BN9 A;  3PX6 A;  3T1A A;  3I8B A;  1A5X A;  3DM2 A;  1BDG A;  4Z94 A;  4IG3 A;  3LL3 A;  4IBN A;  1BOT O;  2VG6 A;  3VA3 A;  2O8F B;  3ZSX A;  4B3T K;  4PL8 A;  3ZEU A;  4DG1 A;  3NE6 A;  4OGE A;  3CFR A;  4M41 A;  3K9J A;  2D4W A;  1JXE A;  5C25 A;  4O5F A;  3H45 C;  2VWK A;  4JK7 A;  3W0L A;  1GLB G;  1HX1 A;  3MCP A;  4H5V A;  4FLY A;  5C12 A;  2QKK A;  4CJ4 A;  1X9J A;  4BE2 A;  1VSH A;  3AVC A;  4CJS A;  1JLB A;  1UA0 A;  2VGM A;  4OGC A;  3N4Q A;  4DUY K;  2CGL A;  2ATQ A;  4GV3 A;  5C24 A;  4DKW A;  1TK5 A;  2YHA A;  5BN8 A;  2FLO A;  2KFN A;  3DXM A;  4ISF A;  3DLH A;  4B9V A;  4BR4 A;  5KRS A;  4RCH A;  2G8W A;  3HZ6 A;  3NH2 A;  4F3T A;  1Z26 A;  1VQP N;  3JSM A;  4CBX A;  3TAP A;  3RRH A;  3CM6 A;  1KFS A;  4QCL A;  3VTH A;  4PKG A;  3AVA A;  1HNW K;  2R7Y A;  2HHU A;  4Z4E A;  3VTI A;  3O4N A;  4CGH A;  2NLX A;  1WN7 A;  2QWQ A;  4WCE L;  1HKC A;  4DTU A;  2WBN A;  3JAM O;  3RR8 A;  3NGY A;  1BWF O;  3AVJ A;  5LJW A;  1T6D A;  4B1V A;  1N33 K;  3WXL A;  2FF3 B;  1IBM K;  4CD1 A;  3PY8 A;  3BP8 A;  4I6M A;  3OS2 A;  3M6G A;  3D2E A;  5DM7 L;  3THW B;  1XMO K;  3TPQ A;  3O8M A;  4E7J A;  3O08 A;  3CXC M;  3WNF A;  2A41 A;  3H3O B;  4MO4 A;  4CZK A;  5AQQ A;  3VEX A;  3E01 A;  4B3M K;  3KK3 A;  2AJQ A;  4E19 A;  4KH4 A;  3C6T A;  2HHX A;  2UXC K;  4CEB A;  2QTD A;  1EET A;  4FWP A;  1ASU A;  1RT3 A;  4CGF A;  3O3F A;  4DTP A;  3I55 N;  4ICL A;  3SQ0 A;  3DLB A;  5BRE A;  2UU9 K;  3E66 A;  4F2S A;  2ZF5 O;  1B9F A;  3EL2 A;  3K57 A;  4KHU A;  3ULE A;  4CED A;  2XY6 A;  4EHU A;  3VQ8 A;  4DR4 K;  4BY9 C;  1HYV A;  4OVL A;  4H0V B;  3Q7C A;  4CZI A;  2P51 A;  4ID5 A;  1C0T A;  3CER A;  4LY7 A;  4A61 A;  4DLG A;  3VGK A;  4I7F A;  3KK7 A;  3HO1 A;  1BQM A;  1ILY A;  5FPM A;  1OH7 A;  2HNY A;  4NYN A;  3CFP A;  1QQM A;  5GAE P;  3CET A;  3F9K A;  4B9U A;  3FLC O;  3NF8 A;  4Y0W A;  4JI6 K;  4FM0 A;  1W9H A;  4C8L A;  3RMA A;  1K6Y A;  4DTJ A;  3HP9 A;  1QE1 A;  4OKK A;  4C23 A;  1SKS A;  1NGC A;  4O8K A;  2RN2 A;  2GWJ A;  4EZ6 A;  2F8T A;  3OVN A;  4LH4 A;  1SL0 A;  1WSH A;  4LFC K;  3OYA A;  3NGI A;  4FM1 A;  3VQQ A;  4DR2 K;  1JLQ A;  4FJI A;  3BUZ B;  3CJA A;  1IBK K;  4DQI A;  3VQC A;  5JS2 A;  4B9L A;  4CK2 A;  5T7B A;  3A5N C;  3DWL A;  3OYI A;  1NNE A;  4LSN A;  3QES A;  3TAE A;  4BRD A;  3EKS A;  1TV6 A;  2EX3 A;  3SPZ A;  5LMN K;  5BPL A;  1ATS A;  3ZSZ A;  1N5Y A;  3ZEU B;  3L2Q A;  3KKR A;  4N5S A;  2JWK A;  4DU3 A;  1NWK A;  4YNQ A;  3P1G A;  4HVJ A;  3GG4 A;  5GIN A;  2CH5 A;  4C8M A;  2KLA A;  3ZYY X;  2NRX A;  4NCA A;  3SK3 A;  1IG9 A;  3O9T A;  1DKG D;  2D0C A;  5BRD A;  5JIC A;  1J5O A;  3IAY A;  4FJL A;  3LM2 A;  2D0B A;  1GLD G;  4IO9 L;  4FJM A;  2V7Z A;  4B1Y B;  4DR7 K;  1YVU A;  3T1H K;  1L3V A;  1U48 A;  2Q31 A;  1UOC A;  1E4G T;  3AY9 A;  3SUN A;  3TTC A;  1SKR A;  5IWA K;  4JKH A;  1DTT A;  1YJW N;  1VQ4 N;  4Z4G A;  4FM2 A;  4JK8 A;  3QFP A;  2OPP A;  4CGJ A;  3LP3 A;  3DXK A;  1JLG A;  1HNV A;  2D0P A;  4KTZ A;  2BDP A;  4DTO A;  4CIF A;  1S22 A;  1NOY A;  4OKJ A;  2IAJ A;  4IOA L;  2IS3 A;  2XO7 A;  1U04 A;  1CXQ A;  3O3H A;  3TWH A;  2VGN A;  1HQU A;  2DY4 A;  2FF6 A;  5EXW A;  4BE0 A;  1T6C A;  1CZA N;  4FWN A;  3QEX A;  3HOS A;  1K9M O;  3VOV A;  4BRQ A;  1YAG A;  5J2M A;  1HYZ A;  2F8S A;  2OPQ A;  3P5J A;  3SCX A;  3VGM A;  3MEC A;  4RW6 A;  5ELZ A;  4B9T A;  1RDB A;  3VEN A;  5HRO A;  4YOY A;  3P38 A;  4M3Z A;  4AF1 A;  3C6U A;  1B92 A;  3OYG A;  1YIJ N;  1RT4 A;  1QSS A;  4O0I A;  4J8F A;  5CY4 A;  3QEW A;  3U4L A;  3SAG A;  2QWR A;  2X6N A;  2ZJR L;  3B8A X;  3DYA A;  1DGK N;  2G8F A;  3CC2 N;  2P1J A;  4JLH A;  3AAP A;  3SV4 A;  5HLF A;  4N76 A;  4KI6 A;  3VQE A;  5JLF A;  4LF6 K;  4CJ7 A;  4OLB A;  3O9S A;  2QXF A;  3D2F B;  1X9W A;  4BRI A;  1HJR A;  3J7Z O;  1HNZ K;  3WXM B;  3C7N B;  1WOQ A;  3AO4 A;  1NGH A;  4YOU A;  2VQF K;  1QZ6 A;  4FLW A;  4FW1 A;  3HRG A;  3V81 A;  4LD0 A;  1KAY A;  5C10 A;  3S3M A;  2YHY A;  3HXM A;  4H0Y B;  4H8K A;  1WBD A;  4HTU A;  4JD2 A;  4CER A;  1TAQ A;  1VK0 A;  3VQD A;  1OVY A;  5FRM A;  5KPT A;  2X74 A;  4B1Z A;  2G8I A;  4CJQ A;  4CK3 A;  3MEE A;  4M42 A;  4R5P A;  4F3O A;  3UKU A;  1WSE A;  4YOX A;  5M1P A;  1NJZ A;  3ZT0 A;  3R8E A;  4M7Y A;  3RSE B;  5J2Q A;  3U3Y A;  5FPE A;  1VSE A;  4CZG A;  4H0P A;  4DUZ K;  3UKR B;  3QO9 A;  4IXC A;  3CCR N;  4IWV A;  2KZM A;  1BL3 A;  5EOY A;  3OYB A;  1L3U A;  3MDQ A;  3IUC A;  3G4S N;  4ZHR A;  4CHN A;  4BRF A;  2ZGZ A;  3CPW M;  3A2F A;  1FKO A;  3ZX3 A;  1VSK A;  4EP5 A;  3NH1 A;  5FPN A;  3F73 A;  3ZX0 A;  3CJ7 A;  1IBL K;  1SQK A;  3FZF A;  4B9M A;  3WNG A;  4BDY A;  3PLA A;  4KHN A;  1CZ9 A;  3WQU A;  4KH6 A;  1NK0 A;  4DSL A;  5FPD A;  3HP6 A;  4Q5V A;  1VQK N;  3B6O A;  3ZX2 A;  5JMV A;  4BRA A;  4N41 A;  2O8B A;  2O8B B;  3WXJ A;  3QNN A;  3MK6 A;  3A8Y A;  1YJ9 N;  4FVU A;  4BRC A;  5I3U A;  2E20 A;  2P9U B;  4LSL A;  4W5O A;  2YX6 A;  4XIU A;  3A5L C;  3QBX A;  1DLO A;  3VQ6 A;  1TAU A;  1NU0 A;  4FPA A;  1GLC G;  4F9O A;  2FXU A;  1MWK A;  3IMX A;  3NBP A;  3AA3 A;  1QQO A;  4L3Q A;  4KHS A;  3SMP A;  4NB4 A;  1ASV A;  4JEP A;  3HOT A;  2BAN A;  1BHL A;  5J1E A;  3VEY A;  5GIP A;  2QKB A;  1EWR A;  1HPZ A;  3DMJ A;  4GKK K;  1XC9 A;  2E5L K;  4WFA L;  1V4T A;  4DR5 K;  4CJU A;  2UUC K;  1JCG A;  4E0D A;  1RBS A;  4IFY A;  4WFN L;  3CCJ N;  3THX B;  1B9D A;  3LAK A;  2GEM A;  3T7Z A;  3L2W A;  2G8U A;  4IEE A;  4K41 A;  2OYQ A;  3AVK A;  4DQQ A;  3V9X A;  1KC8 O;  4PL7 A;  1I39 A;  3BGR A;  3V9S A;  4E7H A;  1RIL A;  1QS4 A;  2HND A;  1NKB A;  1XWL A;  3O1B A;  4RW8 A;  3NF9 A;  1QQN A;  1RT5 A;  4MO5 A;  1LV5 A;  5FRN A;  4M3R A;  3BY5 A;  4DR1 K;  4HCC A;  4H0T B;  2A40 A;  1OH5 A;  3O9U A;  4DU4 A;  4JKB A;  3OYM A;  4O0J A;  4KI4 A;  3I56 N;  2IVO A;  4E7L A;  3C95 A;  3OYJ A;  3WXI A;  5BR9 A;  3KZB A;  1KQS M;  4JKA A;  2ITG A;  5AQU A;  4WQ4 C;  1GLJ O;  1RTJ A;  2GBZ A;  1K8K B;  3QLH A;  3LZI A;  2D1K A;  4CBU A;  5I42 A;  1REV A;  2IDO A;  4DS4 A;  4FWL A;  4Y1D A;  3TAQ A;  5LMU K;  2O8D B;  4CJT A;  1T8E A;  5FDL A;  4TSX A;  2HBJ A;  4WF9 L;  4CGI A;  4HHT A;  1BU6 O;  3Q7B A;  5MLC Q;  2IGI A;  4CES A;  1RBR A;  1RT7 A;  1L5U A;  3CC7 N;  3KTQ A;  1NBW A;  5ADX A;  2UXD K;  3SNN A;  1JJ2 M;  3AA5 X;  2O8C A;  2HBM A;  5HBM A;  3C94 A;  4CEA A;  2PYL A;  3AVI A;  3E9O A;  2RPI A;  1LWC A;  3HPH A;  3VQ5 A;  3PUF A;  1WLJ A;  1VSI A;  1LW0 A;  4DSI A;  2YJE A;  3M8Q A;  3ZSO A;  3ZLJ A;  1NGI A;  1A5W A;  3K5M A;  4CHP A;  4FZY A;  2F9T A;  1U2V A;  1C1C A;  1TYQ A;  3BF1 A;  2HF3 A;  4DSE A;  4RW4 A;  3OHR A;  1NK6 A;  2ITM A;  3QIN A;  5AQG A;  3G25 A;  3MN9 A;  4LF4 K;  2E6M A;  4NLC A;  4I9Q A;  4CEF A;  4QS7 A;  3LM9 A;  3FGU A;  4BQL A;  3QB0 A;  3LWL A;  3QNO A;  3QER A;  1VRU A;  3DXM B;  4HUG A;  1O1W A;  4BRE A;  3FE1 A;  4FWR A;  1NMD A;  3LPT A;  1D4X A;  4J2D A;  1NKC A;  2G8K A;  1VQ8 N;  1YJN N;  1ATR A;  4JI4 K;  3WQT A;  2Z1I A;  3L2V A;  5LJV A;  3ID6 A;  4CVN E;  3ZSV A;  1NKE A;  2DFH A;  1JCE A;  3KIO A;  3VGL A;  4DF4 A;  1SL1 A;  1EWQ A;  4HCB A;  4Z4I A;  2HNZ A;  1RTI A;  2P9N A;  4E1M A;  3VF4 A;  2DTU A;  3O5B A;  5AZJ A;  5FLX O;  4LH5 A;  5KTQ A;  3THW A;  3MWT A;  1HKG A;  3O80 A;  4QOZ B;  4CJV A;  5AQM A;  1KRP A;  4CEO A;  2EWS A;  2VWB A;  3AGR A;  3QIP A;  3T1Y K;  2IC3 A;  2NRZ A;  4DV4 K;  5M1Q A;  2NRH A;  3ISN C;  4CF8 A;  2GUI A;  4K8X A;  4Z4C A;  1NK8 A;  1U45 A;  3ZSQ A;  1UAX A;  2HVH A;  2HHT A;  4EP4 A;  1JLA A;  1X3N A;  2O8E A;  2O8E B;  3U9Z A;  2IVN A;  2Q97 A;  2Y1J A;  5AQF A;  4BVO A;  3KK2 A;  1S1V A;  4C8O A;  1FJG K;  3NH0 A;  2E2P A;  4CZH A;  4X66 K;  5BPN A;  4NXM K;  4B3O A;  2I5J A;  3ZT4 A;  2OAN A;  3HM8 A;  4OX9 K;  4O44 A;  3AVB A;  5BPM A;  3H3N O;  3ZSR A;  4O8U A;  1J9A A;  3TAM A;  2P9L A;  4BG8 A;  5AQI A;  1CLQ A;  1H1V A;  1YUW A;  3KLF A;  2I7N A;  4W5T A;  2V52 B;  3VER A;  1XMQ K;  4EIA A;  5CYQ A;  4KB1 A;  1NOZ A;  4OO1 J;  4MLE A;  4FLV A;  4IJA A;  4NO7 A;  3D45 A;  3L3V A;  4A5A A;  5AFU H;  5AR0 A;  1T3V A;  2QWP A;  2AA4 A;  5E41 A;  3PX4 A;  4QS8 A;  4XH5 A;  3LWM A;  1SV5 A;  3L4I A;  4JRQ A;  4BC2 A;  1N32 K;  3VQ9 A;  4PKI A;  4E1N A;  2XHB A;  1NJX A;  5EY4 A;  2NNW A;  3H1Q A;  3GL1 A;  3TU5 A;  4DR6 K;  2FC0 A;  4GV6 A;  2DPN A;  1ZBS A;  3RVC A;  1L3S A;  5C0Y A;  3SUP A;  3CCQ N;  2UXB K;  1FK9 A;  3S9H A;  3OW2 M;  4LF8 K;  5B8H A;  3A5M C;  3C6A A;  5CYM A;  1NJY A;  1RTD A;  4DTX A;  5HOO A;  3CCU N;  4A62 A;  4XH4 A;  3LZJ A;  2A6A A;  1ZXO A;  4DTN A;  4CJ5 A;  1U49 A;  1XNR K;  4JKF A;  4QS9 A;  4BRO A;  1BG3 A;  1KSP A;  1VQ6 N;  5D3G A;  3KWI A;  4DQR A;  3M8P A;  3U3G A;  4CF9 A;  1N6Q A;  1BGX T;  4DQP A;  4EZ9 A;  3CMA N;  3P39 A;  2P9I A;  1EX4 A;  4JD2 B;  2ZM6 K;  1R59 O;  4OLA A;  4DTS A;  2HST A;  4U7B A;  3VQ4 A;  3VPZ A;  3SJH A;  3T3F A;  1RTH A;  4EHT A;  1HR0 K;  4H4M A;  2E1Z A;  3VA0 A;  4HUF A;  4IEI A;  1BIU A;  4K8Z A;  5AQK A;  3MX5 A;  1OH6 A;  1RFQ A;  4IDH A;  4FLU A;  3THY A;  3TAB A;  4N56 A;  4FOE A;  4BRK A;  1D9F A;  3HVT A;  1Q9Y A;  4YOV A;  3L2R A;  1KTQ A;  2FBV A;  5M1K A;  2E8A A;  2A3Z A;  3N4P A;  2PZS A;  1TKD A;  2BGG A;  4KKO A;  1HPM A;  4X64 K;  4E7K A;  1DT9 A;  3O9Q A;  2LSN A;  4FL9 A;  1EQY A;  1W7A A;  5HRR A;  1ITG A;  5A2Q O;  1QZ5 A;  4CD3 A;  3AVF A;  4DSK A;  2O8C B;  3D6R A;  2E1Y A;  3ULE B;  1NK4 A;  4YFU A;  4B8C A;  3VQB A;  1XC3 A;  4M45 A;  4C1N K;  3QIC A;  4FLZ A;  5HRP A;  2YI1 A;  1C6V A;  1ZBH A;  2GX9 A;  3CHW A;  3LDS A;  2NRW A;  2ZGY A;  1YIT N;  2YHB A;  2W40 A;  3SUO A;  4LFB K;  3ZT1 A;  3U6F A;  1YI2 N;  3H6E A;  2YKN A;  4WQ5 C;  2WOM A;  4M3Y A;  2WC9 A;  5AQL A;  3DLK A;  4KB0 A;  3IKM A;  1LOT B;  3VES A;  4JI8 K;  3DLE A;  4BRN A;  2VG7 A;  3FFK B;  4B9Q A;  2A1S A;  4JHD B;  3JYT A;  4B3R K;  4B3S K;  1FW6 A;  3KJV A;  4CJP A;  1MA9 B;  3WNH A;  3O6W A;  3E1Y A;  3OS0 A;  4JKG B;  3I33 A;  3NVM A;  1TYQ B;  3A0I X;  3LP1 A;  1LWF A;  3JXU A;  1JLC A;  4JS4 A;  2VWJ A;  3QET A;  3CJ1 A;  4Z4F A;  5M1O A;  1U47 A;  2G8H A;  1JL1 A;  1YVN A;  4DV3 K;  2W41 A;  3CG7 A;  1S9G A;  4JS5 A;  1GOB A;  1K8A O;  4G1Q A;  4HUE A;  4FWO A;  1GLE G;  3F9M A;  2BH1 A;  2Q0R A;  3LDQ A;  4FYD A;  2HB5 A;  4ILJ A;  4NYF A;  4M3W A;  1G99 A;  2YCH A;  3FZH A;  5J2N A;  3K5N A;  2HVI A;  3SUQ A;  1WAF A;  3SBG A;  3PIO L;  4DS5 A;  3AAQ A;  4BRG A;  3OY9 A;  1KD1 O;  3DJC A;  3SMS A;  2Z1J A;  1IG8 A;  1KAZ A;  4ID1 A;  1VSD A;  1VQL N;  2KTQ A;  1D9D A;  4LF9 K;  4JRP A;  2B6A A;  1MWM A;  3EO3 A;  4ISE A;  3ENO A;  2QEX N;  1Z05 A;  3WXK A;  3LP0 A;  4GV9 A;  1TL3 A;  3K5O A;  3DLL L;  5CZ1 A;  3NAE A;  3LDN A;  3VQP A;  1JLE A;  4IO8 A;  1F21 A;  3I0R A;  4PWD A;  4B9S A;  2ASM A;  3ULD A;  3SQ2 A;  2AP1 A;  3H46 O;  2GEL A;  4CE9 A;  4FCY A;  1N36 K;  3SQ4 A;  1EO1 A;  3R9P A;  3C65 A;  2H3G X;  1Z6R A;  3NFA A;  3RMD A;  5AQN A;  5KI6 A;  4JKC A;  3LDL A;  4KRE A;  1NGE A;  4FK0 A;  4R79 A;  3V9W A;  1QSL A;  4CEQ A;  2YNH A;  3CME N;  4E1J A;  2O8F A;  3O9R A;  1WSG A;  4U67 L;  4AHV A;  5DK5 A;  2OPR A;  3LPU A;  5GAH P;  4ELT A;  1CZB A;  1G15 A;  4CZE A;  4DTM A;  1RDA A;  3CIP A;  2Z1G A;  2BE2 A;  3A5O C;  3SZ2 A;  3TAR A;  3KLG A;  3PSF A;  3VF6 A;  1WB9 A;  3AO5 A;  1O13 A;  1X1P A;  1S1X A;  4FVM A;  3THV A;  1S9E A;  3THX A;  2RF2 A;  1GOC A;  4PUO A;  5BRF A;  1GLF O;  2YV0 X;  4YOW A;  1RBT A;  2HHH K;  1TKX A;  3F5T A;  2ETJ A;  5AJ3 K;  4C8N A;  1WNS A;  3QDK A;  3ENH A;  3G10 A;  3HL8 A;  3M1F A;  1JLF A;  2D0O A;  4WFB L;  3M5R A;  3TAG A;  4CHY A;  3QEI A;  4H4O A;  3EY1 A;  1TKT A;  2J4R A;  3R1X A;  4CZF A;  3VET A;  3RTV A;  4JHD A;  3BEX A;  2BTF A;  2P9S A;  2Q36 A;  3MXM A;  3SBT A;  2P9I B;  2P9S B;  1RNH A;  2QXL A;  4Z0U A;  4OPK A;  4FZZ A;  5CR4 A;  1ZBL A;  4K25 A;  4QAG A;  4YOT A;  2F7T A;  4CFB A;  1ZBU A;  3VEO A;  3GOI A;  2P5O A;  3M8S A;  2P9K A;  2G8V A;  3KWG A;  1VQM N;  4H0X B;  2ASO A;  4C8K A;  4BGB A;  4DFP A;  4JN4 A;  3IG1 A;  1P90 A;  5KGW A;  3VEW A;  3TTD A;  2Z1H A;  3QEV A;  3MXJ A;  1N8R O;  3OYL A;  2YNF A;  3UE5 A;  3P31 A;  4BDZ A;  5J2P A;  1VSM A;  3M3Z A;  4K0K K;  1HLU A;  4KAZ A;  1WUA A;  3CCL N;  1GLL O;  3J7A P;  1J53 A;  2HOE A;  3WUH A;  1IH7 A;  2PFU A;  2YNG A;  3PV8 A;  3OTO K;  5I9E B;  2OTJ N;  4GKJ K;  2D0A A;  3BF3 A;  3UKR A;  4X65 K;  3G6E N;  5F2R A;  4DFJ A;  4CEC A;  1NK9 A;  4GMJ B;  5CHI A;  3KD5 E;  2B4J A;  3OJS A;  5AQS A;  1RDW X;  5K14 A;  2E88 A;  4I2Q A;  3S3O A;  3SV3 A;  2P9U A;  1ZYQ A;  3K59 A;  3HPG A;  2RE2 A;  1U2V B;  2IIR A;  1W0H A;  2D5R A;  4ELU A;  4CFA A;  2OZM A;  4XH1 A;  4WQ4 A;  2YKM A;  2ZD1 A;  3EN9 A;  1M90 O;  3SQ1 A;  1HYS A;  2PAV A;  4PHT X;  3OYK A;  4OPA A;  3HST B;  1A5V A;  4BVP A;  3L6Q A;  3EZ5 A;  1I3A A;  3T19 A;  1S5J A;  1LWE A;  1RT6 A;  1GLA G;  1VHX A;  4CIG A;  3D2F A;  5JS1 A;  2WUS A;  5TKY A;  1KAX A;  1VQ7 N;  4GNI A;  5AQJ A;  4CEE A;  3DI6 A;  2Y1I A;  3J81 O;  1C1B A;  5AQX A;  4FXD A;  3OYH A;  5IT9 O;  3G0Z A;  5KGX A;  2W6K A;  3M8R A;  3VF2 A;  1HJO A;  4CK1 A;  4FJJ A;  3MWP A;  4OPJ A;  3MED A;  4LF5 K;  3K0S A;  4CIE A;  2QWN A;  4CEZ A;  2HW3 A;  4CJL A;  3G71 N;  3AVG A;  3CJB A;  4E89 A;  1TK8 A;  3AVN A;  3S41 A;  3J7Y P;  3CF5 L;  1C0U A;  5GIO A;  5AFU A;  1YXQ A;  2HF4 A;  3MN7 A;  1ESV A;  1BA0 A;  2P9N B;  1S3X A;  1UWB A;  2EHG A;  3IFR A;  1IKW A;  4IFV A;  1C0M A;  4OJR A;  4W5R A;  1NGF A;  1TGO A;  4FWM A;  1NK5 A;  3DOL A;  1IO2 A;  2XRI A;  3J80 O;  1QVG M;  4K43 A;  3IDH A;  2OPS A;  2ZJQ L;  4NXN K;  3E9L A;  4FSV A;  2XY7 A;  4DF8 A;  4O55 A;  1KVB A;  4KHP K;  4FJG A;  1IJJ A;  3CCS N;  4DTR A;  3KK1 A;  3VQA A;  2WTU A;  3SJJ A;  3MX2 A;  1NGA A;  1Z25 A;  2JWL A;  4GW6 A;  3ZCM A;  4YHH K;  4AHT A;  3CQY A;  2E2Q A;  1E4F T;  4M3U A;  5AQZ A;  5AQV A;  1NM1 A;  3FZM A;  4FLX A;  4PY5 A;  3HM9 A;  3AO2 A;  3C7N A;  2F9W A;  3K58 A;  4A2B A;  3CJ9 A;  3R6M A;  4KTW A;  3OJU A;  3I0S A;  5M1F A;  4CGG A;  2PYJ A;  1RBV A;  4OPH A;  4H5N A;  5AZJ B;  2GTD A;  3VMF B;  4BDP A;  5AZI B;  4CW7 B;  3PO4 A;  2X78 A;  2WON A;  1QQC A;  4IOC L;  3CM5 A;  3GDQ A;  4IZ9 A;  4BG9 A;  3OA9 A;  4AM7 A;  4E3S A;  1HMV A;  4LF7 K;  3WT0 A;  3H08 A;  4FW2 A;  2HHS A;  4UQG A;  1K73 O;  1EP4 A;  5SWM A;  1RBU A;  4B8A B;  4E7I A;  1KVA A;  1LCU A;  3OYC A;  3DXK B;  3CYM A;  1SL2 A;  4X62 K;  5AQW A;  1NK7 A;  4FOI A;  2RKI A;  3CQX A;  4RW9 A;  5KRT A;  2FSN A;  3AVL A;  4CZL A;  1J5E K;  1I94 K;  4WE1 A;  4BR0 A;  1SAZ A;  4DQS A;  4BRL A;  5LL6 Z;  3CI5 A;  1WAJ A;  3NF7 A;  2OTL N;  1Q8I A;  4JYA K;  3GE1 A;  3LDP A;  1VAZ A;  2OCE A;  1EKE A;  1XHX A;  1BI4 A;  3V4I A;  1YTA A;  4JKE A;  1BA1 A;  4I6M B;  5SZT A;  4IJN A;  2VQE K;  1WSI A;  1IKY A;  4RW7 A;  3QML A;  5FRO A;  3LDO A;  4W5Q A;  1BCO A;  1Y64 A;  3AAR A;  3ATV A;  2W6L A;  1NGJ A;  4BR9 A;  3EYZ A;  4M63 C;  3SPY A;  4BGA A;  1CXU A;  3CCM N;  1TVR A;  4DFK A;  3VN5 A;  2CGK A;  1FXX A;  5CE3 A;  4AHS A;  3DOK A;  3EZW A;  3RSE A;  2HBL A;  2ASP A;  4YDU C;  3ZSW A;  1KLM A;  5DM6 L;  1KLN A;  3W3D A;  2FSK A;  4DMN A;  2QW9 A;  2V7Y A;  4DR3 K;  2QI2 A;  3FZK A;  2O8D A;  1FKP A;  4YOR A;  3I8D A;  2QM1 A;  3WEE A;  1Q81 O;  4FJX A;  2FBX A;  1WSF A;  2VG5 A;  1NMN A;  3UB5 A;  3V1Q A;  4J2B A;  4BRM A;  5C2D A;  4AH9 A;  4DSJ A;  5C15 A;  1VSF A;  2E6L A;  3CC4 N;  3CCE N;  1MU2 A;  3D7E O;  2F4V K;  4CFC A;  5HP1 A;  3K2P A;  4DHY A;  4IKF A;  4BQZ A;  1ZC6 A;  3EE8 A;  3UKU B;  4BAC A;  2ZQB A;  5JLH A;  5TKW A;  4CF2 A;  4WQ5 A;  4JNE A;  4Z4H A;  4JV5 K;  4XEI A;  3MXI A;  4F4K A;  3ALY A;  3QFU A;  4A2A A;  1XI1 A;  3TSQ A;  3AVM A;  1BIS A;  3LAN A;  3MCA B;  2Q0U A;  1TK0 A;  5AZI A;  4AQY K;  4FJ8 A;  4PQU A;  2QWM A;  4MDB A;  1HKB A;  1VSJ A;  1XNQ K;  1HQE A;  4I2P A;  4DSF A;  4AHU A;  1YTU A;  4W5N A;  2YJF A;  3ENB A;  1Q86 O;  2UUA K;  1Q7Y O;  2Q2R A;  1X3M A;  4GY2 B;  4BWJ A;  4ELV A;  1TUU A;  3HPO A;  3HBT A;  2HHW A;  4M7X A;  5BR8 K;  4JI2 K;  1BQN A;  4IFE A;  3V1R A;  4DV6 K;  1JKH A;  4A5B A;  1HNX K;  4KH5 A;  3VEZ A;  3V6D A;  4DV0 K;  2FBY A;  4FWQ A;  4O5B A;  2YNI A;  1HUX A;  5GAD P;  1HRH A;  3KVG A;  3L3U A;  1SKW A;  4Q0B A;  4FK2 A;  1ZBF A;  3DAW A;  3HJF A;  3VQ7 A;  1QVF M;  1UA1 A;  4J2E A;  4KPY A;  4IOX A;  1T03 A;  5KPZ A;  2P9P B;  1QTM A;  1XQS C;  1Y97 A;  4H03 B;  3TI0 A;  4WYB A;  1RT1 A;  2A1R A;  4A59 A;  5HL7 L;  4YY3 K;  2VCP A;  5KPR A;  1QSY A;  3EKU A;  1BO5 O;  4NLB A;  4CI6 A;  4DFM A;  2NRR A;  2NRV A;  4ILH A;  3GBT A;  3CQ8 A;  1IV0 A;  1S1W A;  4DB3 A;  3S3N A;  1MDU B;  3O4W A;  4LFA K;  1C0F A;  2HHV A;  4H0O A;  4CHZ A;  4EAH D;  5JVG L;  4CJF A;  4DLE A;  4PA1 A;  3TSP A;  2HBK A;  3IS9 A;  4DV5 K;  2JGU A;  1VQN N;  5E26 A;  1JL2 A;  3F2K A;  3KLI A;  4ZTF A;  5BRH A;  3HK2 A;  4EFH A;  3H1V X;  4JK9 A;  2HMP A;  2DFF A;  1NLV A;  4CFD A;  2E2N A;  4B1U B;  3PIP L;  3KLE A;  3QEP A;  5HRS A;  3NGZ A;  4B08 A;  3ITH A;  4RG8 A;  3EEQ A;  3ZT3 A;  2QA4 N;  5KQ8 A;  4AIL C;  2E2O A;  2NUB A;  1KXP A;  3D0P A;  1S1T A;  2KFZ A;  5E84 A;  3O3G A;  3EE9 A;  1J54 A;  3OYE A;  4UY8 O;  3VEV A;  2KQ2 A;  2KZZ A;  4H5R A;  2W42 A;  4BRP A;  4NCB A;  3BZC A;  3L0Q A;  4FJ9 A;  2CH6 A;  1DTQ A;  3HYF A;  4HWI A;  1D5A A;  1ASW A;  2O4G A;  4C1N I;  1U6Z A;  3OBY A;  1JXB A;  3DLR A;  1TKZ A;  1NJI O;  2A5X A;  4V19 S;  2GWK A;  1KCF A;  4A57 A;  4DU1 A;  2BUP A;  4KO0 A;  1K8K A;  1S6Q A;  2P9L B;  1BCM A;  4JI0 K;  3IRX A;  1OKJ A;  3PX0 A;  1M1K O;  2DFE A;  1V4S A;  4BRH A;  4CJW A;  5KQD A;  3ASM A;  1NGB A;  2Q1N A;  2UYT A;  4BR5 A;  3PSI A;  1IKV A;  4AHR A;  2UUB K;  1T44 A;  1NGD A;  3RMC A;  2PY5 A;  3L2U A;  1RGI A;  4CZM A;  4F2R A;  3PO5 A;  2ZWH A;  4FPB A;  3U8X A;  4B1W B;  4CJR A;  1Q18 A;  3ZET A;  1TL1 A;  5AQH A;  3SAH A;  4CJE A;  2ZE2 A;  3RR7 A;  1W97 L;  5AQR A;  4BC4 A;  2FSJ A;  3LAL A;  5HRN A;  1RCH A;  3HTV A;  5C2F A;  4ZTJ A;  4FK4 A;  4H5T A;  3O1W A;  5AQP A;  4FLT A;  2JLE A;  4CJK A;  1WBB A;  4IDK A;  2B5J A;  4BWM A;  3V9Z A;  3BZK A;  1S72 N;  3CFO A;  2WFB A;  3SI6 A;  4KFB A;  1S6P A;  4CBW A;  3HSC A;  3MN5 A;  3ZT2 A;  3TTF A;  2QWL A;  4LC9 B;  3TSU A;  3ZET B;  3NVK A;  1R0A A;  4FJH A;  1U4B A;  3U9D A;  4DWI A;  1OH8 A;  2IOC A;  2FBT A;  3WEE B;  1P8Z A;  3AVH A;  4GVM A;  4O4G A;  1QHA A;  2E4L A;  2YHW A;  3BDP A;  4FWS A;  3P4I A;  1WSJ A;  3SLC A;  4BC3 A;  1VQ9 N;  3AA2 A;  5DMR A;  4JI3 K;  4H5W A;  4GVE A;  1X9S A;  4HTL A;  1KFD A;  4I9L A;  4AM6 A;  4K42 A;  4Y1C A;  1NGG A;  4MDA A;  4CHQ A;  1SUQ A;  3AO1 A;  3JS6 A;  4G9Z A;  2VYP A;  5C42 A;  4YDU A;  5JVH L;  2HMI A;  4B9N A;  4KHQ A;  3O4Q A;  4FJ5 A;  3D2E B;  2YHX A;  3LAM A;  3SAF A;  3HVR A;  5AQT A;  3NHG A;  1LAW A;  1RDU A;  4MLH A;  3QIO A;  1VQO N;  1JCF A;  3HI0 A;  1RDD A;  5EVZ A;  3C0B A;  1Q9X A;  1SZ2 A;  3DLG A;  4AHC A;  4DV2 K;  3ATU A;  2OZS A;  2A42 A;  1VQ5 N;  3MAQ A;  4FJ7 A;  4J2A A;  3OYD A;  4BC5 A;  3NMU A;  4CCH A;  3CD6 N;  4FO0 A;  4JKG A;  4FJN A;  5AQO A;  2KW4 A;  3E9P A;  2IVP A;  1E3M A;  3ZSY A;  3QBW A;  3NCI A;  4IG0 A;  5AQY A;  5ADX H;  3AGK A;  1GOA A;  1BI4 B;  4KRF A;  2CGJ A;  3SYZ A;  3RMB A;  1T7P A;  4BE1 A;  1C1A A;  2ZJP L;  2I7P A;  3K9K A;  3FR0 A;  1YF5 L;  2V51 B;  4M3X A;  1KVC A;  1C0G A;  1BIZ A;  2F96 A;  1YT3 A;  4DCH A;  1Q82 O;  1LAV A;  1SS6 A;  1OVQ A;  2PBD A;  2HHQ A;  4L8R B;  2X6S A;  1L3T A;  2RHK A;  4N47 A;  3MN6 A;  3CCV N;  3CJC A;  1HNI A;  1VRT A;  4MFB A;  3AO3 A;  3HT3 A;  1VSL A;  2P9P A;  3NF6 A;  1DEJ A;  4NCG A;  2XY5 A;  4F8R A;  4JI7 K;  4MQ3 A;  1TUY A;  1QHT A;  5F0X A;  3KHY A;  2Q3S A;  1D8Y A;  3OS1 A;  2P9K B;  1LW2 A;  4KBO A;  3MMV A;  1RDC A;  2KKZ A;  4DV7 K;  4KV8 A;  1EXQ A;  1J6Z A;  2XY8 A;  3DRP A;  4FJK A;  3TAN A;  1ATN A;  3L4Q A;  1NJW A;  2QWO A;  3FFI A;  1X9M A;  2QK9 A;  4CF0 A;  3V1O A;  5M1N A;  4FWK A;  5LY3 A;  4CZJ A;  3FZL A;  5EU7 A;  3C6H A;  1RT2 A;  2NZT A;  1IKX A;  4B1X B;  3OYN A;  3RRG A;  5F1X A;  3B6P A;  3KKS A;  3ID8 A;  2P5G A;  4JI5 K;  4KTQ A;  3L8B A;  4BR7 A;  4CJ3 A;  3KLH A;  3V9U A;  4JAX A;  1NG9 A;  2GV9 A;  4OKE A;  2KHO A;  5CZ2 A;  2OA8 A;  4M3T A;  5GAG P;  4KHY A;  3T69 A;  3K5L A;  1BUP A;  1YHQ N;  3DRS A;  3P83 D;  3MEG A;  4FZX C;  4RTF D;  3TR8 A;  3J8A A; 
#chains in the Genus database with same CATH homology
 3OS0 A;  4DMN A;  4XIU A;  1S1U A;  1FKP A;  3LP1 A;  1LWF A;  1DLO A;  1JLC A;  4JS4 A;  3I8D A;  4CF1 A;  2VWJ A;  3VQ6 A;  3QET A;  4FJX A;  2FBX A;  1WSF A;  2VG5 A;  4CGD A;  1U47 A;  2G8H A;  4Z4F A;  1JL1 A;  3V1Q A;  1TAU A;  4J2B A;  3AV9 A;  3CG7 A;  4AH9 A;  1S9G A;  4JS5 A;  4DSJ A;  1VSF A;  3DRR A;  3OYF A;  2E6L A;  1GOB A;  1MU2 A;  2O4I A;  1ZBI A;  4G1Q A;  4HUE A;  3WNE A;  3NBP A;  3AA3 A;  3TAF A;  3AA4 A;  4CFC A;  4KHS A;  4FYD A;  5HP1 A;  2HB5 A;  1ASV A;  3K2P A;  4NYF A;  4M3W A;  2BAN A;  1BHL A;  3LP2 A;  5J1E A;  4IKF A;  2QKB A;  4BAC A;  1HPZ A;  2ZQB A;  3DMJ A;  3NDK A;  5J2N A;  3K5N A;  1XHZ A;  1XC9 A;  3SUQ A;  2HVI A;  3UIQ A;  1WAF A;  3KD1 E;  4CF2 A;  4CHO A;  1T05 A;  3RWU A;  3PX6 A;  4CJU A;  4DS5 A;  4Z4H A;  3T1A A;  3MXI A;  1A5X A;  3DM2 A;  3OY9 A;  4F4K A;  3ALY A;  4IG3 A;  4IBN A;  1XI1 A;  3TAG A;  4E0D A;  3AVM A;  1BIS A;  2VG6 A;  3LAN A;  3VA3 A;  1RBS A;  4IFY A;  2Z1J A;  3ZSX A;  1TK0 A;  4FJ8 A;  4PQU A;  1B9D A;  3LAK A;  4DG1 A;  3NE6 A;  4OGE A;  3L2W A;  4ID1 A;  1VSJ A;  4M41 A;  3CFR A;  2G8U A;  1VSD A;  2OYQ A;  1HQE A;  1JXE A;  4I2P A;  5C25 A;  3NGZ A;  3AVK A;  4DQQ A;  2KTQ A;  1D9D A;  4DSF A;  4AHU A;  3V9X A;  1YTU A;  2VWK A;  4W5N A;  4JRP A;  2B6A A;  1I39 A;  3BGR A;  3V9S A;  4E7H A;  4FLY A;  1RIL A;  1QS4 A;  2HND A;  2QKK A;  1NKB A;  1XWL A;  4CJ4 A;  4BE2 A;  3NF9 A;  1VSH A;  3AVC A;  1RT5 A;  3LP0 A;  4RW8 A;  4BWJ A;  1TL3 A;  3K5O A;  4CJS A;  5CZ1 A;  1JLB A;  4M3R A;  3NAE A;  3HPO A;  4ELV A;  1UA0 A;  2HHW A;  3VQP A;  4OGC A;  1JLE A;  2ATQ A;  4HCC A;  1F21 A;  5C24 A;  3I0R A;  4PWD A;  1TK5 A;  4B9S A;  2YHA A;  1BQN A;  2KFN A;  3ULD A;  3SQ2 A;  3V1R A;  4DU4 A;  3OYM A;  4O0J A;  3DLH A;  4B9V A;  4KI4 A;  1JKH A;  5KRS A;  4E7L A;  3C95 A;  3OYJ A;  4CE9 A;  3V6D A;  4FCY A;  2G8W A;  3SQ4 A;  2FBY A;  3NH2 A;  4O5B A;  2YNI A;  1HRH A;  4F3T A;  1Z26 A;  1SKW A;  3L3U A;  2ITG A;  3NFA A;  4Q0B A;  4FK2 A;  3JSM A;  3RMD A;  1ZBF A;  5KI6 A;  1RTJ A;  3TAP A;  3RRH A;  2GBZ A;  3HJF A;  4KRE A;  3CM6 A;  3QLH A;  3VQ7 A;  4FK0 A;  1KFS A;  4QCL A;  3AVA A;  3LZI A;  3V9W A;  1UA1 A;  2R7Y A;  1QSL A;  4CEQ A;  4Z4E A;  4J2E A;  2HHU A;  3O4N A;  4KPY A;  4CGH A;  2YNH A;  1REV A;  5I42 A;  1WN7 A;  2IDO A;  4F8R A;  4DS4 A;  1T03 A;  4Y1D A;  3TAQ A;  1QTM A;  1WSG A;  4DTU A;  4AHV A;  5DK5 A;  1Y97 A;  3TI0 A;  3RR8 A;  2OPR A;  3LPU A;  1RT1 A;  3NGY A;  2A1R A;  4ELT A;  4CJT A;  3AVJ A;  1CZB A;  1G15 A;  1T8E A;  5FDL A;  1QSY A;  4TSX A;  4DTM A;  1RDA A;  4DFM A;  2Z1G A;  2BE2 A;  4CGI A;  4HHT A;  3PY8 A;  3OS2 A;  3CQ8 A;  3SZ2 A;  1S1W A;  3TAR A;  3KLG A;  3S3N A;  2IGI A;  4CES A;  1RBR A;  3AO5 A;  1RT7 A;  1L5U A;  2HHV A;  1X1P A;  4CHZ A;  1S1X A;  4FVM A;  3THV A;  1S9E A;  4E7J A;  3KTQ A;  4CJF A;  2RF2 A;  1GOC A;  4PA1 A;  4DLE A;  3SNN A;  3WNF A;  4PUO A;  2YV0 X;  1RBT A;  3IS9 A;  1TKX A;  2JGU A;  3E01 A;  3AA5 X;  3KK3 A;  1JL2 A;  2ETJ A;  2AJQ A;  4E19 A;  3C6T A;  3KLI A;  4C8N A;  4ZTF A;  1WNS A;  5HBM A;  3C94 A;  4CEA A;  3HK2 A;  3G10 A;  3HL8 A;  2PYL A;  2DFF A;  3AVI A;  1JLF A;  4CFD A;  2HHX A;  3KLE A;  4CEB A;  3QEP A;  2RPI A;  1EET A;  1LWC A;  3HPH A;  1ASU A;  3VQ5 A;  4B08 A;  3PUF A;  1RT3 A;  1WLJ A;  3ITH A;  4CHY A;  3QEI A;  4H4O A;  4RG8 A;  3ZT3 A;  1VSI A;  1LW0 A;  4CGF A;  3O3F A;  3EY1 A;  4DSI A;  1TKT A;  4DTP A;  3M8Q A;  3RTV A;  3ZSO A;  4AIL C;  2NUB A;  4ICL A;  3SQ0 A;  3D0P A;  3DLB A;  1S1T A;  2KFZ A;  3O3G A;  4F2S A;  1B9F A;  1A5W A;  3K57 A;  3MXM A;  1J54 A;  1RNH A;  4Z0U A;  3OYE A;  4CHP A;  3K5M A;  4FZY A;  2KQ2 A;  4OPK A;  4CED A;  4KHU A;  2KZZ A;  2XY6 A;  2W42 A;  4FZZ A;  3VQ8 A;  1C1C A;  1ZBL A;  4QAG A;  4NCB A;  1HYV A;  4OVL A;  4DSE A;  4RW4 A;  1NK6 A;  4FJ9 A;  4CFB A;  1DTQ A;  1ZBU A;  2P51 A;  3HYF A;  3QIN A;  4ID5 A;  2P5O A;  1C0T A;  1D5A A;  4LY7 A;  1ASW A;  2E6M A;  2O4G A;  3M8S A;  4DLG A;  4I9Q A;  4CEF A;  4I7F A;  2G8V A;  3HO1 A;  1JXB A;  3DLR A;  1BQM A;  1TKZ A;  4C8K A;  3LWL A;  3QNO A;  4DFP A;  1VRU A;  3QER A;  1LV5 A;  3IG1 A;  4HUG A;  5KGW A;  1O1W A;  2HNY A;  2Z1H A;  4NYN A;  3CFP A;  3QEV A;  3MXJ A;  3LPT A;  1KCF A;  4DU1 A;  3OYL A;  4J2D A;  2YNF A;  1NKC A;  4KO0 A;  2G8K A;  1S6Q A;  3F9K A;  4BDZ A;  4B9U A;  1BCM A;  3IRX A;  3NF8 A;  3PX0 A;  5J2P A;  1VSM A;  4FM0 A;  2DFE A;  4CJW A;  3ASM A;  1W9H A;  4C8L A;  3RMA A;  1K6Y A;  2Z1I A;  4DTJ A;  3L2V A;  3HP9 A;  1QE1 A;  4OKK A;  4KAZ A;  3ZSV A;  1SKS A;  1NKE A;  2DFH A;  1J53 A;  2RN2 A;  4EZ6 A;  1IKV A;  2F8T A;  3OVN A;  4AHR A;  1IH7 A;  4LH4 A;  3PV8 A;  2YNG A;  1SL0 A;  3KIO A;  1WSH A;  4DF4 A;  1SL1 A;  3OYA A;  4HCB A;  4Z4I A;  3NGI A;  3RMC A;  4KHW A;  4FM1 A;  2HNZ A;  3VQQ A;  2PY5 A;  1RTI A;  1JLQ A;  2D0A A;  4E1M A;  4FJI A;  2DTU A;  3L2U A;  4DQI A;  4F2R A;  3VQC A;  3PO5 A;  5JS2 A;  4CJR A;  4DFJ A;  4LH5 A;  1TL1 A;  4CEC A;  4CK2 A;  5KTQ A;  1NK9 A;  4GMJ B;  4CJE A;  4CJV A;  5T7B A;  1KRP A;  4B9L A;  4QOZ B;  2ZE2 A;  4CEO A;  3RR7 A;  3KD5 E;  2B4J A;  3OJS A;  3QIP A;  3OYI A;  5K14 A;  4LSN A;  3QES A;  3LAL A;  2IC3 A;  5HRN A;  1RCH A;  4I2Q A;  3TAE A;  3S3O A;  1TV6 A;  2EX3 A;  3SV3 A;  1ZYQ A;  4ZTJ A;  3SPZ A;  4FK4 A;  3ISN C;  3K59 A;  4CF8 A;  2GUI A;  3HPG A;  4FLT A;  4K8X A;  1W0H A;  2D5R A;  3ZSZ A;  4CFA A;  4Z4C A;  2JLE A;  1U45 A;  1NK8 A;  1N5Y A;  2OZM A;  5FRN A;  4CJK A;  3ZSQ A;  1UAX A;  3L2Q A;  3KKR A;  4IDK A;  4N5S A;  2YKM A;  2ZD1 A;  2HVH A;  2B5J A;  4BWM A;  3V9Z A;  2HHT A;  4EP4 A;  1JLA A;  4DU3 A;  4YNQ A;  2Y1J A;  3P1G A;  3SQ1 A;  1HYS A;  4HVJ A;  3CFO A;  3OYK A;  3KK2 A;  1S1V A;  4C8M A;  3HST B;  4C8O A;  3SI6 A;  1A5V A;  3NH0 A;  4NCA A;  4KFB A;  1S6P A;  1IG9 A;  2D0C A;  1J5O A;  3IAY A;  3EZ5 A;  1I3A A;  3T19 A;  4B3O A;  2I5J A;  3ZT4 A;  3ZT2 A;  1S5J A;  4FJL A;  1LWE A;  1RT6 A;  3AVB A;  4O44 A;  2D0B A;  3ZSR A;  4CIG A;  1KLN A;  4FJM A;  1J9A A;  3TAM A;  5JS1 A;  1YVU A;  1R0A A;  1L3V A;  4FJH A;  1CLQ A;  1U48 A;  3KLF A;  4CEE A;  2Y1I A;  3DI6 A;  1U4B A;  4W5T A;  1C1B A;  4DWI A;  1UOC A;  3SUN A;  3OYH A;  1SKR A;  4FXD A;  2IOC A;  3G0Z A;  2FBT A;  5CYQ A;  1DTT A;  5KGX A;  4KB1 A;  3M8R A;  1NOZ A;  4CK1 A;  3AVH A;  4FJJ A;  4GVM A;  4O4G A;  2E4L A;  4FM2 A;  4OPJ A;  4FLV A;  3MED A;  4Z4G A;  3BDP A;  3D45 A;  3L3V A;  2HW3 A;  1WSJ A;  4CIE A;  4CEZ A;  4CJL A;  2OPP A;  3AVG A;  4CGJ A;  4E89 A;  3LP3 A;  3AA2 A;  5DMR A;  5E41 A;  1JLG A;  1HNV A;  3AVN A;  3PX4 A;  1TK8 A;  4KTZ A;  3LWM A;  1SV5 A;  2BDP A;  1C0U A;  4DTO A;  4JRQ A;  4CIF A;  1X9S A;  1NOY A;  4OKJ A;  1KFD A;  2IAJ A;  4I9L A;  2IS3 A;  1UWB A;  2EHG A;  2XO7 A;  1U04 A;  1CXQ A;  3VQ9 A;  1IKW A;  4IFV A;  1C0M A;  4Y1C A;  4CHQ A;  4E1N A;  3O3H A;  1SUQ A;  2XHB A;  3TWH A;  4OJR A;  1NJX A;  3AO1 A;  4W5R A;  1HQU A;  1TGO A;  1NK5 A;  3DOL A;  5C42 A;  1IO2 A;  2HMI A;  2FC0 A;  2XRI A;  4B9N A;  4BE0 A;  4KHQ A;  2DY4 A;  3QEX A;  3O4Q A;  4FJ5 A;  5J2M A;  3LAM A;  1L3S A;  2OPS A;  1HYZ A;  2XY7 A;  3SUP A;  2F8S A;  4DF8 A;  4O55 A;  1FK9 A;  2OPQ A;  3P5J A;  1KVB A;  3HVR A;  3SCX A;  3S9H A;  3MEC A;  3NHG A;  1LAW A;  4RW6 A;  4FJG A;  4B9T A;  4DTR A;  3KK1 A;  3QIO A;  3VQA A;  1RDB A;  5HRO A;  3SJJ A;  1RDD A;  1Q9X A;  1Z25 A;  4M3Z A;  3C6U A;  3DLG A;  1B92 A;  4AHC A;  5CYM A;  4GW6 A;  1NJY A;  3OYG A;  1RTD A;  4DTX A;  3ZCM A;  2OZS A;  4AHT A;  3TR8 A;  1RT4 A;  3MAQ A;  3LZJ A;  4M3U A;  1QSS A;  4DTN A;  4CJ5 A;  1U49 A;  4O0I A;  4J2A A;  4FJ7 A;  3OYD A;  5CY4 A;  3QEW A;  4CCH A;  4FLX A;  4PY5 A;  2X6N A;  4FJN A;  3HM9 A;  1KSP A;  2KW4 A;  3AO2 A;  5D3G A;  3K58 A;  4DQR A;  3M8P A;  3ZSY A;  3NCI A;  3U3G A;  4IG0 A;  3DYA A;  3I0S A;  4KTW A;  4CF9 A;  3OJU A;  1GOA A;  4CGG A;  2G8F A;  1BI4 B;  2PYJ A;  2P1J A;  1N6Q A;  4KRF A;  1RBV A;  1BGX T;  3SYZ A;  4JLH A;  3RMB A;  3SV4 A;  1T7P A;  5HLF A;  4DQP A;  4EZ9 A;  4BE1 A;  4N76 A;  1C1A A;  1EX4 A;  4BDP A;  4KI6 A;  3PO4 A;  3VQE A;  4OLB A;  4OLA A;  4DTS A;  2X78 A;  4M3X A;  1KVC A;  2WON A;  1QQC A;  1BIZ A;  2F96 A;  1YT3 A;  3CM5 A;  3VQ4 A;  2QXF A;  3T3F A;  1LAV A;  1RTH A;  4E3S A;  1X9W A;  2HHQ A;  4ELU A;  1HMV A;  4H4M A;  1HJR A;  3VA0 A;  4L8R B;  3H08 A;  4HUF A;  2X6S A;  3AO4 A;  1L3T A;  4N47 A;  1BIU A;  4K8Z A;  4FW2 A;  4FLW A;  2HHS A;  1HNI A;  4FW1 A;  4UQG A;  1VRT A;  3V81 A;  4MFB A;  4LD0 A;  4FLU A;  3AO3 A;  3S3M A;  3HT3 A;  3TAB A;  3HXM A;  1VSL A;  4N56 A;  1EP4 A;  4H8K A;  5SWM A;  3NF6 A;  4NCG A;  4HTU A;  2XY5 A;  1D9F A;  4CER A;  1RBU A;  1TAQ A;  1VK0 A;  3HVT A;  3VQD A;  1Q9Y A;  5FRM A;  2X74 A;  4MQ3 A;  1KTQ A;  2FBV A;  1QHT A;  3L2R A;  2G8I A;  4B8A B;  4CJQ A;  2Q3S A;  1KVA A;  4E7I A;  1TKD A;  2PZS A;  4KKO A;  4CK3 A;  1D8Y A;  3OYC A;  2BGG A;  3OS1 A;  3MEE A;  1LW2 A;  3CYM A;  4R5P A;  4E7K A;  1SL2 A;  4M42 A;  1RDC A;  4F3O A;  4KV8 A;  1EXQ A;  1NK7 A;  2XY8 A;  2LSN A;  2RKI A;  4RW9 A;  5KRT A;  3DRP A;  4FJK A;  5HRR A;  1ITG A;  3AVL A;  3TAN A;  1NJW A;  1X9M A;  2QK9 A;  3FFI A;  1WSE A;  3AVF A;  4DSK A;  4CF0 A;  1NJZ A;  3ZT0 A;  4WE1 A;  3V1O A;  5J2Q A;  3U3Y A;  1VSE A;  4DQS A;  1NK4 A;  4YFU A;  4B8C A;  3VQB A;  3QO9 A;  2KZM A;  1BL3 A;  1WAJ A;  5EU7 A;  3OYB A;  1L3U A;  4M45 A;  3NF7 A;  4ZHR A;  4CHN A;  1RT2 A;  4FLZ A;  5HRP A;  1Q8I A;  1IKX A;  1C6V A;  1ZBH A;  3LDS A;  3RRG A;  3OYN A;  3A2F A;  1FKO A;  1EKE A;  1VSK A;  1XHX A;  2YHB A;  3B6P A;  1BI4 A;  4EP5 A;  3NH1 A;  3F73 A;  3KKS A;  3V4I A;  1YTA A;  3SUO A;  2P5G A;  3ZT1 A;  4B9M A;  3U6F A;  3WNG A;  4KTQ A;  3L8B A;  5SZT A;  2YKN A;  4CJ3 A;  4BDY A;  2WOM A;  3KLH A;  4KHN A;  1WSI A;  3V9U A;  1IKY A;  1CZ9 A;  4RW7 A;  4M3Y A;  5FRO A;  4W5Q A;  3DLK A;  1NK0 A;  1BCO A;  4DSL A;  4KB0 A;  3HP6 A;  4Q5V A;  3EYZ A;  2GV9 A;  4OKE A;  3B6O A;  5CZ2 A;  3SPY A;  4N41 A;  2OA8 A;  1CXU A;  4M3T A;  3DLE A;  4KHY A;  1TVR A;  4DFK A;  2VG7 A;  3K5L A;  3VN5 A;  2A1S A;  3QNN A;  3DRS A;  1FXX A;  3P83 D;  3JYT A;  4AHS A;  3DOK A;  3MEG A;  4FZX C;  3KJV A;  5I3U A;  4CJP A;  3WNH A;  3ZSW A;  1KLM A;  5HRS A;  4LSL A;  4W5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...