2KQVA

Sars coronavirus-unique domain (sud): three-domain molecular architecture in solution and rna binding. i: structure of the sud-m domain of sud-mc
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
129
structure length
129
Chain Sequence
GSHMGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SARS coronavirus unique domain: three-domain molecular architecture in solution and RNA binding.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Non-structural protein 3
total genus 28
structure length 129
sequence length 129
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12124 Nsp3_PL2pro Coronavirus polyprotein cleavage domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.20 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2kqvA01
2JZDA 2RNKA 2W2GA 2JZEA 2KQVA 2JZFA 2WCTA
chains in the Genus database with same CATH superfamily
3EWRA 2FAVA 2EWBA 4ZYQA 2FXKA 1TXZA 2J9AA 4ZY2A 4ZY0A 3GQEA 4ZY1A 1ZR3A 3KR5A 4JLLA 4D86A 3V45A 5FSVA 4KYBA 4ABLA 2LGRA 5HIHA 3EW5A 4ETJA 3H8GA 5HOLA 5FSXA 3EJFA 2BFRA 4IQYA 1BPMA 3GPOA 2JZEA 4R7MA 5D8NA 3KQXA 1VHUA 1NJRA 3GQOA 1GYTA 3EKEA 5E3BA 4ZX8A 2JZFA 4K3NA 5CBMA 1LANA 3T8WA 3V2BA 3IIDA 3PEIA 4GUAA 2L8RA 2W2GA 4X2TA 2WCTA 4TU0A 4JCAA 3KR4A 1LCPA 2ACFA 4JVVA 1TY8A 1YD9A 4UMLA 2JZDA 2RNKA 3IJ3A 3SIGA 3GPGA 4K0CA 4ETKA 2VRIA 3EJGA 4ZI6A 3IIFA 4ZX9A 4ABKA 3JRUA 1LAMA 3KZWA 3SIHA 5AILA 1LAPA 2FG1A 4J4ZA 2EEEA 3SIJA 4J5QA 3ETIA 3GPQA 5DUSA 3EWOA 1SPVA 1HJZA 4GVVA 2XD7A 3JZTA 5CB3A 1BLLE 2X47A 3H8FA 5FSZA 1ZR5A 3SIIA 3KQZA 4J5RA 1BPNA 3EWQA 3Q6ZA 4ESSA 4R6TA 2BFQA 4KSIA 3EWPA 2DX6A 3Q71A 3H8EA 4R76A 4JGKA 3VFQA 5FSUA 5FSYA 5CB5A 4GVWA 2AFCA 2KQVA 4J5SA 5CMSA
chains in the Genus database with same CATH topology
2JZDA 2RNKA 2W2GA 2JZEA 2KQVA 2JZFA 2WCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZD A;  2RNK A;  2W2G A;  2JZE A;  2KQV A;  2JZF A;  2WCT A; 
#chains in the Genus database with same CATH topology
 3EWR A;  2FAV A;  2EWB A;  4ZYQ A;  2FXK A;  1TXZ A;  2J9A A;  4ZY2 A;  4ZY0 A;  3GQE A;  4ZY1 A;  1ZR3 A;  3KR5 A;  4JLL A;  4D86 A;  3V45 A;  5FSV A;  4KYB A;  4ABL A;  2LGR A;  5HIH A;  3EW5 A;  4ETJ A;  3H8G A;  5HOL A;  5FSX A;  3EJF A;  2BFR A;  4IQY A;  1BPM A;  3GPO A;  2JZE A;  4R7M A;  5D8N A;  3KQX A;  1VHU A;  1NJR A;  3GQO A;  1GYT A;  3EKE A;  5E3B A;  4ZX8 A;  2JZF A;  4K3N A;  5CBM A;  1LAN A;  3T8W A;  3V2B A;  3IID A;  3PEI A;  4GUA A;  2L8R A;  2W2G A;  4X2T A;  2WCT A;  4TU0 A;  4JCA A;  3KR4 A;  1LCP A;  2ACF A;  4JVV A;  1TY8 A;  1YD9 A;  4UML A;  2JZD A;  2RNK A;  3IJ3 A;  3SIG A;  3GPG A;  4K0C A;  4ETK A;  2VRI A;  3EJG A;  4ZI6 A;  3IIF A;  4ZX9 A;  4ABK A;  3JRU A;  1LAM A;  3KZW A;  3SIH A;  5AIL A;  1LAP A;  2FG1 A;  4J4Z A;  2EEE A;  3SIJ A;  4J5Q A;  3ETI A;  3GPQ A;  5DUS A;  3EWO A;  1SPV A;  1HJZ A;  4GVV A;  2XD7 A;  3JZT A;  5CB3 A;  1BLL E;  2X47 A;  3H8F A;  5FSZ A;  1ZR5 A;  3SII A;  3KQZ A;  4J5R A;  1BPN A;  3EWQ A;  3Q6Z A;  4ESS A;  4R6T A;  2BFQ A;  4KSI A;  3EWP A;  2DX6 A;  3Q71 A;  3H8E A;  4R76 A;  4JGK A;  3VFQ A;  5FSU A;  5FSY A;  5CB5 A;  4GVW A;  2AFC A;  2KQV A;  4J5S A;  5CMS A; 
#chains in the Genus database with same CATH homology
 2JZD A;  2RNK A;  2W2G A;  2JZE A;  2KQV A;  2JZF A;  2WCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...