The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
129
|
structure length |
129
|
Chain Sequence |
GSHMGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Viral protein
|
molecule keywords |
Non-structural protein 3
|
publication title |
SARS coronavirus unique domain: three-domain molecular architecture in solution and RNA binding.
pubmed doi rcsb |
source organism |
Sars coronavirus
|
total genus |
28
|
structure length |
129
|
sequence length |
129
|
ec nomenclature |
ec
3.4.19.12: Ubiquitinyl hydrolase 1. |
pdb deposition date | 2009-11-19 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF12124 | Nsp3_PL2pro | Coronavirus polyprotein cleavage domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Leucine Aminopeptidase, subunit E; domain 1 | Leucine Aminopeptidase, subunit E; domain 1 |
#chains in the Genus database with same CATH superfamily 2W2G A; 2JZE A; 2KQV A; 2WCT A; 2JZD A; 2JZF A; 2RNK A; #chains in the Genus database with same CATH topology 5FSX A; 4D86 A; 4ZX8 A; 1ZR5 A; 4J5Q A; 4JGK A; 4JCA A; 4ABK A; 5FSY A; 4J5R A; 2L8R A; 1YD9 A; 3SII A; 2RNK A; 3EJF A; 4ZY1 A; 4ZY2 A; 3GQE A; 1TY8 A; 4JLL A; 3H8F A; 1HJZ A; 3H8E A; 4TU0 A; 1GYT A; 2XD7 A; 3JRU A; 2KQV A; 5CBM A; 2JZD A; 4ESS A; 3SIH A; 1BPN A; 4ETK A; 4R76 A; 1LAM A; 4R6T A; 5FSU A; 3Q71 A; 5CMS A; 1LAN A; 3KZW A; 4GVV A; 3KQZ A; 4ZYQ A; 3V45 A; 1SPV A; 3EWR A; 2W2G A; 4X2T A; 4R7M A; 3KR5 A; 5DUS A; 2JZE A; 2JZF A; 2LGR A; 1NJR A; 3T8W A; 3EKE A; 1VHU A; 1ZR3 A; 4IQY A; 5CB5 A; 4JVV A; 4ZY0 A; 3GQO A; 4GUA A; 3SIG A; 4J4Z A; 1LAP A; 5D8N A; 1TXZ A; 2X47 A; 4GVW A; 2AFC A; 2WCT A; 4UML A; 1BPM A; 2VRI A; 4ZX9 A; 3EWP A; 3EWQ A; 3EJG A; 4KYB A; 2BFQ A; 4J5S A; 4ETJ A; 2BFR A; 5CB3 A; 5HOL A; 3VFQ A; 3ETI A; 5HIH A; 3GPQ A; 5E3B A; 4ABL A; 3KQX A; 3Q6Z A; 5AIL A; 3EWO A; 4KSI A; 3EW5 A; 5FSV A; 2EWB A; 3SIJ A; 3KR4 A; 4K3N A; 3IID A; 2DX6 A; 2FG1 A; 2EEE A; 4ZI6 A; 3GPG A; 3JZT A; 5FSZ A; 3H8G A; 1LCP A; 3V2B A; 2FXK A; 3PEI A; 3IIF A; 3IJ3 A; 1BLL E; 2ACF A; 2J9A A; 4K0C A; 2FAV A; 3GPO A; #chains in the Genus database with same CATH homology 2W2G A; 2JZE A; 2KQV A; 2WCT A; 2JZD A; 2JZF A; 2RNK A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...