2KQVA

Sars coronavirus-unique domain (sud): three-domain molecular architecture in solution and rna binding. i: structure of the sud-m domain of sud-mc
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
129
structure length
129
Chain Sequence
GSHMGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SARS coronavirus unique domain: three-domain molecular architecture in solution and RNA binding.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Non-structural protein 3
total genus 28
structure length 129
sequence length 129
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12124 Nsp3_PL2pro Coronavirus polyprotein cleavage domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.20 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2kqvA01
2KQVA 2WCTA 2JZEA 2JZFA 2W2GA 2JZDA 2RNKA
chains in the Genus database with same CATH superfamily
3IIFA 3EW5A 3KQXA 4JCAA 2BFRA 4ZY0A 3KR4A 3EKEA 4UMLA 4ABKA 4J5QA 3PEIA 4GVVA 4ZX8A 1YD9A 2EWBA 4IQYA 3JZTA 4J4ZA 4ZY2A 5HOLA 3H8EA 1NJRA 1TY8A 3GPOA 4K0CA 4KSIA 3ETIA 1LCPA 4ZX9A 1ZR5A 3KR5A 4R6TA 3V2BA 1SPVA 5FSXA 2KQVA 2JZEA 3GQEA 3SIIA 3VFQA 1LAPA 2L8RA 3Q6ZA 3EWPA 4ZYQA 5CB3A 5FSVA 2FXKA 3SIJA 4D86A 2ACFA 2FG1A 5FSZA 5CBMA 3EWRA 4J5SA 2EEEA 5AILA 4X2TA 3H8GA 3SIGA 2BFQA 2X47A 3KQZA 2LGRA 3IIDA 1BPMA 3H8FA 4ZY1A 4TU0A 1BLLE 1VHUA 2J9AA 1TXZA 4JVVA 4ETJA 1LAMA 2DX6A 1GYTA 3T8WA 3V45A 1BPNA 5HIHA 3EJGA 1LANA 4GUAA 5FSUA 4K3NA 2W2GA 1ZR3A 4GVWA 4R76A 4JLLA 2VRIA 4ABLA 4R7MA 2WCTA 3GPGA 5CB5A 4J5RA 4ETKA 2RNKA 5DUSA 4ZI6A 2XD7A 4KYBA 3JRUA 2JZFA 5D8NA 3EWQA 2FAVA 5FSYA 3SIHA 4JGKA 3IJ3A 1HJZA 3EJFA 3GPQA 5E3BA 4ESSA 3EWOA 2JZDA 3Q71A 5CMSA 3KZWA 3GQOA 2AFCA
chains in the Genus database with same CATH topology
2KQVA 2WCTA 2JZEA 2JZFA 2W2GA 2JZDA 2RNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQV A;  2WCT A;  2JZE A;  2JZF A;  2W2G A;  2JZD A;  2RNK A; 
#chains in the Genus database with same CATH topology
 3IIF A;  3EW5 A;  3KQX A;  4JCA A;  2BFR A;  4ZY0 A;  3KR4 A;  3EKE A;  4UML A;  4ABK A;  4J5Q A;  3PEI A;  4GVV A;  4ZX8 A;  1YD9 A;  2EWB A;  4IQY A;  3JZT A;  4J4Z A;  4ZY2 A;  5HOL A;  3H8E A;  1NJR A;  1TY8 A;  3GPO A;  4K0C A;  4KSI A;  3ETI A;  1LCP A;  4ZX9 A;  1ZR5 A;  3KR5 A;  4R6T A;  3V2B A;  1SPV A;  5FSX A;  2KQV A;  2JZE A;  3GQE A;  3SII A;  3VFQ A;  1LAP A;  2L8R A;  3Q6Z A;  3EWP A;  4ZYQ A;  5CB3 A;  5FSV A;  2FXK A;  3SIJ A;  4D86 A;  2ACF A;  2FG1 A;  5FSZ A;  5CBM A;  3EWR A;  4J5S A;  2EEE A;  5AIL A;  4X2T A;  3H8G A;  3SIG A;  2BFQ A;  2X47 A;  3KQZ A;  2LGR A;  3IID A;  1BPM A;  3H8F A;  4ZY1 A;  4TU0 A;  1BLL E;  1VHU A;  2J9A A;  1TXZ A;  4JVV A;  4ETJ A;  1LAM A;  2DX6 A;  1GYT A;  3T8W A;  3V45 A;  1BPN A;  5HIH A;  3EJG A;  1LAN A;  4GUA A;  5FSU A;  4K3N A;  2W2G A;  1ZR3 A;  4GVW A;  4R76 A;  4JLL A;  2VRI A;  4ABL A;  4R7M A;  2WCT A;  3GPG A;  5CB5 A;  4J5R A;  4ETK A;  2RNK A;  5DUS A;  4ZI6 A;  2XD7 A;  4KYB A;  3JRU A;  2JZF A;  5D8N A;  3EWQ A;  2FAV A;  5FSY A;  3SIH A;  4JGK A;  3IJ3 A;  1HJZ A;  3EJF A;  3GPQ A;  5E3B A;  4ESS A;  3EWO A;  2JZD A;  3Q71 A;  5CMS A;  3KZW A;  3GQO A;  2AFC A; 
#chains in the Genus database with same CATH homology
 2KQV A;  2WCT A;  2JZE A;  2JZF A;  2W2G A;  2JZD A;  2RNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...