2KQXA

Nmr structure of the j-domain (residues 2-72) in the escherichia coli cbpa
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
ELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYDQMWQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Curved DNA-binding protein
publication title Structural basis of the regulation of the CbpA co-chaperone by its specific modulator CbpM.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Chaperone binding protein
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2kqxA00
2Y4UA 2CTWA 2YS8A 1GH6A 2LGWA 2LO1A 1FPOA 2QWQB 3APOA 3APQA 2EJ7A 1HDJA 1N4CA 2L6LA 1WJZA 2QSAA 2CUGA 2DMXA 2DN9A 2QWNB 3UO2A 2CTQA 2Y4TA 1IURA 3BVOA 2QWPB 2N05A 4RWUA 2CTPA 3AG7A 4J80A 3UO3A 2N04A 1BQZA 2PF4E 2GUZB 2KQXA 4IT5A 2QWOB 2OCHA 2GUZA 2CTRA 1NZ6A 1BQ0A 4J7ZA 1FAFA 2M6YA 3UCSC 2QWRB 1XBLA 2YUAA
chains in the Genus database with same CATH superfamily
2OIEA 1PL0A 4MVMA 1HNWO 3RVYA 1RM1B 1D5AA 4J42A 3SJAC 5ITZB 3LSSA 2F1MA 4CBCA 2CUGA 2F23A 4I50A 4B3MO 1DLBA 3P30A 3SPJA 1JFFA 5JVDA 3UO3A 1MSWD 3HKCA 2CDYA 4ZHQA 1EN5A 2LFSA 1WPBA 2M6YA 4IYHA 5B5EZ 4DK0A 1W0JG 3GB7C 4DV5B 4J11A 1R6TA 2DQ0A 3ZMTA 1A32A 1X4TA 3ZHQA 3APOA 2YSUB 3FAVA 4K35A 3ZJZA 4GKKO 3JATA 3SYPA 4JI6O 2BE3A 2LW1A 3ABKB 4Q20A 5JJNB 3JSNA 4B3SB 1FXKB 2B9ZA 4DR7B 4JI4O 3X2QB 1QLNA 2ZQMA 1GH6A 4I4TB 1GM7A 4E2LA 5JQGB 3ASOB 2CE4A 2QKCA 5GONA 4B7EA 4X1IB 5H5NA 5J2UA 3HR0A 5BZBA 1JX9A 1NR1A 3Q4HA 4I0XB 3OMIB 5BMVB 2UUBO 4LBEC 1XBLA 2CH7B 1UJWB 3AG1C 4IHJA 4JI8B 1CEZA 1P49A 3C90A 2H94A 3D3IA 4HNAB 1I94O 1DF4A 2HVJC 1AILA 4HBNA 4LP8A 1BQZA 1KP3A 4DUZB 3PN1A 5C8YA 3KCXA 1N0NA 2PZSA 1OCOC 3G4SV 1NJIW 1YJWV 1FPOA 1GN6A 3OE7G 4X66O 3B40A 4CH4A 3RT3C 5CB4A 4X1YB 2A7WA 2CGOA 3G6BA 4FLXA 3OGIB 1IURA 3L9DA 3RW0A 1KP2A 2A79B 2Q6AA 2X6CA 4JI7O 3CJHA 4DR3O 4I55A 2GUZA 3L72H 1EN6A 3ZEDA 5LYJA 3JALA 3ZRWA 4AHCA 2PYLA 1HR0B 2X6BA 1IZ3A 4NR1A 4EKWA 5B1BC 1QHTA 4AI8A 1K8AW 2IM9A 3DGEA 3DSQA 4NXMO 4DR4O 5B66Z 3CMEV 2QM8A 5EC1C 2KB1A 2VS0A 4WCEV 1OV9A 1PNKA 2GBOA 3KKYA 5H6QA 2JDIG 4Z2WA 2H3OA 3CP1A 3HPLC 3OUFA 3H1KH 4BAYA 5L3BA 1ZL8B 4U3FH 4LFBB 1O9GA 4YHHO 1W59A 1WN7A 1YCIA 2VWKA 4YJ3B 1ZX3A 5LL6Y 2B1IA 3BVOA 4RWUA 2UXNA 2HHHO 1H2NA 5H6RA 1N33B 3K0GA 3OFNG 3WB2A 2KG7B 1M9NA 2QGNA 4LF5O 5GTIZ 4KHPB 3SYAA 3P3NA 1VARA 3RWRD 5KX5A 2ZD9A 3ABUA 4RUEA 2JGDA 3BEHA 5IWAB 3B8NA 2CTPA 2YEVA 4GYCB 4LFAO 3K03A 5IE9A 4B3RO 4NB5A 2H8PC 2IJHA 5IYZB 1NH2B 3S3XA 4XDJA 3BAAA 4TT3G 2W6JG 1FXHA 3O9OA 4U3JA 5DM6V 4RQEA 4CS4A 3ASNB 1WJZA 2WLHA 1O9HA 5IJ0A 4WFHA 2UUCO 2RMKB 1VF6A 4X88A 2VQFB 3ETEA 3SPIA 1R3JC 3HKBA 2Y69C 4JI5B 1EN4A 4UVCA 4P2ZA 4UV8A 4ICGA 1Q7YW 2AZ2A 1M1KW 4AQYB 3T2MA 2BTQB 2UXDB 2UUAB 2JJ2G 1AR1B 2WA3A 1PNMA 4DRXA 1KQSU 4K0KO 2QM7A 2P22C 4QE7A 5EZYB 4O4LB 4IT5A 3GWKC 4MVSA 2ZR3A 3ZMSA 1VIBA 4OXSA 4QIWF 4O2BB 3L75H 5J9PC 1AR5A 1I7FA 4EB6A 3CSXA 1YTFB 1XMQO 3N2GB 1HNZB 4UVBA 4DR5B 1SA0B 3C3SA 2QE7G 4PI0A 1I94B 3TCUA 5KUKA 3B77A 3RYIB 2EBOA 3ZRVA 2A0LA 1M56C 3L71H 5B1AB 2F4VO 4X64B 3K9AA 1R73A 1GN4A 1XEQA 2YIAA 2P67A 1M93A 3CCUV 3N2KA 1XNQB 1IXMA 2ZDIA 5DN6G 2WPDG 3VQWA 1MG1A 3CHXA 4UFZA 4BIUA 1FS0G 5IT9N 1WAZA 3LNMB 3B09A 3FB6C 3J7AU 4TV9B 4FM1A 3LDDA 3D8CA 4W4LA 1K4DC 2AXTZ 2Y0PA 3ZRXA 4DV2O 2ITCC 3CYOA 4E4EA 2P7TC 1AI4A 4JV5O 4PDRA 2DMXA 4I50B 2HVKC 5B1BB 1JFFB 4X62O 5JVDB 5KUMA 1IVSA 1XNRO 4D6TH 3FB5C 3SR2C 3HKCB 3WG7B 4JZGA 2EINB 1TAEA 2CTRA 4ZHQB 1YIJV 4NXMB 1AJQA 4DR4B 1WNSA 1E79G 4DR6B 4TSFG 1WB7A 2WAMA 3H1HH 3ABMB 2LP7A 3JD2A 4P9OA 3SYQA 2AGAA 1J5EB 1FXVA 1QVGU 1L1FA 3FAVB 1N36O 5K1XA 4TUYA 2WLIA 4UCVA 5EC2C 1IBKO 3JATB 4KL1A 3W7TA 4EFEA 3ETGA 2OCCC 1NTKH 3SJQC 3CCJV 2Q4PA 1E1RG 2ZE8A 2BSKA 2Q67A 1RM1C 1K73W 2EIJB 2WLLA 2XNDG 2Z5UA 4JTDB 3SPCA 4WFBV 1YXBA 3RN4A 3UT5A 4G2KA 5GONB 5FNVA 3ZIAG 2PF4E 1V54B 5LOVA 1MABG 5J2UB 1L8DA 2EILB 3Q4HB 5CA0A 4LFAB 4H44B 3E89A 1V55B 4MVOA 4DV5O 2HG5C 3G80A 4IHJB 5HFLA 4LNUA 4GLXA 2DYSC 1VQNV 3AG4B 4O4IA 1XREA 3ABLB 4IYIA 2QDOA 3DXRA 2JGUA 1TVKA 2YXYA 5GW7A 3ABKC 2P5OA 5C8YB 4FMTA 1FXKC 4B3SO 3CRCA 2R9RB 4DR7O 2E5LB 2Y69B 1Z5WA 5D5PA 3B2EE 4QJFB 3CCEV 4GZRB 1G6UA 2ZDIC 1DF5A 1THZA 3ASOC 5CB4B 4UB8Z 1K4CC 4L87A 3ZHVA 5LHHA 1S5HC 1JQ0A 1TA8A 2X6AA 3CJHB 1H8HG 4I55B 3ZS8C 4F6RA 1ROPA 2JK5C 2HFEC 5CA1A 4CS2A 1VMGA 1SS3A 1KBHA 5LYJB 3T1HB 3JALB 4JI8O 3ZRWB 4DW1A 4R8CA 2XOKG 4DO2A 4HYOA 4PDLA 4DV6O 1Z5VA 3A0HZ 4DUZO 4LC1A 4RQFA 3NR7A 2DE0X 3K79A 1I5YA 1M56B 5IYBO 2JS5A 4D7TA 1VQ7V 3L74H 1BSMA 3F7YC 2G38A 3ZHSA 4LF6B 3E35A 1U97A 3D36A 1VQ8V 4J80A 4GX1A 4J9ZB 2EX3A 3WB1A 3OMAB 2DWEC 4K3AA 1LNQA 1G1XB 5IYCO 2UXXA 1S5LZ 1HR0O 2Q7HA 5KX5B 5JCOA 2JGDB 3H1JH 3LUTB 4JAUA 4JV5B 1VQPV 5LGUA 1SA0A 2YEVB 3K3WA 3AK2A 4Z1MG 1JVMA 5L3GA 1M57B 2F66C 1VQ4V 3CXHF 5KHKA 1PP9H 3F7VC 3SYOA 2AW9A 1QR9A 5B1OA 4U3JB 4JYAB 3CCQV 4LFBO 1SERA 5LGTA 5IYDO 3HKEA 5IJ9A 1EFRG 1SQGA 2Q0OC 1HP8A 5LMNB 2UU9B 4KFMA 1BE3H 1GM9A 4JI0B 2ZNJA 1N33O 3HKBB 3M99B 2MK3A 1CXZB 5BXZA 1N34O 4KHPO 3SGIA 3F5TA 3T1YB 3FB8C 4DRXB 2JS3A 3LDCA 3JSLA 3ZMZA 5IWAO 1YITV 3RYCA 1ZWIC 3CE2A 1Y4MA 2RDCA 3FFQA 2FKXA 3CCVV 1K92A 2V4DA 2Q7GA 4LF9B 2ZE7A 3DC5A 1WLEA 2Q69A 5JJEB 4EB6B 1F7YA 4B3TB 3ASNC 3OT7A 4PA3A 2RN9A 2DYSB 1S72V 4IIJA 1WB8A 2YXLA 1Q43A 3TK1A 4FPPA 2VQFO 4MVUA 3K9SA 3K0DA 4UVAA 5B3SB 4JI5O 1SETA 4LWSA 4RO2A 4AQYO 2OIGA 2R9AA 3RYHA 2UXDO 4UCOA 2UUAO 2VQEB 3CCSV 1RP3B 3D36C 3N2KB 1XOUA 1E1QG 1VF5B 4WFEA 2OYQA 3KCYA 5EYPA 5L3FA 3QG5A 5JWPA 4PA6A 1V9PA 1Q81W 2EIKB 1MZEA 2JRIA 1UPGA 3U0ZA 1Y6XA 4JYYA 4BW5A 4UCTA 3K5LA 3IAYA 1JJOA 2IJJA 1Y67A 2XASA 2QM4A 1HNZO 3T4DA 2XAQA 4DR5O 4PA7A 2B5UA 1BS3A 1COWG 3ZHRA 4DV6B 5H2FZ 3S3WA 3K06A 3DC6A 3E8FA 3M8AA 1OJHA 2ATKC 3JCUZ 2GTAA 5DECA 5B1AC 4DV3B 3BA9A 3OEHG 4X64O 3EXAA 5KMGA 1FJGB 4JAVA 1XNQO 1K97A 1G8MA 4TQDA 1YHQV 1NR7A 2WLIB 4TUYB 4MTOA 2JEXA 1BHBA 3SJCC 3UQ8A 3CRAA 1R6NA 5IDJA 3K59A 3GVMA 3RYFA 2YS8A 3E86A 2BSKB 3JASA 3JAMN 2NN4A 3OTOB 1I5XA 3OR7C 1K5QA 3QNEA 2WLLB 1VQ5V 3UT5B 5J2TA 1VQMV 1X59A 3BY6A 5FNVB 1NVPD 1PV0A 3WG7C 2EINC 2WLNA 2HJFC 3A8TA 5LOVB 1KMIZ 4J10A 2QWOB 2JVDA 5CA0B 4J7ZA 4DR6O 1ZLZA 3SJBC 4FLWA 1WPXA 2ZINA 3ABMC 2OT5A 4LNUB 1RFYA 3E8GA 1J5EO 5FPOA 4O4IB 3W7UA 2HKOA 3P32A 4FLUA 3KZIZ 3DXRB 2ZT9B 3HKDA 4EEQA 1SKVA 1B04A 1TVKB 1ZUQA 4CC6A 5EIBD 3T4ZA 3JYCA 4MTFA 3H01A 2DOSA 4QPKA 5A2QN 2PUSA 2RJZA 1QBZA 4JGSA 2YC0A 2YIBD 3AG2C 1YF2A 4B08A 1N34B 2EIJC 4PDVA 1SC5B 5FL7G 2QWQB 2AHZA 5LGNA 2NNUA 2QTOA 2L6LA 3G6EV 4NVPA 2HR3A 1V54C 3OTFA 1GAXA 1VEWA 1YEWA 2EILC 3K5OA 4F6RB 3QVNA 3K57A 4NXNB 1V55C 5CA1B 1YZBA 2GV9A 4QGPA 4MS2A 1Q6IA 3IC9A 2FTKA 2O57A 5LHGA 3AG3B 3D3QA 3AG4C 3L73H 4WFGA 1VP7A 3ABLC 1P7GA 5L3CA 2B1GA 3JAKA 3MHHC 1AROP 1KKDA 4CZZA 4LF8B 3PJSK 3U10A 1NTMH 1JJ2U 2E5LO 1KD1W 2Y4UA 2P4KA 3GWOA 1GN2A 1VQKV 3OR6C 3CPWU 3TXQA 5LXTB 4GCZA 4H13B 2HJDA 1PPJH 4CS3A 5LP6A 1IX9A 2XAGA 5CBFA 3VQYA 2FMLA 4NTWA 4UUJC 3T1HO 2W0FC 2P90A 1XMOB 2BOBC 1QR8A 4FM2A 4KUMA 4DV1B 3EHBB 1AI6A 1L0NH 1S5JA 4JTCB 2QEXV 1KUQA 5JJJB 1F4NA 2N04A 5EK0A 4FK5C 2PGGA 2AHYA 5JH7A 2LGWA 2HLDG 4DR1B 2OTJV 4LF6O 5LA6A 1OCCB 2DW4A 3HKEB 5IJ9B 4YY3B 2IU0A 4PV1B 3RFRA 5KA5A 4LF4B 1N32B 4GX5A 1BT8A 1Y76A 4X1KA 5CA3A 4CH3A 1W2BU 1GMGA 1I0HA 3ZHUA 1GKFA 3B4SA 3BPZA 4DV7B 4LF7O 4PDMA 5FPRA 2KKWA 4P30A 3RYCB 2M7WA 1US6A 1M57C 1M5IA 3WFVA 3AK3A 1IXBA 3HB3B 1R3LC 1VQ9V 3LDEA 1B06A 1MA1A 4PI2A 1URFA 1AP5A 1D5NA 1KU9A 4JYAO 3VBBA 3A2FA 2FYUH 3H1LH 1WA8A 1XHZA 4JI1B 4DUYB 3APQA 1OHHG 1U96A 2IBZH 4O4HB 4IIJB 4TWKA 2ZKOA 1VF6C 3JD1A 1JMKC 5LMNO 2UU9O 3CRRA 4JI0O 2R9IA 4QNHB 2OCHA 3K58A 3MD0A 4LWSB 4ABMA 3RYHB 5CBHA 2IU3A 3AG2B 3T1YO 2A9HA 3CCRV 3ZCCA 3CEIA 3U11A 4YJ2A 3G71V 3CD6V 1GTOA 3BFRA 5EYPB 4F4LA 5LP6C 4LFCB 4Q6GA 3E83A 4X8AA 1ZAUA 1YSCA 2ZE6A 3LNNA 1D2DA 2X0LA 2EIMB 1BHAA 4LF9O 2NLJC 4OPAA 2WWWA 4J7KA 3T1CA 4B3TO 1NS1A 1UFIA 3E22A 4X20A 5F2VO 3CX5F 1SZTA 2Y4TA 2W6IG 4DR2B 4X65B 5B3SC 4BIOA 1W0KG 1QQCA 3IC7A 2GHYA 2Q7EA 5C93A 3A0RA 4WFFA 4MTXA 5KMGB 3CCMV 2VQEO 1Q86W 1AB3A 1QNMA 2ODMA 2RCVA 1OCZC 2D3OW 5E79Z 2EIKC 1XILA 1GO3F 5H9CA 3RYFB 3JASB 4ZOLA 1SZXA 1QLEB 1WP8A 3L70H 4JF3A 3M7MX 2VRZA 4TV8A 4X9QA 5J2TB 3G67A 3OUSA 4UXNA 1RSOA 4X89A 1DGSA 3KG2A 4DV3O 2Q5ZA 3FB7C 4FIPC 1QCEA 2WLMA 2IJIA 1FJGO 2QR4A 5EBMC 1LUWA 2JEUA 2EJ7A 5LXTA 3BABA 3HKDB 1Q82W 3SPGA 3K5NA 1BQ0A 5IY5C 2RNBA 5BR8B 3OTOO 4DYLA 4G28B 3MHSC 1GN3A 4LF7B 4FZ0A 3CRQA 1HDJA 4DV0B 2N05A 2E3CA 4DV4B 4B7KA 4MVZA 4P9PA 2K9PA 2IW5A 2A3QA 1S76D 1RPRA 1EM1A 4W4KA 1ENVA 1K5SA 3SYCA 2KSDA 4L8JA 4XDLA 3JAKB 4J9YB 3EFFK 1N0JA 1GK9A 4JTAB 4FFBA 4R50A 3P3PA 4WBNA 3JAWA 3ZX6A 2ZIMA 5LMUB 1DK1A 4DK1A 3BA8A 2ZXWC 5AG2A 2W0XA 4N21A 2GDSA 1N4CA 2XT9A 2L35A 3RGBA 4U7NA 3BHPA 4H37A 2ARHA 1TUBA 5LP6B 5LHIA 4NKGB 4NXNO 1Q6HA 1KYOF 3ZBHA 4OX9B 3AG3C 2EULA 1XI1A 5LBQA 2RQ6A 2EJRA 4MTGA 1XUQA 2XUMA 2XAFA 4JI2B 1LR1A 4KXRA 4O4HA 1LUVA 1SQBH 3CS5A 2GSMB 1CPYA 2PI4A 4BW9A 4LF8O 4JYCA 1G4YB 3CCLV 3DTUB 1FAFA 4I9WA 1H2MA 5JH7B 3JCZA 5EBLC 4TOIA 4YIOA 5LA6B 4ZBMA 3FKSG 1FFXA 1Q90D 2YIDA 2FB5A 1OCZB 1Y76B 5KA6A 4JZ2A 3K04A 4X1KB 3R65A 2UXBB 1XMOO 2ZR2A 1KB9F 1NBMG 5DEDA 4DV1O 1TUEB 1P7BA 2Q8VA 1S3JA 3OMNB 5JCOC 2IH1C 2F93B 3UO2A 4O4JA 2QSAA 3QO8A 5KHGA 3ZMVA 2AZ0A 3OD4A 5GTHZ 4JPRA 2IH3C 4DXWA 1PD3A 4PA9A 1XL4A 4R7CA 4ZI7A 1IDSA 1WA8B 1OCCC 4DR1O 2UXCB 2NR5A 1PL4A 4YY3O 2QKSA 5KAIZ 3TJTA 4LF4O 1N32O 4NTXA 4I7ZB 4KP4A 4GKJB 1OCRB 1NT2B 1K3EA 3QF7A 1VQOV 3STLC 4BWAA 1EZVH 2Y48A 5IY5B 4DV7O 5CBGA 1Q6UA 3JD4A 3AEIA 1H8EG 4YJ2B 3UKMA 1HNXB 2R70A 2X7RB 3E8HA 3OGCC 3LSUA 2Z0AA 3AG7A 4GX2A 1AI7A 1KECA 1IBMB 1Y74A 1QU7A 1EZJA 1IBLB 1FFTB 1GRJA 4O2AA 5K1PA 1SESA 5L3DA 2ZE5A 1YJNV 4DW0A 4JI3B 4JI1O 4FLVA 4DUYO 3E22B 4X20B 1AP6A 1SQVH 3CC2V 2QWNB 3E2EA 3CRMA 1XHXA 4OPHA 4QE9A 3ETDA 1Q5OA 1K9MW 1AR4A 2QWRB 2Y0IA 3FYEB 4XBFA 1SRYA 4UV9A 1WP7A 4FLZA 2A06H 1AJNA 1FKAO 5KHIA 1Y66A 2DWDC 4FLTA 3ZHTA 1ORQC 4PA4A 2ZXWB 3SDLA 4LFCO 3ETQA 2YIBA 1VF7A 4JASA 3O65A 2EIMC 1JR9A 2XAHA 5KHJA 2DYRC 4MVQA 1SQXH 4FJCC 4BR6A 1KC8W 4MSWC 4ZOLB 5FLXN 1HNWB 2JJ1G 1XQ8A 1JPXA 4TV8B 2BCCH 2DN9A 1SQQH 4B3MB 3BCCH 4DR2O 2YICA 4X65O 3EVKA 2D2CB 4XDKA 2KQXA 1RSOB 4PJ0Z 1TGOA 2E74B 2ITDC 3WU2Z 4H33A 4OGQB 4ZKIA 5D5QA 4HZ3A 1H38A 3THOA 2ZIOA 4A5UB 2XAJA 4N23A 2CAZC 1QVFU 3N27A 1SQPH 2V1DA 3VQVA 4GKKB 2QWPB 1BZKA 3R66A 4JI6B 2Q0AA 1YVWA 2P6JA 2WSSG 4JYBA 4RAIA 2LGQA 4JI4B 1QLEC 2ADQB 3C3TA 1F23A 1SQFA 5ITZA 1R6KA 3SPHA 1F4MA 4NYKA 4NTYA 4LH7A 2VWJA 1H2GA 1K33A 2IJKA 3ZMUA 2YXHA 3JARB 4BIZA 4J41A 2ZM6O 4FLYA 2UUBB 3ZN1A 1YI2V 4IL6Z 2CGNA 3AG1B 2F43G 3I5DA 4GUNA 2LO1A 3B8MA 1NI8A 1BMFG 4K8ZA 3RBZA 3OM3B 3ICXA 3IJ4A 5BY1A 1HWYA 3ZN0A 4FFKA 3CC7V 2OTLV 4FFBB 1I08A 4WBNB 3JAWB 4F6EA 1H2KA 3VOUA 1FXKA 2OWOA 5BR8O 2QA4V 3RVZA 5EIBC 1AVMA 4GT1A 4MW3A 3FX7A 1OCOB 4I4TA 1Q3EA 2MW2B 3AK1A 1N8RW 3I56V 4X66B 2Q73A 3BRCA 4DV0O 5JQGA 3K5MA 1S77D 1KKCA 3MAQA 4X1IA 4DV4O 2YI9A 1TUBB 1PM9A 2ADPA 4JI7B 4DR3B 2BOCC 1NZ6A 4I0XA 4G27B 3QTCA 5BMVA 1Q8IA 2F95B 2CH7A 2WLKA 5KAFZ 1ZTEA 2QKAA 3OAAG 2Q68A 3ABTA 5KLVH 1EBOA 4HNAA 2R72A 1SF9A 3OEEG 2P4VA 3CB2A 2GTSA 4C7UA 4H0LB 5LMUO 3UCSC 2XHBA 5CMUA 4U7OA 3STZC 1NTZH 1DTOA 2FL4A 2LFRA 4YHHB 4ASUG 4EFBA 4X1YA 5TISZ 4YXWG 5CN0A 1R3IC 5EBWC 1FFXB 2HHHB 4MT8A 1JA8A 4OX9O 1M4UA 4CH6A 1R3KC 5A9GA 4LF5B 2Z3YA 3H1IH 2DYRB 3FD9A 4UCSA 4LH6A 3JD0A 1XDCA 4JI2O 1AJPA 1AI5A 3W7WA 4O4JB 3E8BA 5E1AC 4YIPA 1H2SB 4Z1VA 4MW8A 2ZCEA 1YDXA 4B3RB 1XL6A 2YUAA 1OZ0A 2EZPA 2QTSA 2ZNIA 1FYJA 4ZI7B 4J7JA 3CXCU 3TXSA 1CP9A 1ZL8A 3I55V 3MDSA 4ZIBA 3F5WC 4YJ3A 1K7DA 1MZFA 2WLJA 1MMMA 4I9QA 3UM7A 1MSDA 4RUFA 2UUCB 3J81N 2WA4A 4QPJA 2HP8A 5KHHA 2LQTA 4LR3A 3VQXA 1VQ6V 2DJVA 4R6ZA 1P4RA 3X2QC 1GM8A 2UXBO 2KG7A 2Q9LA 1BL8A 2QJ1A 4FZ1A 1FD9A 2LJ2A 2JIZG 1YJ9V 2YDEA 3CWBH 1NH2D 4K0KB 1NU1H 3H9VA 1BCCH 2GUZB 1Y74B 3J80N 3JD3A 4K8XA 1JCHA 5IYZA 1R1BA 3A0BZ 2ZM6B 4O2AB 4I5SA 3LSQA 1HW7A 1NVPB 2UXCO 2N74A 3W7XA 4PELA 1XMQB 1MOFA 1Z2GA 1NKDA 2CTQA 3CMAV 1OCRC 1M90W 4GKJO 2CK3G 2DQ3A 4WF9V 2V7QG 3ML0A 4UCRA 4WFAV 2PI5A 4AILC 1VQLV 2F4VB 5L3EA 4JAAA 2PY5A 2E75B 2BTQA 1BGYH 5HFMA 1J95A 1NQTA 3WB0A 1HNXO 2PTMA 1F51A 3QO5A 1IBMO 3TGUH 1JOYA 4UB6Z 3TETA 5EZYA 2E76B 4O4LA 1YTFD 2ETNA 4HAMA 2XTAA 3JARA 3QO7A 1IBLO 3IFXA 4LCUC 3ZRSA 4CH5A 2YI8A 1PKXA 1PNLA 4JI3O 2BTOA 4O2BA 2LW7A 4CC5A 4DV2B 1H2LA 3IGAC 3N2GA 3K08A 4D7SA 4PD4F 4GX0A 4X62B 1XNRB 3RYIA 2HEPA 1MNGA 3W7SA 1S0VA 2EZOA 4TQFA 1RPOA 3FYIB 2C2AA 1B3QA 2CTWA 5B1NA 4FVMA 4IGGA 2K1EA 2PYJA 2ILMA 4UCUA 4PHZA 1T5EA 1K34A 5IJ0B 1P84F 1N36B 1ZSPA 1IBKB 3CC4V 1B6QA 3OW2U 1L0LH 2P06A 3NXSA 4TV9A 2OCCB 4FM0A 4MVRA
chains in the Genus database with same CATH topology
2Y4UA 2CTWA 2YS8A 1GH6A 2LGWA 2LO1A 1FPOA 2QWQB 3APOA 3APQA 2EJ7A 1HDJA 1N4CA 2L6LA 1WJZA 2QSAA 2CUGA 2DMXA 2DN9A 2QWNB 3UO2A 2CTQA 2Y4TA 1IURA 3BVOA 2QWPB 2N05A 4RWUA 2CTPA 3AG7A 4J80A 3UO3A 2N04A 1BQZA 2PF4E 2GUZB 2KQXA 4IT5A 2QWOB 2OCHA 2GUZA 2CTRA 1NZ6A 1BQ0A 4J7ZA 1FAFA 2M6YA 3UCSC 2QWRB 1XBLA 2YUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4U A;  2CTW A;  2YS8 A;  1GH6 A;  2LGW A;  2LO1 A;  1FPO A;  2QWQ B;  3APO A;  3APQ A;  2EJ7 A;  1HDJ A;  1N4C A;  2L6L A;  1WJZ A;  2QSA A;  2CUG A;  2DMX A;  2DN9 A;  2QWN B;  3UO2 A;  2CTQ A;  2Y4T A;  1IUR A;  3BVO A;  2QWP B;  2N05 A;  4RWU A;  2CTP A;  3AG7 A;  4J80 A;  3UO3 A;  2N04 A;  1BQZ A;  2PF4 E;  2GUZ B;  2KQX A;  4IT5 A;  2QWO B;  2OCH A;  2GUZ A;  2CTR A;  1NZ6 A;  1BQ0 A;  4J7Z A;  1FAF A;  2M6Y A;  3UCS C;  2QWR B;  1XBL A;  2YUA A; 
#chains in the Genus database with same CATH topology
 2OIE A;  1PL0 A;  4MVM A;  1HNW O;  3RVY A;  1RM1 B;  1D5A A;  4J42 A;  3SJA C;  5ITZ B;  3LSS A;  2F1M A;  4CBC A;  2CUG A;  2F23 A;  4I50 A;  4B3M O;  1DLB A;  3P30 A;  3SPJ A;  1JFF A;  5JVD A;  3UO3 A;  1MSW D;  3HKC A;  2CDY A;  4ZHQ A;  1EN5 A;  2LFS A;  1WPB A;  2M6Y A;  4IYH A;  5B5E Z;  4DK0 A;  1W0J G;  3GB7 C;  4DV5 B;  4J11 A;  1R6T A;  2DQ0 A;  3ZMT A;  1A32 A;  1X4T A;  3ZHQ A;  3APO A;  2YSU B;  3FAV A;  4K35 A;  3ZJZ A;  4GKK O;  3JAT A;  3SYP A;  4JI6 O;  2BE3 A;  2LW1 A;  3ABK B;  4Q20 A;  5JJN B;  3JSN A;  4B3S B;  1FXK B;  2B9Z A;  4DR7 B;  4JI4 O;  3X2Q B;  1QLN A;  2ZQM A;  1GH6 A;  4I4T B;  1GM7 A;  4E2L A;  5JQG B;  3ASO B;  2CE4 A;  2QKC A;  5GON A;  4B7E A;  4X1I B;  5H5N A;  5J2U A;  3HR0 A;  5BZB A;  1JX9 A;  1NR1 A;  3Q4H A;  4I0X B;  3OMI B;  5BMV B;  2UUB O;  4LBE C;  1XBL A;  2CH7 B;  1UJW B;  3AG1 C;  4IHJ A;  4JI8 B;  1CEZ A;  1P49 A;  3C90 A;  2H94 A;  3D3I A;  4HNA B;  1I94 O;  1DF4 A;  2HVJ C;  1AIL A;  4HBN A;  4LP8 A;  1BQZ A;  1KP3 A;  4DUZ B;  3PN1 A;  5C8Y A;  3KCX A;  1N0N A;  2PZS A;  1OCO C;  3G4S V;  1NJI W;  1YJW V;  1FPO A;  1GN6 A;  3OE7 G;  4X66 O;  3B40 A;  4CH4 A;  3RT3 C;  5CB4 A;  4X1Y B;  2A7W A;  2CGO A;  3G6B A;  4FLX A;  3OGI B;  1IUR A;  3L9D A;  3RW0 A;  1KP2 A;  2A79 B;  2Q6A A;  2X6C A;  4JI7 O;  3CJH A;  4DR3 O;  4I55 A;  2GUZ A;  3L72 H;  1EN6 A;  3ZED A;  5LYJ A;  3JAL A;  3ZRW A;  4AHC A;  2PYL A;  1HR0 B;  2X6B A;  1IZ3 A;  4NR1 A;  4EKW A;  5B1B C;  1QHT A;  4AI8 A;  1K8A W;  2IM9 A;  3DGE A;  3DSQ A;  4NXM O;  4DR4 O;  5B66 Z;  3CME V;  2QM8 A;  5EC1 C;  2KB1 A;  2VS0 A;  4WCE V;  1OV9 A;  1PNK A;  2GBO A;  3KKY A;  5H6Q A;  2JDI G;  4Z2W A;  2H3O A;  3CP1 A;  3HPL C;  3OUF A;  3H1K H;  4BAY A;  5L3B A;  1ZL8 B;  4U3F H;  4LFB B;  1O9G A;  4YHH O;  1W59 A;  1WN7 A;  1YCI A;  2VWK A;  4YJ3 B;  1ZX3 A;  5LL6 Y;  2B1I A;  3BVO A;  4RWU A;  2UXN A;  2HHH O;  1H2N A;  5H6R A;  1N33 B;  3K0G A;  3OFN G;  3WB2 A;  2KG7 B;  1M9N A;  2QGN A;  4LF5 O;  5GTI Z;  4KHP B;  3SYA A;  3P3N A;  1VAR A;  3RWR D;  5KX5 A;  2ZD9 A;  3ABU A;  4RUE A;  2JGD A;  3BEH A;  5IWA B;  3B8N A;  2CTP A;  2YEV A;  4GYC B;  4LFA O;  3K03 A;  5IE9 A;  4B3R O;  4NB5 A;  2H8P C;  2IJH A;  5IYZ B;  1NH2 B;  3S3X A;  4XDJ A;  3BAA A;  4TT3 G;  2W6J G;  1FXH A;  3O9O A;  4U3J A;  5DM6 V;  4RQE A;  4CS4 A;  3ASN B;  1WJZ A;  2WLH A;  1O9H A;  5IJ0 A;  4WFH A;  2UUC O;  2RMK B;  1VF6 A;  4X88 A;  2VQF B;  3ETE A;  3SPI A;  1R3J C;  3HKB A;  2Y69 C;  4JI5 B;  1EN4 A;  4UVC A;  4P2Z A;  4UV8 A;  4ICG A;  1Q7Y W;  2AZ2 A;  1M1K W;  4AQY B;  3T2M A;  2BTQ B;  2UXD B;  2UUA B;  2JJ2 G;  1AR1 B;  2WA3 A;  1PNM A;  4DRX A;  1KQS U;  4K0K O;  2QM7 A;  2P22 C;  4QE7 A;  5EZY B;  4O4L B;  4IT5 A;  3GWK C;  4MVS A;  2ZR3 A;  3ZMS A;  1VIB A;  4OXS A;  4QIW F;  4O2B B;  3L75 H;  5J9P C;  1AR5 A;  1I7F A;  4EB6 A;  3CSX A;  1YTF B;  1XMQ O;  3N2G B;  1HNZ B;  4UVB A;  4DR5 B;  1SA0 B;  3C3S A;  2QE7 G;  4PI0 A;  1I94 B;  3TCU A;  5KUK A;  3B77 A;  3RYI B;  2EBO A;  3ZRV A;  2A0L A;  1M56 C;  3L71 H;  5B1A B;  2F4V O;  4X64 B;  3K9A A;  1R73 A;  1GN4 A;  1XEQ A;  2YIA A;  2P67 A;  1M93 A;  3CCU V;  3N2K A;  1XNQ B;  1IXM A;  2ZDI A;  5DN6 G;  2WPD G;  3VQW A;  1MG1 A;  3CHX A;  4UFZ A;  4BIU A;  1FS0 G;  5IT9 N;  1WAZ A;  3LNM B;  3B09 A;  3FB6 C;  3J7A U;  4TV9 B;  4FM1 A;  3LDD A;  3D8C A;  4W4L A;  1K4D C;  2AXT Z;  2Y0P A;  3ZRX A;  4DV2 O;  2ITC C;  3CYO A;  4E4E A;  2P7T C;  1AI4 A;  4JV5 O;  4PDR A;  2DMX A;  4I50 B;  2HVK C;  5B1B B;  1JFF B;  4X62 O;  5JVD B;  5KUM A;  1IVS A;  1XNR O;  4D6T H;  3FB5 C;  3SR2 C;  3HKC B;  3WG7 B;  4JZG A;  2EIN B;  1TAE A;  2CTR A;  4ZHQ B;  1YIJ V;  4NXM B;  1AJQ A;  4DR4 B;  1WNS A;  1E79 G;  4DR6 B;  4TSF G;  1WB7 A;  2WAM A;  3H1H H;  3ABM B;  2LP7 A;  3JD2 A;  4P9O A;  3SYQ A;  2AGA A;  1J5E B;  1FXV A;  1QVG U;  1L1F A;  3FAV B;  1N36 O;  5K1X A;  4TUY A;  2WLI A;  4UCV A;  5EC2 C;  1IBK O;  3JAT B;  4KL1 A;  3W7T A;  4EFE A;  3ETG A;  2OCC C;  1NTK H;  3SJQ C;  3CCJ V;  2Q4P A;  1E1R G;  2ZE8 A;  2BSK A;  2Q67 A;  1RM1 C;  1K73 W;  2EIJ B;  2WLL A;  2XND G;  2Z5U A;  4JTD B;  3SPC A;  4WFB V;  1YXB A;  3RN4 A;  3UT5 A;  4G2K A;  5GON B;  5FNV A;  3ZIA G;  2PF4 E;  1V54 B;  5LOV A;  1MAB G;  5J2U B;  1L8D A;  2EIL B;  3Q4H B;  5CA0 A;  4LFA B;  4H44 B;  3E89 A;  1V55 B;  4MVO A;  4DV5 O;  2HG5 C;  3G80 A;  4IHJ B;  5HFL A;  4LNU A;  4GLX A;  2DYS C;  1VQN V;  3AG4 B;  4O4I A;  1XRE A;  3ABL B;  4IYI A;  2QDO A;  3DXR A;  2JGU A;  1TVK A;  2YXY A;  5GW7 A;  3ABK C;  2P5O A;  5C8Y B;  4FMT A;  1FXK C;  4B3S O;  3CRC A;  2R9R B;  4DR7 O;  2E5L B;  2Y69 B;  1Z5W A;  5D5P A;  3B2E E;  4QJF B;  3CCE V;  4GZR B;  1G6U A;  2ZDI C;  1DF5 A;  1THZ A;  3ASO C;  5CB4 B;  4UB8 Z;  1K4C C;  4L87 A;  3ZHV A;  5LHH A;  1S5H C;  1JQ0 A;  1TA8 A;  2X6A A;  3CJH B;  1H8H G;  4I55 B;  3ZS8 C;  4F6R A;  1ROP A;  2JK5 C;  2HFE C;  5CA1 A;  4CS2 A;  1VMG A;  1SS3 A;  1KBH A;  5LYJ B;  3T1H B;  3JAL B;  4JI8 O;  3ZRW B;  4DW1 A;  4R8C A;  2XOK G;  4DO2 A;  4HYO A;  4PDL A;  4DV6 O;  1Z5V A;  3A0H Z;  4DUZ O;  4LC1 A;  4RQF A;  3NR7 A;  2DE0 X;  3K79 A;  1I5Y A;  1M56 B;  5IYB O;  2JS5 A;  4D7T A;  1VQ7 V;  3L74 H;  1BSM A;  3F7Y C;  2G38 A;  3ZHS A;  4LF6 B;  3E35 A;  1U97 A;  3D36 A;  1VQ8 V;  4J80 A;  4GX1 A;  4J9Z B;  2EX3 A;  3WB1 A;  3OMA B;  2DWE C;  4K3A A;  1LNQ A;  1G1X B;  5IYC O;  2UXX A;  1S5L Z;  1HR0 O;  2Q7H A;  5KX5 B;  5JCO A;  2JGD B;  3H1J H;  3LUT B;  4JAU A;  4JV5 B;  1VQP V;  5LGU A;  1SA0 A;  2YEV B;  3K3W A;  3AK2 A;  4Z1M G;  1JVM A;  5L3G A;  1M57 B;  2F66 C;  1VQ4 V;  3CXH F;  5KHK A;  1PP9 H;  3F7V C;  3SYO A;  2AW9 A;  1QR9 A;  5B1O A;  4U3J B;  4JYA B;  3CCQ V;  4LFB O;  1SER A;  5LGT A;  5IYD O;  3HKE A;  5IJ9 A;  1EFR G;  1SQG A;  2Q0O C;  1HP8 A;  5LMN B;  2UU9 B;  4KFM A;  1BE3 H;  1GM9 A;  4JI0 B;  2ZNJ A;  1N33 O;  3HKB B;  3M99 B;  2MK3 A;  1CXZ B;  5BXZ A;  1N34 O;  4KHP O;  3SGI A;  3F5T A;  3T1Y B;  3FB8 C;  4DRX B;  2JS3 A;  3LDC A;  3JSL A;  3ZMZ A;  5IWA O;  1YIT V;  3RYC A;  1ZWI C;  3CE2 A;  1Y4M A;  2RDC A;  3FFQ A;  2FKX A;  3CCV V;  1K92 A;  2V4D A;  2Q7G A;  4LF9 B;  2ZE7 A;  3DC5 A;  1WLE A;  2Q69 A;  5JJE B;  4EB6 B;  1F7Y A;  4B3T B;  3ASN C;  3OT7 A;  4PA3 A;  2RN9 A;  2DYS B;  1S72 V;  4IIJ A;  1WB8 A;  2YXL A;  1Q43 A;  3TK1 A;  4FPP A;  2VQF O;  4MVU A;  3K9S A;  3K0D A;  4UVA A;  5B3S B;  4JI5 O;  1SET A;  4LWS A;  4RO2 A;  4AQY O;  2OIG A;  2R9A A;  3RYH A;  2UXD O;  4UCO A;  2UUA O;  2VQE B;  3CCS V;  1RP3 B;  3D36 C;  3N2K B;  1XOU A;  1E1Q G;  1VF5 B;  4WFE A;  2OYQ A;  3KCY A;  5EYP A;  5L3F A;  3QG5 A;  5JWP A;  4PA6 A;  1V9P A;  1Q81 W;  2EIK B;  1MZE A;  2JRI A;  1UPG A;  3U0Z A;  1Y6X A;  4JYY A;  4BW5 A;  4UCT A;  3K5L A;  3IAY A;  1JJO A;  2IJJ A;  1Y67 A;  2XAS A;  2QM4 A;  1HNZ O;  3T4D A;  2XAQ A;  4DR5 O;  4PA7 A;  2B5U A;  1BS3 A;  1COW G;  3ZHR A;  4DV6 B;  5H2F Z;  3S3W A;  3K06 A;  3DC6 A;  3E8F A;  3M8A A;  1OJH A;  2ATK C;  3JCU Z;  2GTA A;  5DEC A;  5B1A C;  4DV3 B;  3BA9 A;  3OEH G;  4X64 O;  3EXA A;  5KMG A;  1FJG B;  4JAV A;  1XNQ O;  1K97 A;  1G8M A;  4TQD A;  1YHQ V;  1NR7 A;  2WLI B;  4TUY B;  4MTO A;  2JEX A;  1BHB A;  3SJC C;  3UQ8 A;  3CRA A;  1R6N A;  5IDJ A;  3K59 A;  3GVM A;  3RYF A;  2YS8 A;  3E86 A;  2BSK B;  3JAS A;  3JAM N;  2NN4 A;  3OTO B;  1I5X A;  3OR7 C;  1K5Q A;  3QNE A;  2WLL B;  1VQ5 V;  3UT5 B;  5J2T A;  1VQM V;  1X59 A;  3BY6 A;  5FNV B;  1NVP D;  1PV0 A;  3WG7 C;  2EIN C;  2WLN A;  2HJF C;  3A8T A;  5LOV B;  1KMI Z;  4J10 A;  2QWO B;  2JVD A;  5CA0 B;  4J7Z A;  4DR6 O;  1ZLZ A;  3SJB C;  4FLW A;  1WPX A;  2ZIN A;  3ABM C;  2OT5 A;  4LNU B;  1RFY A;  3E8G A;  1J5E O;  5FPO A;  4O4I B;  3W7U A;  2HKO A;  3P32 A;  4FLU A;  3KZI Z;  3DXR B;  2ZT9 B;  3HKD A;  4EEQ A;  1SKV A;  1B04 A;  1TVK B;  1ZUQ A;  4CC6 A;  5EIB D;  3T4Z A;  3JYC A;  4MTF A;  3H01 A;  2DOS A;  4QPK A;  5A2Q N;  2PUS A;  2RJZ A;  1QBZ A;  4JGS A;  2YC0 A;  2YIB D;  3AG2 C;  1YF2 A;  4B08 A;  1N34 B;  2EIJ C;  4PDV A;  1SC5 B;  5FL7 G;  2QWQ B;  2AHZ A;  5LGN A;  2NNU A;  2QTO A;  2L6L A;  3G6E V;  4NVP A;  2HR3 A;  1V54 C;  3OTF A;  1GAX A;  1VEW A;  1YEW A;  2EIL C;  3K5O A;  4F6R B;  3QVN A;  3K57 A;  4NXN B;  1V55 C;  5CA1 B;  1YZB A;  2GV9 A;  4QGP A;  4MS2 A;  1Q6I A;  3IC9 A;  2FTK A;  2O57 A;  5LHG A;  3AG3 B;  3D3Q A;  3AG4 C;  3L73 H;  4WFG A;  1VP7 A;  3ABL C;  1P7G A;  5L3C A;  2B1G A;  3JAK A;  3MHH C;  1ARO P;  1KKD A;  4CZZ A;  4LF8 B;  3PJS K;  3U10 A;  1NTM H;  1JJ2 U;  2E5L O;  1KD1 W;  2Y4U A;  2P4K A;  3GWO A;  1GN2 A;  1VQK V;  3OR6 C;  3CPW U;  3TXQ A;  5LXT B;  4GCZ A;  4H13 B;  2HJD A;  1PPJ H;  4CS3 A;  5LP6 A;  1IX9 A;  2XAG A;  5CBF A;  3VQY A;  2FML A;  4NTW A;  4UUJ C;  3T1H O;  2W0F C;  2P90 A;  1XMO B;  2BOB C;  1QR8 A;  4FM2 A;  4KUM A;  4DV1 B;  3EHB B;  1AI6 A;  1L0N H;  1S5J A;  4JTC B;  2QEX V;  1KUQ A;  5JJJ B;  1F4N A;  2N04 A;  5EK0 A;  4FK5 C;  2PGG A;  2AHY A;  5JH7 A;  2LGW A;  2HLD G;  4DR1 B;  2OTJ V;  4LF6 O;  5LA6 A;  1OCC B;  2DW4 A;  3HKE B;  5IJ9 B;  4YY3 B;  2IU0 A;  4PV1 B;  3RFR A;  5KA5 A;  4LF4 B;  1N32 B;  4GX5 A;  1BT8 A;  1Y76 A;  4X1K A;  5CA3 A;  4CH3 A;  1W2B U;  1GMG A;  1I0H A;  3ZHU A;  1GKF A;  3B4S A;  3BPZ A;  4DV7 B;  4LF7 O;  4PDM A;  5FPR A;  2KKW A;  4P30 A;  3RYC B;  2M7W A;  1US6 A;  1M57 C;  1M5I A;  3WFV A;  3AK3 A;  1IXB A;  3HB3 B;  1R3L C;  1VQ9 V;  3LDE A;  1B06 A;  1MA1 A;  4PI2 A;  1URF A;  1AP5 A;  1D5N A;  1KU9 A;  4JYA O;  3VBB A;  3A2F A;  2FYU H;  3H1L H;  1WA8 A;  1XHZ A;  4JI1 B;  4DUY B;  3APQ A;  1OHH G;  1U96 A;  2IBZ H;  4O4H B;  4IIJ B;  4TWK A;  2ZKO A;  1VF6 C;  3JD1 A;  1JMK C;  5LMN O;  2UU9 O;  3CRR A;  4JI0 O;  2R9I A;  4QNH B;  2OCH A;  3K58 A;  3MD0 A;  4LWS B;  4ABM A;  3RYH B;  5CBH A;  2IU3 A;  3AG2 B;  3T1Y O;  2A9H A;  3CCR V;  3ZCC A;  3CEI A;  3U11 A;  4YJ2 A;  3G71 V;  3CD6 V;  1GTO A;  3BFR A;  5EYP B;  4F4L A;  5LP6 C;  4LFC B;  4Q6G A;  3E83 A;  4X8A A;  1ZAU A;  1YSC A;  2ZE6 A;  3LNN A;  1D2D A;  2X0L A;  2EIM B;  1BHA A;  4LF9 O;  2NLJ C;  4OPA A;  2WWW A;  4J7K A;  3T1C A;  4B3T O;  1NS1 A;  1UFI A;  3E22 A;  4X20 A;  5F2V O;  3CX5 F;  1SZT A;  2Y4T A;  2W6I G;  4DR2 B;  4X65 B;  5B3S C;  4BIO A;  1W0K G;  1QQC A;  3IC7 A;  2GHY A;  2Q7E A;  5C93 A;  3A0R A;  4WFF A;  4MTX A;  5KMG B;  3CCM V;  2VQE O;  1Q86 W;  1AB3 A;  1QNM A;  2ODM A;  2RCV A;  1OCZ C;  2D3O W;  5E79 Z;  2EIK C;  1XIL A;  1GO3 F;  5H9C A;  3RYF B;  3JAS B;  4ZOL A;  1SZX A;  1QLE B;  1WP8 A;  3L70 H;  4JF3 A;  3M7M X;  2VRZ A;  4TV8 A;  4X9Q A;  5J2T B;  3G67 A;  3OUS A;  4UXN A;  1RSO A;  4X89 A;  1DGS A;  3KG2 A;  4DV3 O;  2Q5Z A;  3FB7 C;  4FIP C;  1QCE A;  2WLM A;  2IJI A;  1FJG O;  2QR4 A;  5EBM C;  1LUW A;  2JEU A;  2EJ7 A;  5LXT A;  3BAB A;  3HKD B;  1Q82 W;  3SPG A;  3K5N A;  1BQ0 A;  5IY5 C;  2RNB A;  5BR8 B;  3OTO O;  4DYL A;  4G28 B;  3MHS C;  1GN3 A;  4LF7 B;  4FZ0 A;  3CRQ A;  1HDJ A;  4DV0 B;  2N05 A;  2E3C A;  4DV4 B;  4B7K A;  4MVZ A;  4P9P A;  2K9P A;  2IW5 A;  2A3Q A;  1S76 D;  1RPR A;  1EM1 A;  4W4K A;  1ENV A;  1K5S A;  3SYC A;  2KSD A;  4L8J A;  4XDL A;  3JAK B;  4J9Y B;  3EFF K;  1N0J A;  1GK9 A;  4JTA B;  4FFB A;  4R50 A;  3P3P A;  4WBN A;  3JAW A;  3ZX6 A;  2ZIM A;  5LMU B;  1DK1 A;  4DK1 A;  3BA8 A;  2ZXW C;  5AG2 A;  2W0X A;  4N21 A;  2GDS A;  1N4C A;  2XT9 A;  2L35 A;  3RGB A;  4U7N A;  3BHP A;  4H37 A;  2ARH A;  1TUB A;  5LP6 B;  5LHI A;  4NKG B;  4NXN O;  1Q6H A;  1KYO F;  3ZBH A;  4OX9 B;  3AG3 C;  2EUL A;  1XI1 A;  5LBQ A;  2RQ6 A;  2EJR A;  4MTG A;  1XUQ A;  2XUM A;  2XAF A;  4JI2 B;  1LR1 A;  4KXR A;  4O4H A;  1LUV A;  1SQB H;  3CS5 A;  2GSM B;  1CPY A;  2PI4 A;  4BW9 A;  4LF8 O;  4JYC A;  1G4Y B;  3CCL V;  3DTU B;  1FAF A;  4I9W A;  1H2M A;  5JH7 B;  3JCZ A;  5EBL C;  4TOI A;  4YIO A;  5LA6 B;  4ZBM A;  3FKS G;  1FFX A;  1Q90 D;  2YID A;  2FB5 A;  1OCZ B;  1Y76 B;  5KA6 A;  4JZ2 A;  3K04 A;  4X1K B;  3R65 A;  2UXB B;  1XMO O;  2ZR2 A;  1KB9 F;  1NBM G;  5DED A;  4DV1 O;  1TUE B;  1P7B A;  2Q8V A;  1S3J A;  3OMN B;  5JCO C;  2IH1 C;  2F93 B;  3UO2 A;  4O4J A;  2QSA A;  3QO8 A;  5KHG A;  3ZMV A;  2AZ0 A;  3OD4 A;  5GTH Z;  4JPR A;  2IH3 C;  4DXW A;  1PD3 A;  4PA9 A;  1XL4 A;  4R7C A;  4ZI7 A;  1IDS A;  1WA8 B;  1OCC C;  4DR1 O;  2UXC B;  2NR5 A;  1PL4 A;  4YY3 O;  2QKS A;  5KAI Z;  3TJT A;  4LF4 O;  1N32 O;  4NTX A;  4I7Z B;  4KP4 A;  4GKJ B;  1OCR B;  1NT2 B;  1K3E A;  3QF7 A;  1VQO V;  3STL C;  4BWA A;  1EZV H;  2Y48 A;  5IY5 B;  4DV7 O;  5CBG A;  1Q6U A;  3JD4 A;  3AEI A;  1H8E G;  4YJ2 B;  3UKM A;  1HNX B;  2R70 A;  2X7R B;  3E8H A;  3OGC C;  3LSU A;  2Z0A A;  3AG7 A;  4GX2 A;  1AI7 A;  1KEC A;  1IBM B;  1Y74 A;  1QU7 A;  1EZJ A;  1IBL B;  1FFT B;  1GRJ A;  4O2A A;  5K1P A;  1SES A;  5L3D A;  2ZE5 A;  1YJN V;  4DW0 A;  4JI3 B;  4JI1 O;  4FLV A;  4DUY O;  3E22 B;  4X20 B;  1AP6 A;  1SQV H;  3CC2 V;  2QWN B;  3E2E A;  3CRM A;  1XHX A;  4OPH A;  4QE9 A;  3ETD A;  1Q5O A;  1K9M W;  1AR4 A;  2QWR B;  2Y0I A;  3FYE B;  4XBF A;  1SRY A;  4UV9 A;  1WP7 A;  4FLZ A;  2A06 H;  1AJN A;  1FKA O;  5KHI A;  1Y66 A;  2DWD C;  4FLT A;  3ZHT A;  1ORQ C;  4PA4 A;  2ZXW B;  3SDL A;  4LFC O;  3ETQ A;  2YIB A;  1VF7 A;  4JAS A;  3O65 A;  2EIM C;  1JR9 A;  2XAH A;  5KHJ A;  2DYR C;  4MVQ A;  1SQX H;  4FJC C;  4BR6 A;  1KC8 W;  4MSW C;  4ZOL B;  5FLX N;  1HNW B;  2JJ1 G;  1XQ8 A;  1JPX A;  4TV8 B;  2BCC H;  2DN9 A;  1SQQ H;  4B3M B;  3BCC H;  4DR2 O;  2YIC A;  4X65 O;  3EVK A;  2D2C B;  4XDK A;  2KQX A;  1RSO B;  4PJ0 Z;  1TGO A;  2E74 B;  2ITD C;  3WU2 Z;  4H33 A;  4OGQ B;  4ZKI A;  5D5Q A;  4HZ3 A;  1H38 A;  3THO A;  2ZIO A;  4A5U B;  2XAJ A;  4N23 A;  2CAZ C;  1QVF U;  3N27 A;  1SQP H;  2V1D A;  3VQV A;  4GKK B;  2QWP B;  1BZK A;  3R66 A;  4JI6 B;  2Q0A A;  1YVW A;  2P6J A;  2WSS G;  4JYB A;  4RAI A;  2LGQ A;  4JI4 B;  1QLE C;  2ADQ B;  3C3T A;  1F23 A;  1SQF A;  5ITZ A;  1R6K A;  3SPH A;  1F4M A;  4NYK A;  4NTY A;  4LH7 A;  2VWJ A;  1H2G A;  1K33 A;  2IJK A;  3ZMU A;  2YXH A;  3JAR B;  4BIZ A;  4J41 A;  2ZM6 O;  4FLY A;  2UUB B;  3ZN1 A;  1YI2 V;  4IL6 Z;  2CGN A;  3AG1 B;  2F43 G;  3I5D A;  4GUN A;  2LO1 A;  3B8M A;  1NI8 A;  1BMF G;  4K8Z A;  3RBZ A;  3OM3 B;  3ICX A;  3IJ4 A;  5BY1 A;  1HWY A;  3ZN0 A;  4FFK A;  3CC7 V;  2OTL V;  4FFB B;  1I08 A;  4WBN B;  3JAW B;  4F6E A;  1H2K A;  3VOU A;  1FXK A;  2OWO A;  5BR8 O;  2QA4 V;  3RVZ A;  5EIB C;  1AVM A;  4GT1 A;  4MW3 A;  3FX7 A;  1OCO B;  4I4T A;  1Q3E A;  2MW2 B;  3AK1 A;  1N8R W;  3I56 V;  4X66 B;  2Q73 A;  3BRC A;  4DV0 O;  5JQG A;  3K5M A;  1S77 D;  1KKC A;  3MAQ A;  4X1I A;  4DV4 O;  2YI9 A;  1TUB B;  1PM9 A;  2ADP A;  4JI7 B;  4DR3 B;  2BOC C;  1NZ6 A;  4I0X A;  4G27 B;  3QTC A;  5BMV A;  1Q8I A;  2F95 B;  2CH7 A;  2WLK A;  5KAF Z;  1ZTE A;  2QKA A;  3OAA G;  2Q68 A;  3ABT A;  5KLV H;  1EBO A;  4HNA A;  2R72 A;  1SF9 A;  3OEE G;  2P4V A;  3CB2 A;  2GTS A;  4C7U A;  4H0L B;  5LMU O;  3UCS C;  2XHB A;  5CMU A;  4U7O A;  3STZ C;  1NTZ H;  1DTO A;  2FL4 A;  2LFR A;  4YHH B;  4ASU G;  4EFB A;  4X1Y A;  5TIS Z;  4YXW G;  5CN0 A;  1R3I C;  5EBW C;  1FFX B;  2HHH B;  4MT8 A;  1JA8 A;  4OX9 O;  1M4U A;  4CH6 A;  1R3K C;  5A9G A;  4LF5 B;  2Z3Y A;  3H1I H;  2DYR B;  3FD9 A;  4UCS A;  4LH6 A;  3JD0 A;  1XDC A;  4JI2 O;  1AJP A;  1AI5 A;  3W7W A;  4O4J B;  3E8B A;  5E1A C;  4YIP A;  1H2S B;  4Z1V A;  4MW8 A;  2ZCE A;  1YDX A;  4B3R B;  1XL6 A;  2YUA A;  1OZ0 A;  2EZP A;  2QTS A;  2ZNI A;  1FYJ A;  4ZI7 B;  4J7J A;  3CXC U;  3TXS A;  1CP9 A;  1ZL8 A;  3I55 V;  3MDS A;  4ZIB A;  3F5W C;  4YJ3 A;  1K7D A;  1MZF A;  2WLJ A;  1MMM A;  4I9Q A;  3UM7 A;  1MSD A;  4RUF A;  2UUC B;  3J81 N;  2WA4 A;  4QPJ A;  2HP8 A;  5KHH A;  2LQT A;  4LR3 A;  3VQX A;  1VQ6 V;  2DJV A;  4R6Z A;  1P4R A;  3X2Q C;  1GM8 A;  2UXB O;  2KG7 A;  2Q9L A;  1BL8 A;  2QJ1 A;  4FZ1 A;  1FD9 A;  2LJ2 A;  2JIZ G;  1YJ9 V;  2YDE A;  3CWB H;  1NH2 D;  4K0K B;  1NU1 H;  3H9V A;  1BCC H;  2GUZ B;  1Y74 B;  3J80 N;  3JD3 A;  4K8X A;  1JCH A;  5IYZ A;  1R1B A;  3A0B Z;  2ZM6 B;  4O2A B;  4I5S A;  3LSQ A;  1HW7 A;  1NVP B;  2UXC O;  2N74 A;  3W7X A;  4PEL A;  1XMQ B;  1MOF A;  1Z2G A;  1NKD A;  2CTQ A;  3CMA V;  1OCR C;  1M90 W;  4GKJ O;  2CK3 G;  2DQ3 A;  4WF9 V;  2V7Q G;  3ML0 A;  4UCR A;  4WFA V;  2PI5 A;  4AIL C;  1VQL V;  2F4V B;  5L3E A;  4JAA A;  2PY5 A;  2E75 B;  2BTQ A;  1BGY H;  5HFM A;  1J95 A;  1NQT A;  3WB0 A;  1HNX O;  2PTM A;  1F51 A;  3QO5 A;  1IBM O;  3TGU H;  1JOY A;  4UB6 Z;  3TET A;  5EZY A;  2E76 B;  4O4L A;  1YTF D;  2ETN A;  4HAM A;  2XTA A;  3JAR A;  3QO7 A;  1IBL O;  3IFX A;  4LCU C;  3ZRS A;  4CH5 A;  2YI8 A;  1PKX A;  1PNL A;  4JI3 O;  2BTO A;  4O2B A;  2LW7 A;  4CC5 A;  4DV2 B;  1H2L A;  3IGA C;  3N2G A;  3K08 A;  4D7S A;  4PD4 F;  4GX0 A;  4X62 B;  1XNR B;  3RYI A;  2HEP A;  1MNG A;  3W7S A;  1S0V A;  2EZO A;  4TQF A;  1RPO A;  3FYI B;  2C2A A;  1B3Q A;  2CTW A;  5B1N A;  4FVM A;  4IGG A;  2K1E A;  2PYJ A;  2ILM A;  4UCU A;  4PHZ A;  1T5E A;  1K34 A;  5IJ0 B;  1P84 F;  1N36 B;  1ZSP A;  1IBK B;  3CC4 V;  1B6Q A;  3OW2 U;  1L0L H;  2P06 A;  3NXS A;  4TV9 A;  2OCC B;  4FM0 A;  4MVR A; 
#chains in the Genus database with same CATH homology
 2Y4U A;  2CTW A;  2YS8 A;  1GH6 A;  2LGW A;  2LO1 A;  1FPO A;  2QWQ B;  3APO A;  3APQ A;  2EJ7 A;  1HDJ A;  1N4C A;  2L6L A;  1WJZ A;  2QSA A;  2CUG A;  2DMX A;  2DN9 A;  2QWN B;  3UO2 A;  2CTQ A;  2Y4T A;  1IUR A;  3BVO A;  2QWP B;  2N05 A;  4RWU A;  2CTP A;  3AG7 A;  4J80 A;  3UO3 A;  2N04 A;  1BQZ A;  2PF4 E;  2GUZ B;  2KQX A;  4IT5 A;  2QWO B;  2OCH A;  2GUZ A;  2CTR A;  1NZ6 A;  1BQ0 A;  4J7Z A;  1FAF A;  2M6Y A;  3UCS C;  2QWR B;  1XBL A;  2YUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...