2KQXA

Nmr structure of the j-domain (residues 2-72) in the escherichia coli cbpa
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
b'ELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYDQMWQHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Curved DNA-binding protein
publication title Structural basis of the regulation of the CbpA co-chaperone by its specific modulator CbpM.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Chaperone binding protein
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2kqxA00
2DMXA 2QWPB 2EJ7A 2GUZB 2OCHA 2QSAA 3APQA 2KQXA 2LO1A 2CTQA 4IT5A 2CTRA 3UCSC 2PF4E 3APOA 2CTPA 1GH6A 2DN9A 3AG7A 1XBLA 2N05A 4J7ZA 2QWOB 1IURA 2GUZA 2Y4TA 2CTWA 1BQZA 2M6YA 1FPOA 2CUGA 2LGWA 2L6LA 2QWNB 2YS8A 4J80A 2N04A 1BQ0A 2QWQB 2QWRB 2YUAA 4RWUA 3BVOA 3UO3A 1WJZA 1NZ6A 2Y4UA 1HDJA 1FAFA 1N4CA 3UO2A
chains in the Genus database with same CATH superfamily
3TXQA 2QSAA 4B3RB 2XOKG 4NTYA 1LR1A 4DO2A 2FMLA 3RYHB 4JGSA 1S77D 4UV9A 2IH3C 4JF3A 4I7ZB 1AI5A 4OPHA 4D7SA 4J42A 3CRQA 2YI8A 4UCTA 1N8RW 1AR5A 4O2BA 1MZFA 3E86A 3P3PA 4P9PA 2BOBC 2QGNA 3K08A 5JVDA 3SDLA 4LFCO 2WLLA 2HFEC 4MTFA 1SQGA 3T4ZA 4O4LB 2Y0IA 5IE9A 4O2AB 1FFTB 4R7CA 3ZHTA 4JAVA 3H01A 1B3QA 1XNQB 1ZLZA 5H6RA 3K0DA 1QR9A 3O9OA 4MVRA 4O4JA 5LGUA 3ABLC 2LW1A 4FK5C 4YY3O 2F93B 1IBMB 1UFIA 1GM7A 2OWOA 1VQPV 3KZIZ 5LL6Y 4KL1A 2DYRC 2EX3A 1NR1A 3ZEDA 4LF8B 2ODMA 3EFFK 1XNRO 4X64B 4UCRA 3C3SA 1Q86W 3SR2C 2X6AA 2UU9B 3LDEA 4LR3A 3SYPA 3CRMA 3JAMN 1IVSA 1N36B 4FZ0A 4WFBV 4LF9O 4ZOLA 4GYCB 3OUSA 5IDJA 1N0JA 5L3CA 1DK1A 1OHHG 3SJCC 1EBOA 3L71H 2QA4V 2F95B 2JJ1G 3OEEG 1Q43A 4MVUA 2IJKA 1PNKA 3LDDA 4CC6A 2VS0A 4X1IB 2CGNA 2QM8A 3D8CA 3RVYA 4X66B 3D36A 2IJJA 3CCMV 4TWKA 3I55V 1NZ6A 4GUNA 1GKFA 3ICXA 4WF9V 1MSWD 3FB6C 1KYOF 4LBEC 4DR3B 1Q6IA 4GX2A 3OMIB 3ZX6A 1WP7A 1VQLV 1K4DC 3OAAG 3ETQA 3SPCA 1WNSA 1CP9A 4Z1VA 1K7DA 2WLIA 3CMEV 3JARB 4C7UA 4F6EA 2ZDIA 4FLTA 1VQ9V 1H38A 5EZYA 2UUCB 3JD2A 3UT5A 3T2MA 1G4YB 2UXBO 4PD4F 5LOVA 3T1YB 3F7VC 2RCVA 5GONB 3ZHUA 3DSQA 4LF7B 2AHZA 4HYOA 2UXBB 1M56C 1NI8A 1Y67A 4I4TB 3N2KA 2WAMA 4IHJB 1DGSA 2VQFO 1HNZO 1S72V 2KG7B 4CC5A 4P30A 4FJCC 2ZKOA 4NTXA 2QM4A 2F1MA 4JTCB 1QQCA 4HNAB 2RMKB 3RYFB 4LF6O 1QR8A 4B3MO 1GK9A 4X9QA 2UUBO 2PZSA 4J41A 2JS5A 4IYHA 4JI5B 3WG7B 3K79A 1I94O 2FL4A 2HLDG 3AG4C 2VQEO 1VF5B 5CBHA 1GAXA 4ZI7B 2IU3A 3LNMB 3A8TA 1GM8A 4UUJC 4BAYA 1RSOB 1O9HA 1R73A 4CH3A 1NVPB 1IBKB 2XNDG 3GB7C 3CCRV 3AG1C 1BQZA 1FPOA 1QHTA 3SYCA 2K9PA 4QPJA 2WLNA 2Q69A 4U3FH 3JD4A 1K8AW 3QO8A 4TV8A 2V7QG 2Q7GA 1AJQA 2AW9A 3ASOB 4AI8A 3CCSV 4K8ZA 1H8HG 2OTJV 2AHYA 1ORQC 3JCZA 4N23A 3CJHB 1V54B 4P2ZA 4GKKB 4DUYO 5EBLC 1M57C 4X88A 5CBFA 4K0KO 1GO3F 3RWRD 4O2BB 1VQKV 1XL4A 4MT8A 2HJFC 2E76B 1P49A 3NR7A 1RPOA 4LF4B 1HNWB 5EC1C 4MS2A 2WLLB 1M93A 5C93A 4DYLA 4X62O 3OW2U 1FD9A 1D2DA 3WU2Z 1XEQA 1S76D 2ZXWB 4O4JB 3H1JH 3WB2A 4L87A 2RNBA 1FXVA 2XASA 2Y69C 3L9DA 4J9YB 1OCOC 3CHXA 3OE7G 3FX7A 4HZ3A 3M8AA 3W7XA 3W7WA 3D36C 2A06H 1K5SA 3M99B 4UVCA 4J11A 3LUTB 4UCSA 3EHBB 1QVFU 1AP6A 1PM9A 4XDKA 1VF7A 1QLEB 4NKGB 3STLC 3CMAV 3AG3C 3VQWA 1K92A 2ZE5A 4LP8A 5LHHA 1COWG 1L1FA 2JEXA 4KHPO 4JI1B 4DV1B 2P5OA 3Q4HB 3FD9A 4B3SB 4FFBA 3HKCA 3U10A 1HR0O 3AK3A 4KHPB 1AJPA 1US6A 2N74A 1W59A 1NVPD 2EINB 4UVBA 1OCZB 1B6QA 4NTWA 5IWAB 2MK3A 4PI0A 1PV0A 5BR8B 3F7YC 2YEVB 3BA9A 3MHHC 4LFBB 4GX5A 3W7TA 3CCLV 1JJOA 2HVJC 1S3JA 4RUEA 4NR1A 4WFHA 1KP3A 2XAQA 2EIJC 3ZRXA 4PA4A 5E79Z 1H2MA 4OPAA 2PTMA 3T1HO 3G67A 2EILC 1EFRG 2XAHA 3N2KB 5D5QA 3CS5A 3T1HB 2P22C 2XUMA 1KUQA 4J7JA 1XMQB 4PI2A 1NH2B 4DR6O 4YJ3B 5KX5B 2JGDA 5IYZA 4DV2O 1VIBA 2PGGA 3JAWA 1VEWA 1BSMA 3OFNG 4DV2B 3QG5A 3E8FA 1FAFA 1O9GA 4R8CA 3WFVA 5LYJB 3OMAB 1WAZA 5LGNA 3ABUA 1GH6A 1XQ8A 4LF5O 1UPGA 3JATB 3RW0A 1Y66A 4GT1A 1DTOA 4AHCA 3ASNB 1Q3EA 1VARA 1NBMG 1H2NA 3N2GB 1GRJA 2QEXV 1OCCB 1SQPH 2ARHA 2VRZA 5CA0A 3A0BZ 1VQMV 1K73W 4BIUA 1KBHA 4WBNB 4MW3A 2WA4A 4BIZA 4X89A 2YDEA 4MVQA 2M6YA 5KA5A 1N33O 1DF4A 1FYJA 1K33A 2BTQA 2ZM6O 1YZBA 1R6NA 2ZNJA 2QKCA 5IJ0A 2OCHA 2XAGA 1IXBA 3K5OA 1HW7A 5IJ9A 3FAVA 4OGQB 3E89A 4TT3G 4JI2O 2ZINA 1KD1W 5CMUA 3JCUZ 1CPYA 4QGPA 1X4TA 1P7BA 4MVSA 3FB7C 2DYSB 4X65B 5EBMC 2F23A 3CRAA 3FYIB 3K06A 1N32O 2HHHO 3LNNA 1XMOB 3T4DA 3TETA 4H33A 4TQDA 1J5EO 5JQGB 1WB7A 1N32B 2CE4A 5KAIZ 1BHBA 3S3XA 1F4MA 1J5EB 4TUYA 1OCRB 1AB3A 2ZT9B 1D5AA 1XOUA 3HKEB 3B8MA 1BHAA 1BMFG 4DR2B 1JMKC 1Z2GA 4DV6O 3N27A 3RVZA 4DRXA 3CEIA 5FNVA 4DR5B 4F6RB 2QWPB 4W4KA 3ZRSA 5JJNB 5H9CA 5A2QN 1AROP 3OTOO 3PJSK 3SPHA 2JGUA 5LMNB 2CAZC 1NH2D 2IBZH 1FXHA 4U7NA 3ABKB 2D2CB 3OTOB 4NXNO 2DOSA 1OZ0A 3SJQC 2EULA 1N34O 1SF9A 1MG1A 1E79G 5C8YB 4K3AA 3OUFA 4CH6A 2IJHA 4XDLA 2OTLV 1NR7A 4DV5O 2Q73A 4IT5A 2HJDA 4MTXA 1N0NA 3BAAA 3ZN0A 4P9OA 1IURA 1Y6XA 2UXXA 4DR7O 4CZZA 2ITCC 5IYDO 1NTZH 4FFBB 3HKCB 4RUFA 4IIJA 2PYLA 2ADQB 3ZJZA 5EK0A 3HKDA 2DQ0A 4D6TH 4KP4A 3THOA 3OGCC 5E1AC 3DXRB 4CH4A 3AG2B 1JX9A 3STZC 1I7FA 4IGGA 3J80N 4JAAA 1OV9A 3HKBB 3SPJA 1IBLO 1AI7A 1Z5WA 3CWBH 3OD4A 4LWSB 4JV5O 1DLBA 3B09A 4KUMA 4I0XA 4DV3O 5CA3A 1V9PA 3BCCH 1BS3A 5BY1A 2QWOB 1W0JG 4LFCB 1Y74B 3G71V 3TCUA 4J80A 4GCZA 4DUZO 1ENVA 3LSQA 4X1KB 2EJ7A 4UCVA 3JAWB 3QF7A 4YY3B 2Z3YA 2V4DA 3SYAA 2P06A 3SJAC 3ZRWB 3B40A 5JH7B 4NVPA 1JR9A 3WB1A 1XNRB 5BMVB 3CP1A 2ZD9A 3DC5A 4DR4O 1I5XA 2WPDG 3K9AA 4TQFA 3K9SA 2X6BA 4IL6Z 4DV0O 2XT9A 4NXMO 4TV9A 2ZE6A 3B77A 4LF9B 2DYRB 5LA6A 2QDOA 3D3QA 4NXMB 5KHJA 1SQQH 4JI3O 3ZN1A 1AJNA 5CA0B 2H8PC 1G8MA 1PP9H 4MTGA 1H2SB 1WLEA 1ZWIC 4JTAB 1FXKB 1GM9A 4G2KA 1Q7YW 2DN9A 4MVMA 4LCUC 2UXNA 5GTIZ 2KSDA 5IJ0B 3TXSA 3CCVV 5CB4A 2IH1C 5D5PA 3E35A 1ZL8A 5J9PC 2HEPA 5IJ9B 3FAVB 2Y4UA 3AK1A 2M7WA 3H1HH 2KKWA 2YIAA 2QJ1A 2E75B 3JALB 1RPRA 2R9RB 5F2VO 1NKDA 1TAEA 2WLKA 4X20B 2QWRB 4EKWA 3RYCA 1WJZA 4CS2A 4YHHO 1GTOA 4UB6Z 1CEZA 2VQFB 1HNZB 2LO1A 4FLYA 2W6JG 3IC9A 5FNVB 3WG7C 3CCUV 1YITV 2YXHA 4GLXA 1E1RG 1I08A 3U11A 2CH7A 1M56B 2HG5C 4FPPA 1BL8A 4LF6B 4MSWC 4EB6A 5KMGB 1X59A 2Q0OC 4B3MB 2UUBB 2QE7G 2YC0A 2YIDA 2YI9A 3CRCA 2ZE8A 3JSNA 4O4IB 1RM1C 2DE0X 1I94B 3T1CA 5CA1B 1F23A 1P4RA 1XUQA 4PA6A 2VQEB 3ABTA 5B1AC 1YSCA 2QTOA 3TK1A 2UXDO 4U3JA 2XAJA 4JASA 2EJRA 4JI8O 1WN7A 4PELA 3LSSA 3IAYA 1Q5OA 4J9ZB 5L3DA 3P30A 2Q67A 2PUSA 2E3CA 2IU0A 3AG4B 1Q8IA 2PF4E 3APOA 4I50A 1KMIZ 1XBLA 1Q6UA 2HR3A 2QKSA 1ZTEA 4F4LA 2QR4A 1BGYH 4FFKA 3ZHRA 2Z0AA 2B9ZA 4MVOA 4W4LA 1JFFA 2ZIMA 1EZVH 4JZGA 2NR5A 1VP7A 3HPLC 4DUYB 4YIOA 3ETEA 2OCCB 4MTOA 4K0KB 3RYIA 1FJGO 5J2UA 5JVDB 3RN4A 4I0XB 1ZAUA 3C3TA 2CGOA 3UO3A 3CSXA 4PA9A 1URFA 1Y76A 3E2EA 2ZXWC 5B3SB 5B1NA 1VQNV 2JRIA 1U96A 2IM9A 5IY5B 4X62B 2F4VO 2UUAO 2YICA 4DW1A 3GVMA 2BCCH 4G28B 3ZIAG 3JAKA 4K35A 1K97A 2LP7A 2UUAB 1WP8A 3W7SA 4LH7A 2WA3A 5GW7A 1YXBA 4DV4O 4DR1O 3O65A 1H8EG 3E22A 3JSLA 5EC2C 1NT2B 1XI1A 1K3EA 1NS1A 5CN0A 4DV7O 1SZTA 2XTAA 4X8AA 2P67A 4ZOLB 4JI6O 4CH5A 1TUBA 1YVWA 2N04A 1FKAO 1SA0A 2Y69B 3BPZA 4KFMA 4ZBMA 5KHGA 1OCOB 5LMUO 3K03A 5LXTA 1H2LA 1F4NA 4PA7A 4YJ2A 4JI4O 2YIBD 5H6QA 5IYBO 3U0ZA 1OCZC 4N21A 3MDSA 1Q82W 1R3JC 5JCOA 2BSKA 4QE7A 1PPJH 1HNXO 3LDCA 1SQVH 1WPXA 2EIMC 5EIBD 4B3TO 1HR0B 3K5MA 2FKXA 3BABA 2YUAA 4KXRA 2DJVA 3FYEB 5L3BA 2UXCO 1SRYA 2B1IA 1HNXB 2LW7A 4PDRA 5HFLA 5CB4B 2WLIB 3UCSC 3VBBA 1TVKA 2Q4PA 1ZL8B 4PJ0Z 3ML0A 1PNMA 1IDSA 1VQ5V 5EZYB 5DN6G 4ASUG 4DXWA 1S0VA 1L0NH 3UT5B 1XHXA 3RYHA 5LOVB 3OT7A 4JTDB 4ICGA 3EXAA 1MMMA 1JPXA 2LQTA 3A0HZ 4FM2A 1KU9A 2P7TC 3IFXA 2RN9A 2F66C 3RYCB 4XBFA 3J7AU 2JK5C 3GWOA 4MVZA 2EIJB 2V1DA 2WLHA 2L6LA 2QWNB 4DR6B 4FLZA 2ZQMA 1HDJA 4O2AA 4JYYA 1VQOV 1E1QG 1M5IA 5FLXN 5A9GA 2EILB 1TGOA 3L70H 3D3IA 5IYCO 4X1YA 1W0KG 4JYAO 2P4VA 2Q0AA 3I56V 2PI4A 3ASNC 3CB2A 1I0HA 1W2BU 2ZIOA 3ETGA 3E8GA 4PA3A 4LF5B 5KUMA 2ZNIA 2JVDA 2GTAA 1LNQA 3LSUA 1KB9F 5KAFZ 2JEUA 1MNGA 3CC4V 2CK3G 4U3JB 2ITDC 2LJ2A 1TA8A 1QBZA 1EZJA 3BY6A 4L8JA 4TV8B 2K1EA 4LC1A 2B5UA 3RFRA 4FLXA 4B7KA 4I50B 5J2TA 5HFMA 3CXCU 4RAIA 4WFEA 4OX9O 1N33B 3APQA 4EEQA 2AZ2A 1V55B 2ZM6B 3KG2A 5B1BC 4I5SA 2N05A 1EN6A 3L73H 4TOIA 1U97A 5DM6V 3X2QC 2DYSC 1JFFB 1VQ7V 5KUKA 1YIJV 4ABMA 4JYBA 3JASA 4JI2B 4AQYO 3FKSG 4R6ZA 2Q5ZA 3EVKA 3ZS8C 4ZHQA 1Q81W 4JPRA 3DC6A 1OCRC 4XDJA 4MW8A 4J7ZA 2HHHB 2JIZG 1Y76B 4H44B 1KC8W 5LHGA 2OIGA 3JD0A 3ZMTA 3K5LA 1R6KA 1SS3A 3H1IH 2A9HA 3NXSA 5KHIA 5EYPA 5FPRA 1SC5B 3JAKB 4DV6B 2KG7A 3ABKC 3K58A 1XHZA 2RJZA 4HNAA 1CXZB 1S5LZ 2X7RB 4CS4A 2EBOA 1WA8A 3ABMB 3W7UA 2R70A 3UO2A 4NXNB 5JCOC 5LP6C 3RBZA 1EM1A 2EIKB 1N34B 5KHKA 4H0LB 1TUBB 2ATKC 4JI0O 4JI7O 5GTHZ 1SA0B 3CYOA 4DV5B 2Q7HA 5LXTB 5FL7G 1NQTA 2GHYA 4DR7B 4I9WA 3MAQA 3S3WA 4E4EA 1AILA 4LFAO 3AG7A 1VF6C 1S5JA 1AR1B 1THZA 3IJ4A 1VQ4V 1SQBH 3ZBHA 2X6CA 1P7GA 2WWWA 4B3RO 1KKCA 4FLWA 1QNMA 5BZBA 5FPOA 1RFYA 1Q6HA 5DEDA 1D5NA 2QTSA 4UVAA 3K5NA 2HP8A 4QNHB 1UJWB 3CJHA 3H1KH 1IBLB 2NNUA 2X0LA 4BW5A 4JV5B 3ZMSA 2CDYA 1FS0G 3B8NA 2H3OA 1BCCH 4DV3B 1H2KA 1BZKA 5H2FZ 3CC2V 3M7MX 3QTCA 2JGDB 5IYZB 1KKDA 5K1PA 4RQFA 3ZMVA 1MOFA 2CTQA 2XHBA 1G6UA 1M1KW 4DUZB 1XNQO 4TSFG 5K1XA 3DTUB 2JJ2G 1IBMO 4PV1B 4UCOA 1NTMH 5CBGA 3QO5A 3WB0A 1FFXA 4FM1A 3A0RA 1YDXA 2ADPA 1GMGA 4X1YB 4I55A 4LF8O 2DMXA 4X64O 3ABLB 1Y4MA 1YTFB 3OR7C 4LH6A 3G6EV 3PN1A 5BXZA 2UU9O 3JD3A 3FB8C 1QCEA 4DR4B 1YEWA 1N36O 1F7YA 2GUZA 5LBQA 2EZOA 3AK2A 2P90A 4DV0B 4BIOA 2P6JA 5LGTA 2Q9LA 1A32A 4PDVA 4O4HA 1FXKC 1GN2A 2YXLA 4GX0A 1N4CA 3BHPA 4JI3B 2DWEC 3P3NA 1LUWA 2LFSA 5L3FA 3QVNA 4X66O 3IGAC 1G1XB 3C90A 4DK1A 5J2TB 2BTQB 2YSUB 1AP5A 3K04A 3Q4HA 5L3GA 4QJFB 4DR3O 3OTFA 5B5EZ 2Y48A 3UM7A 3KKYA 1S5HC 4U7OA 1JQ0A 2YEVA 4PDLA 2FB5A 2L35A 2Q6AA 4NB5A 5IT9N 3JASB 1PKXA 1IX9A 3VQYA 3QO7A 4DK0A 2UUCO 4ZHQB 3DGEA 2Q7EA 1L0LH 1XREA 1WB8A 3T1YO 4RWUA 4K8XA 4BR6A 1GN6A 4LF7O 3K0GA 2NN4A 1KP2A 4FIPC 4YXWG 3VOUA 4TUYB 2R9AA 1YCIA 1BT8A 1HWYA 4YHHB 1IXMA 3KCYA 4RQEA 1K9MW 2OYQA 4DRXB 4PHZA 3CC7V 3I5DA 2ZE7A 3F5WC 1R6TA 5EYPB 2P4KA 4YJ3A 5KX5A 1YJ9V 1WPBA 1HP8A 5DECA 1ZUQA 3MD0A 1YF2A 3L75H 1WA8B 2ZR2A 3OR6C 4JI5O 4LNUA 2RDCA 5EIBC 3H1LH 1LUVA 5LYJA 3ZRVA 5TISZ 1JJ2U 3FB5C 2ZCEA 1J95A 2GSMB 3JATA 1JCHA 3ASOC 3ZHVA 2UXDB 1IBKO 4G27B 4JI8B 4HBNA 1YTFD 2A3QA 2XAFA 1RM1B 1NTKH 3N2GA 4D7TA 4J10A 4IIJB 3CX5F 1PL4A 1V54C 5EBWC 5B1AB 4NYKA 3HKDB 5H5NA 5L3EA 2A79B 3OGIB 1M90W 4WBNA 3AG1B 1R3LC 3ZMZA 4Z1MG 4JZ2A 1EN5A 2IW5A 5KA6A 2OCCC 2BE3A 3L74H 5JJJB 2HKOA 3ZHSA 4QPKA 3K59A 4GKKO 5KHHA 1MZEA 1QLNA 2YS8A 2HVKC 4FMTA 5B3SC 1YJWV 5IY5C 5B1OA 4DW0A 1FJGB 5ITZA 4LF4O 1HNWO 2CTPA 2GTSA 4ZKIA 4OXSA 2PI5A 1ROPA 1M57B 2JS3A 3SYQA 1B06A 2WSSG 2DQ3A 4FM0A 2LFRA 1VQ8V 1KQSU 1GN3A 2BOCC 1R3KC 2CTWA 5JQGA 2PYJA 3SGIA 2F4VB 3UQ8A 3UKMA 4UCUA 3BA8A 4EFBA 3CCQV 3CCJV 1VQ6V 3HR0A 3HKEA 2JDIG 5JJEB 2KQXA 4UB8Z 3K3WA 4QIWF 4GX1A 3A2FA 1QLEC 1RP3B 1FFXB 4F6RA 4DV4B 4E2LA 4DR1B 4I55B 3SPGA 5LHIA 2QM7A 3SPIA 4H37A 2FTKA 3E83A 4WFGA 2Y0PA 1BE3H 2GBOA 4TV9B 4DV7B 3JYCA 1IZ3A 2W6IG 2GUZB 5LA6B 3G4SV 1XILA 4JI6B 1SETA 3P32A 5C8YA 4YIPA 4O4HB 1H2GA 2EINC 3ZCCA 5LMUB 1QU7A 4JYCA 4BWAA 3CD6V 4GZRB 4JAUA 1SQXH 3R65A 5JWPA 4R50A 4JI4B 4JI1O 5LP6A 4DV1O 2QWQB 3SJBC 4B3SO 1PNLA 3AG3B 2ZDIC 2E5LO 4B3TB 1ZSPA 2AGAA 4FZ1A 2UXCB 5IWAO 3H9VA 2E5LB 5BR8O 4GKJO 3QNEA 4LFBO 2Q68A 2Q8VA 1R3IC 3DXRA 4GKJB 3G80A 3CXHF 5KLVH 2EIMB 2AZ0A 2PY5A 1VF6A 1SESA 4CBCA 3BFRA 4WCEV 3HKBA 1M4UA 2ZR3A 3L72H 3AEIA 1M9NA 1P84F 4B7EA 4LWSA 1Q90D 2Z5UA 3B2EE 4A5UB 4UFZA 3CPWU 3TJTA 2H94A 1L8DA 1XL6A 1AR4A 1XMQO 1K5QA 4O4LA 4PDMA 1Y74A 2A0LA 4FLUA 4Q6GA 2CH7B 2W0FC 1T5EA 2ETNA 3CCEV 4EB6B 4X1KA 2LGQA 1DF5A 1PL0A 3HB3B 3IC7A 2W0XA 2AXTZ 3GWKC 2GDSA 3RGBA 1BQ0A 4LNUB 1R1BA 4QE9A 3ZRWA 4JYAB 1EN4A 1OCCC 5JH7A 3ETDA 1B04A 3SYOA 1QVGU 2DWDC 3E8BA 1GN4A 5BMVA 1AI4A 2CTRA 3G6BA 2R9IA 1I5YA 3OM3B 2ILMA 3ZMUA 1Z5VA 4UV8A 4EFEA 3F5TA 2OT5A 3K57A 1ZX3A 1V55C 1XDCA 1SERA 3OMNB 3R66A 1OJHA 4RO2A 4X1IA 4HAMA 2VWJA 4UXNA 1AVMA 2RQ6A 2BTOA 3ZHQA 3JD1A 1VMGA 4OX9B 1TUEB 2G38A 2Y4TA 1FXKA 1YHQV 3BRCA 1SKVA 4I9QA 1JVMA 5B66Z 4WFFA 3JARA 4AILC 2EZPA 3RYIB 1SQFA 2C2AA 1MABG 2O57A 1AI6A 5J2UB 4AQYB 3E8HA 1F51A 4Q20A 4X65O 3FFQA 2MW2B 5B1BB 1MA1A 3MHSC 1XMOO 3JALA 3J81N 5ITZB 3X2QB 5GONA 2QKAA 2YXYA 4Z2WA 2B1GA 3CRRA 4I4TA 1NJIW 2GV9A 4X20A 4IHJA 2DW4A 1KECA 4DR2O 2D3OW 1K34A 2IJIA 1YJNV 2WLMA 3VQVA 4CS3A 4FLVA 3ABMC 4DR5O 3RYFA 2CUGA 1JA8A 3CE2A 3TGUH 4FVMA 3E22B 1NU1H 1SZXA 2EIKC 5LMNO 1K4CC 3KCXA 2R72A 3VQXA 2VWKA 1PD3A 1YI2V 3RT3C 5KMGA 2F43G 4J7KA 2FYUH 1JOYA 4ZIBA 3OEHG 2E74B 4ZI7A 4O4IA 2NLJC 2YIBA 5AG2A 2LGWA 4IYIA 5CA1A 1RSOA 4JI7B 4JI0B 4YJ2B 3BVOA 1MSDA 4BW9A 4WFAV 3AG2C 2BSKB 3BEHA 4B08A 5LP6B 2A7WA 2KB1A 3B4SA 2WLJA 4LFAB 2OIEA 1TVKB 4H13B
chains in the Genus database with same CATH topology
2DMXA 2QWPB 2EJ7A 2GUZB 2OCHA 2QSAA 3APQA 2KQXA 2LO1A 2CTQA 4IT5A 2CTRA 3UCSC 2PF4E 3APOA 2CTPA 1GH6A 2DN9A 3AG7A 1XBLA 2N05A 4J7ZA 2QWOB 1IURA 2GUZA 2Y4TA 2CTWA 1BQZA 2M6YA 1FPOA 2CUGA 2LGWA 2L6LA 2QWNB 2YS8A 4J80A 2N04A 1BQ0A 2QWQB 2QWRB 2YUAA 4RWUA 3BVOA 3UO3A 1WJZA 1NZ6A 2Y4UA 1HDJA 1FAFA 1N4CA 3UO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMX A;  2QWP B;  2EJ7 A;  2GUZ B;  2OCH A;  2QSA A;  3APQ A;  2KQX A;  2LO1 A;  2CTQ A;  4IT5 A;  2CTR A;  3UCS C;  2PF4 E;  3APO A;  2CTP A;  1GH6 A;  2DN9 A;  3AG7 A;  1XBL A;  2N05 A;  4J7Z A;  2QWO B;  1IUR A;  2GUZ A;  2Y4T A;  2CTW A;  1BQZ A;  2M6Y A;  1FPO A;  2CUG A;  2LGW A;  2L6L A;  2QWN B;  2YS8 A;  4J80 A;  2N04 A;  1BQ0 A;  2QWQ B;  2QWR B;  2YUA A;  4RWU A;  3BVO A;  3UO3 A;  1WJZ A;  1NZ6 A;  2Y4U A;  1HDJ A;  1FAF A;  1N4C A;  3UO2 A; 
#chains in the Genus database with same CATH topology
 3TXQ A;  2QSA A;  4B3R B;  2XOK G;  4NTY A;  1LR1 A;  4DO2 A;  2FML A;  3RYH B;  4JGS A;  1S77 D;  4UV9 A;  2IH3 C;  4JF3 A;  4I7Z B;  1AI5 A;  4OPH A;  4D7S A;  4J42 A;  3CRQ A;  2YI8 A;  4UCT A;  1N8R W;  1AR5 A;  4O2B A;  1MZF A;  3E86 A;  3P3P A;  4P9P A;  2BOB C;  2QGN A;  3K08 A;  5JVD A;  3SDL A;  4LFC O;  2WLL A;  2HFE C;  4MTF A;  1SQG A;  3T4Z A;  4O4L B;  2Y0I A;  5IE9 A;  4O2A B;  1FFT B;  4R7C A;  3ZHT A;  4JAV A;  3H01 A;  1B3Q A;  1XNQ B;  1ZLZ A;  5H6R A;  3K0D A;  1QR9 A;  3O9O A;  4MVR A;  4O4J A;  5LGU A;  3ABL C;  2LW1 A;  4FK5 C;  4YY3 O;  2F93 B;  1IBM B;  1UFI A;  1GM7 A;  2OWO A;  1VQP V;  3KZI Z;  5LL6 Y;  4KL1 A;  2DYR C;  2EX3 A;  1NR1 A;  3ZED A;  4LF8 B;  2ODM A;  3EFF K;  1XNR O;  4X64 B;  4UCR A;  3C3S A;  1Q86 W;  3SR2 C;  2X6A A;  2UU9 B;  3LDE A;  4LR3 A;  3SYP A;  3CRM A;  3JAM N;  1IVS A;  1N36 B;  4FZ0 A;  4WFB V;  4LF9 O;  4ZOL A;  4GYC B;  3OUS A;  5IDJ A;  1N0J A;  5L3C A;  1DK1 A;  1OHH G;  3SJC C;  1EBO A;  3L71 H;  2QA4 V;  2F95 B;  2JJ1 G;  3OEE G;  1Q43 A;  4MVU A;  2IJK A;  1PNK A;  3LDD A;  4CC6 A;  2VS0 A;  4X1I B;  2CGN A;  2QM8 A;  3D8C A;  3RVY A;  4X66 B;  3D36 A;  2IJJ A;  3CCM V;  4TWK A;  3I55 V;  1NZ6 A;  4GUN A;  1GKF A;  3ICX A;  4WF9 V;  1MSW D;  3FB6 C;  1KYO F;  4LBE C;  4DR3 B;  1Q6I A;  4GX2 A;  3OMI B;  3ZX6 A;  1WP7 A;  1VQL V;  1K4D C;  3OAA G;  3ETQ A;  3SPC A;  1WNS A;  1CP9 A;  4Z1V A;  1K7D A;  2WLI A;  3CME V;  3JAR B;  4C7U A;  4F6E A;  2ZDI A;  4FLT A;  1VQ9 V;  1H38 A;  5EZY A;  2UUC B;  3JD2 A;  3UT5 A;  3T2M A;  1G4Y B;  2UXB O;  4PD4 F;  5LOV A;  3T1Y B;  3F7V C;  2RCV A;  5GON B;  3ZHU A;  3DSQ A;  4LF7 B;  2AHZ A;  4HYO A;  2UXB B;  1M56 C;  1NI8 A;  1Y67 A;  4I4T B;  3N2K A;  2WAM A;  4IHJ B;  1DGS A;  2VQF O;  1HNZ O;  1S72 V;  2KG7 B;  4CC5 A;  4P30 A;  4FJC C;  2ZKO A;  4NTX A;  2QM4 A;  2F1M A;  4JTC B;  1QQC A;  4HNA B;  2RMK B;  3RYF B;  4LF6 O;  1QR8 A;  4B3M O;  1GK9 A;  4X9Q A;  2UUB O;  2PZS A;  4J41 A;  2JS5 A;  4IYH A;  4JI5 B;  3WG7 B;  3K79 A;  1I94 O;  2FL4 A;  2HLD G;  3AG4 C;  2VQE O;  1VF5 B;  5CBH A;  1GAX A;  4ZI7 B;  2IU3 A;  3LNM B;  3A8T A;  1GM8 A;  4UUJ C;  4BAY A;  1RSO B;  1O9H A;  1R73 A;  4CH3 A;  1NVP B;  1IBK B;  2XND G;  3GB7 C;  3CCR V;  3AG1 C;  1BQZ A;  1FPO A;  1QHT A;  3SYC A;  2K9P A;  4QPJ A;  2WLN A;  2Q69 A;  4U3F H;  3JD4 A;  1K8A W;  3QO8 A;  4TV8 A;  2V7Q G;  2Q7G A;  1AJQ A;  2AW9 A;  3ASO B;  4AI8 A;  3CCS V;  4K8Z A;  1H8H G;  2OTJ V;  2AHY A;  1ORQ C;  3JCZ A;  4N23 A;  3CJH B;  1V54 B;  4P2Z A;  4GKK B;  4DUY O;  5EBL C;  1M57 C;  4X88 A;  5CBF A;  4K0K O;  1GO3 F;  3RWR D;  4O2B B;  1VQK V;  1XL4 A;  4MT8 A;  2HJF C;  2E76 B;  1P49 A;  3NR7 A;  1RPO A;  4LF4 B;  1HNW B;  5EC1 C;  4MS2 A;  2WLL B;  1M93 A;  5C93 A;  4DYL A;  4X62 O;  3OW2 U;  1FD9 A;  1D2D A;  3WU2 Z;  1XEQ A;  1S76 D;  2ZXW B;  4O4J B;  3H1J H;  3WB2 A;  4L87 A;  2RNB A;  1FXV A;  2XAS A;  2Y69 C;  3L9D A;  4J9Y B;  1OCO C;  3CHX A;  3OE7 G;  3FX7 A;  4HZ3 A;  3M8A A;  3W7X A;  3W7W A;  3D36 C;  2A06 H;  1K5S A;  3M99 B;  4UVC A;  4J11 A;  3LUT B;  4UCS A;  3EHB B;  1QVF U;  1AP6 A;  1PM9 A;  4XDK A;  1VF7 A;  1QLE B;  4NKG B;  3STL C;  3CMA V;  3AG3 C;  3VQW A;  1K92 A;  2ZE5 A;  4LP8 A;  5LHH A;  1COW G;  1L1F A;  2JEX A;  4KHP O;  4JI1 B;  4DV1 B;  2P5O A;  3Q4H B;  3FD9 A;  4B3S B;  4FFB A;  3HKC A;  3U10 A;  1HR0 O;  3AK3 A;  4KHP B;  1AJP A;  1US6 A;  2N74 A;  1W59 A;  1NVP D;  2EIN B;  4UVB A;  1OCZ B;  1B6Q A;  4NTW A;  5IWA B;  2MK3 A;  4PI0 A;  1PV0 A;  5BR8 B;  3F7Y C;  2YEV B;  3BA9 A;  3MHH C;  4LFB B;  4GX5 A;  3W7T A;  3CCL V;  1JJO A;  2HVJ C;  1S3J A;  4RUE A;  4NR1 A;  4WFH A;  1KP3 A;  2XAQ A;  2EIJ C;  3ZRX A;  4PA4 A;  5E79 Z;  1H2M A;  4OPA A;  2PTM A;  3T1H O;  3G67 A;  2EIL C;  1EFR G;  2XAH A;  3N2K B;  5D5Q A;  3CS5 A;  3T1H B;  2P22 C;  2XUM A;  1KUQ A;  4J7J A;  1XMQ B;  4PI2 A;  1NH2 B;  4DR6 O;  4YJ3 B;  5KX5 B;  2JGD A;  5IYZ A;  4DV2 O;  1VIB A;  2PGG A;  3JAW A;  1VEW A;  1BSM A;  3OFN G;  4DV2 B;  3QG5 A;  3E8F A;  1FAF A;  1O9G A;  4R8C A;  3WFV A;  5LYJ B;  3OMA B;  1WAZ A;  5LGN A;  3ABU A;  1GH6 A;  1XQ8 A;  4LF5 O;  1UPG A;  3JAT B;  3RW0 A;  1Y66 A;  4GT1 A;  1DTO A;  4AHC A;  3ASN B;  1Q3E A;  1VAR A;  1NBM G;  1H2N A;  3N2G B;  1GRJ A;  2QEX V;  1OCC B;  1SQP H;  2ARH A;  2VRZ A;  5CA0 A;  3A0B Z;  1VQM V;  1K73 W;  4BIU A;  1KBH A;  4WBN B;  4MW3 A;  2WA4 A;  4BIZ A;  4X89 A;  2YDE A;  4MVQ A;  2M6Y A;  5KA5 A;  1N33 O;  1DF4 A;  1FYJ A;  1K33 A;  2BTQ A;  2ZM6 O;  1YZB A;  1R6N A;  2ZNJ A;  2QKC A;  5IJ0 A;  2OCH A;  2XAG A;  1IXB A;  3K5O A;  1HW7 A;  5IJ9 A;  3FAV A;  4OGQ B;  3E89 A;  4TT3 G;  4JI2 O;  2ZIN A;  1KD1 W;  5CMU A;  3JCU Z;  1CPY A;  4QGP A;  1X4T A;  1P7B A;  4MVS A;  3FB7 C;  2DYS B;  4X65 B;  5EBM C;  2F23 A;  3CRA A;  3FYI B;  3K06 A;  1N32 O;  2HHH O;  3LNN A;  1XMO B;  3T4D A;  3TET A;  4H33 A;  4TQD A;  1J5E O;  5JQG B;  1WB7 A;  1N32 B;  2CE4 A;  5KAI Z;  1BHB A;  3S3X A;  1F4M A;  1J5E B;  4TUY A;  1OCR B;  1AB3 A;  2ZT9 B;  1D5A A;  1XOU A;  3HKE B;  3B8M A;  1BHA A;  1BMF G;  4DR2 B;  1JMK C;  1Z2G A;  4DV6 O;  3N27 A;  3RVZ A;  4DRX A;  3CEI A;  5FNV A;  4DR5 B;  4F6R B;  2QWP B;  4W4K A;  3ZRS A;  5JJN B;  5H9C A;  5A2Q N;  1ARO P;  3OTO O;  3PJS K;  3SPH A;  2JGU A;  5LMN B;  2CAZ C;  1NH2 D;  2IBZ H;  1FXH A;  4U7N A;  3ABK B;  2D2C B;  3OTO B;  4NXN O;  2DOS A;  1OZ0 A;  3SJQ C;  2EUL A;  1N34 O;  1SF9 A;  1MG1 A;  1E79 G;  5C8Y B;  4K3A A;  3OUF A;  4CH6 A;  2IJH A;  4XDL A;  2OTL V;  1NR7 A;  4DV5 O;  2Q73 A;  4IT5 A;  2HJD A;  4MTX A;  1N0N A;  3BAA A;  3ZN0 A;  4P9O A;  1IUR A;  1Y6X A;  2UXX A;  4DR7 O;  4CZZ A;  2ITC C;  5IYD O;  1NTZ H;  4FFB B;  3HKC B;  4RUF A;  4IIJ A;  2PYL A;  2ADQ B;  3ZJZ A;  5EK0 A;  3HKD A;  2DQ0 A;  4D6T H;  4KP4 A;  3THO A;  3OGC C;  5E1A C;  3DXR B;  4CH4 A;  3AG2 B;  1JX9 A;  3STZ C;  1I7F A;  4IGG A;  3J80 N;  4JAA A;  1OV9 A;  3HKB B;  3SPJ A;  1IBL O;  1AI7 A;  1Z5W A;  3CWB H;  3OD4 A;  4LWS B;  4JV5 O;  1DLB A;  3B09 A;  4KUM A;  4I0X A;  4DV3 O;  5CA3 A;  1V9P A;  3BCC H;  1BS3 A;  5BY1 A;  2QWO B;  1W0J G;  4LFC B;  1Y74 B;  3G71 V;  3TCU A;  4J80 A;  4GCZ A;  4DUZ O;  1ENV A;  3LSQ A;  4X1K B;  2EJ7 A;  4UCV A;  3JAW B;  3QF7 A;  4YY3 B;  2Z3Y A;  2V4D A;  3SYA A;  2P06 A;  3SJA C;  3ZRW B;  3B40 A;  5JH7 B;  4NVP A;  1JR9 A;  3WB1 A;  1XNR B;  5BMV B;  3CP1 A;  2ZD9 A;  3DC5 A;  4DR4 O;  1I5X A;  2WPD G;  3K9A A;  4TQF A;  3K9S A;  2X6B A;  4IL6 Z;  4DV0 O;  2XT9 A;  4NXM O;  4TV9 A;  2ZE6 A;  3B77 A;  4LF9 B;  2DYR B;  5LA6 A;  2QDO A;  3D3Q A;  4NXM B;  5KHJ A;  1SQQ H;  4JI3 O;  3ZN1 A;  1AJN A;  5CA0 B;  2H8P C;  1G8M A;  1PP9 H;  4MTG A;  1H2S B;  1WLE A;  1ZWI C;  4JTA B;  1FXK B;  1GM9 A;  4G2K A;  1Q7Y W;  2DN9 A;  4MVM A;  4LCU C;  2UXN A;  5GTI Z;  2KSD A;  5IJ0 B;  3TXS A;  3CCV V;  5CB4 A;  2IH1 C;  5D5P A;  3E35 A;  1ZL8 A;  5J9P C;  2HEP A;  5IJ9 B;  3FAV B;  2Y4U A;  3AK1 A;  2M7W A;  3H1H H;  2KKW A;  2YIA A;  2QJ1 A;  2E75 B;  3JAL B;  1RPR A;  2R9R B;  5F2V O;  1NKD A;  1TAE A;  2WLK A;  4X20 B;  2QWR B;  4EKW A;  3RYC A;  1WJZ A;  4CS2 A;  4YHH O;  1GTO A;  4UB6 Z;  1CEZ A;  2VQF B;  1HNZ B;  2LO1 A;  4FLY A;  2W6J G;  3IC9 A;  5FNV B;  3WG7 C;  3CCU V;  1YIT V;  2YXH A;  4GLX A;  1E1R G;  1I08 A;  3U11 A;  2CH7 A;  1M56 B;  2HG5 C;  4FPP A;  1BL8 A;  4LF6 B;  4MSW C;  4EB6 A;  5KMG B;  1X59 A;  2Q0O C;  4B3M B;  2UUB B;  2QE7 G;  2YC0 A;  2YID A;  2YI9 A;  3CRC A;  2ZE8 A;  3JSN A;  4O4I B;  1RM1 C;  2DE0 X;  1I94 B;  3T1C A;  5CA1 B;  1F23 A;  1P4R A;  1XUQ A;  4PA6 A;  2VQE B;  3ABT A;  5B1A C;  1YSC A;  2QTO A;  3TK1 A;  2UXD O;  4U3J A;  2XAJ A;  4JAS A;  2EJR A;  4JI8 O;  1WN7 A;  4PEL A;  3LSS A;  3IAY A;  1Q5O A;  4J9Z B;  5L3D A;  3P30 A;  2Q67 A;  2PUS A;  2E3C A;  2IU0 A;  3AG4 B;  1Q8I A;  2PF4 E;  3APO A;  4I50 A;  1KMI Z;  1XBL A;  1Q6U A;  2HR3 A;  2QKS A;  1ZTE A;  4F4L A;  2QR4 A;  1BGY H;  4FFK A;  3ZHR A;  2Z0A A;  2B9Z A;  4MVO A;  4W4L A;  1JFF A;  2ZIM A;  1EZV H;  4JZG A;  2NR5 A;  1VP7 A;  3HPL C;  4DUY B;  4YIO A;  3ETE A;  2OCC B;  4MTO A;  4K0K B;  3RYI A;  1FJG O;  5J2U A;  5JVD B;  3RN4 A;  4I0X B;  1ZAU A;  3C3T A;  2CGO A;  3UO3 A;  3CSX A;  4PA9 A;  1URF A;  1Y76 A;  3E2E A;  2ZXW C;  5B3S B;  5B1N A;  1VQN V;  2JRI A;  1U96 A;  2IM9 A;  5IY5 B;  4X62 B;  2F4V O;  2UUA O;  2YIC A;  4DW1 A;  3GVM A;  2BCC H;  4G28 B;  3ZIA G;  3JAK A;  4K35 A;  1K97 A;  2LP7 A;  2UUA B;  1WP8 A;  3W7S A;  4LH7 A;  2WA3 A;  5GW7 A;  1YXB A;  4DV4 O;  4DR1 O;  3O65 A;  1H8E G;  3E22 A;  3JSL A;  5EC2 C;  1NT2 B;  1XI1 A;  1K3E A;  1NS1 A;  5CN0 A;  4DV7 O;  1SZT A;  2XTA A;  4X8A A;  2P67 A;  4ZOL B;  4JI6 O;  4CH5 A;  1TUB A;  1YVW A;  2N04 A;  1FKA O;  1SA0 A;  2Y69 B;  3BPZ A;  4KFM A;  4ZBM A;  5KHG A;  1OCO B;  5LMU O;  3K03 A;  5LXT A;  1H2L A;  1F4N A;  4PA7 A;  4YJ2 A;  4JI4 O;  2YIB D;  5H6Q A;  5IYB O;  3U0Z A;  1OCZ C;  4N21 A;  3MDS A;  1Q82 W;  1R3J C;  5JCO A;  2BSK A;  4QE7 A;  1PPJ H;  1HNX O;  3LDC A;  1SQV H;  1WPX A;  2EIM C;  5EIB D;  4B3T O;  1HR0 B;  3K5M A;  2FKX A;  3BAB A;  2YUA A;  4KXR A;  2DJV A;  3FYE B;  5L3B A;  2UXC O;  1SRY A;  2B1I A;  1HNX B;  2LW7 A;  4PDR A;  5HFL A;  5CB4 B;  2WLI B;  3UCS C;  3VBB A;  1TVK A;  2Q4P A;  1ZL8 B;  4PJ0 Z;  3ML0 A;  1PNM A;  1IDS A;  1VQ5 V;  5EZY B;  5DN6 G;  4ASU G;  4DXW A;  1S0V A;  1L0N H;  3UT5 B;  1XHX A;  3RYH A;  5LOV B;  3OT7 A;  4JTD B;  4ICG A;  3EXA A;  1MMM A;  1JPX A;  2LQT A;  3A0H Z;  4FM2 A;  1KU9 A;  2P7T C;  3IFX A;  2RN9 A;  2F66 C;  3RYC B;  4XBF A;  3J7A U;  2JK5 C;  3GWO A;  4MVZ A;  2EIJ B;  2V1D A;  2WLH A;  2L6L A;  2QWN B;  4DR6 B;  4FLZ A;  2ZQM A;  1HDJ A;  4O2A A;  4JYY A;  1VQO V;  1E1Q G;  1M5I A;  5FLX N;  5A9G A;  2EIL B;  1TGO A;  3L70 H;  3D3I A;  5IYC O;  4X1Y A;  1W0K G;  4JYA O;  2P4V A;  2Q0A A;  3I56 V;  2PI4 A;  3ASN C;  3CB2 A;  1I0H A;  1W2B U;  2ZIO A;  3ETG A;  3E8G A;  4PA3 A;  4LF5 B;  5KUM A;  2ZNI A;  2JVD A;  2GTA A;  1LNQ A;  3LSU A;  1KB9 F;  5KAF Z;  2JEU A;  1MNG A;  3CC4 V;  2CK3 G;  4U3J B;  2ITD C;  2LJ2 A;  1TA8 A;  1QBZ A;  1EZJ A;  3BY6 A;  4L8J A;  4TV8 B;  2K1E A;  4LC1 A;  2B5U A;  3RFR A;  4FLX A;  4B7K A;  4I50 B;  5J2T A;  5HFM A;  3CXC U;  4RAI A;  4WFE A;  4OX9 O;  1N33 B;  3APQ A;  4EEQ A;  2AZ2 A;  1V55 B;  2ZM6 B;  3KG2 A;  5B1B C;  4I5S A;  2N05 A;  1EN6 A;  3L73 H;  4TOI A;  1U97 A;  5DM6 V;  3X2Q C;  2DYS C;  1JFF B;  1VQ7 V;  5KUK A;  1YIJ V;  4ABM A;  4JYB A;  3JAS A;  4JI2 B;  4AQY O;  3FKS G;  4R6Z A;  2Q5Z A;  3EVK A;  3ZS8 C;  4ZHQ A;  1Q81 W;  4JPR A;  3DC6 A;  1OCR C;  4XDJ A;  4MW8 A;  4J7Z A;  2HHH B;  2JIZ G;  1Y76 B;  4H44 B;  1KC8 W;  5LHG A;  2OIG A;  3JD0 A;  3ZMT A;  3K5L A;  1R6K A;  1SS3 A;  3H1I H;  2A9H A;  3NXS A;  5KHI A;  5EYP A;  5FPR A;  1SC5 B;  3JAK B;  4DV6 B;  2KG7 A;  3ABK C;  3K58 A;  1XHZ A;  2RJZ A;  4HNA A;  1CXZ B;  1S5L Z;  2X7R B;  4CS4 A;  2EBO A;  1WA8 A;  3ABM B;  3W7U A;  2R70 A;  3UO2 A;  4NXN B;  5JCO C;  5LP6 C;  3RBZ A;  1EM1 A;  2EIK B;  1N34 B;  5KHK A;  4H0L B;  1TUB B;  2ATK C;  4JI0 O;  4JI7 O;  5GTH Z;  1SA0 B;  3CYO A;  4DV5 B;  2Q7H A;  5LXT B;  5FL7 G;  1NQT A;  2GHY A;  4DR7 B;  4I9W A;  3MAQ A;  3S3W A;  4E4E A;  1AIL A;  4LFA O;  3AG7 A;  1VF6 C;  1S5J A;  1AR1 B;  1THZ A;  3IJ4 A;  1VQ4 V;  1SQB H;  3ZBH A;  2X6C A;  1P7G A;  2WWW A;  4B3R O;  1KKC A;  4FLW A;  1QNM A;  5BZB A;  5FPO A;  1RFY A;  1Q6H A;  5DED A;  1D5N A;  2QTS A;  4UVA A;  3K5N A;  2HP8 A;  4QNH B;  1UJW B;  3CJH A;  3H1K H;  1IBL B;  2NNU A;  2X0L A;  4BW5 A;  4JV5 B;  3ZMS A;  2CDY A;  1FS0 G;  3B8N A;  2H3O A;  1BCC H;  4DV3 B;  1H2K A;  1BZK A;  5H2F Z;  3CC2 V;  3M7M X;  3QTC A;  2JGD B;  5IYZ B;  1KKD A;  5K1P A;  4RQF A;  3ZMV A;  1MOF A;  2CTQ A;  2XHB A;  1G6U A;  1M1K W;  4DUZ B;  1XNQ O;  4TSF G;  5K1X A;  3DTU B;  2JJ2 G;  1IBM O;  4PV1 B;  4UCO A;  1NTM H;  5CBG A;  3QO5 A;  3WB0 A;  1FFX A;  4FM1 A;  3A0R A;  1YDX A;  2ADP A;  1GMG A;  4X1Y B;  4I55 A;  4LF8 O;  2DMX A;  4X64 O;  3ABL B;  1Y4M A;  1YTF B;  3OR7 C;  4LH6 A;  3G6E V;  3PN1 A;  5BXZ A;  2UU9 O;  3JD3 A;  3FB8 C;  1QCE A;  4DR4 B;  1YEW A;  1N36 O;  1F7Y A;  2GUZ A;  5LBQ A;  2EZO A;  3AK2 A;  2P90 A;  4DV0 B;  4BIO A;  2P6J A;  5LGT A;  2Q9L A;  1A32 A;  4PDV A;  4O4H A;  1FXK C;  1GN2 A;  2YXL A;  4GX0 A;  1N4C A;  3BHP A;  4JI3 B;  2DWE C;  3P3N A;  1LUW A;  2LFS A;  5L3F A;  3QVN A;  4X66 O;  3IGA C;  1G1X B;  3C90 A;  4DK1 A;  5J2T B;  2BTQ B;  2YSU B;  1AP5 A;  3K04 A;  3Q4H A;  5L3G A;  4QJF B;  4DR3 O;  3OTF A;  5B5E Z;  2Y48 A;  3UM7 A;  3KKY A;  1S5H C;  4U7O A;  1JQ0 A;  2YEV A;  4PDL A;  2FB5 A;  2L35 A;  2Q6A A;  4NB5 A;  5IT9 N;  3JAS B;  1PKX A;  1IX9 A;  3VQY A;  3QO7 A;  4DK0 A;  2UUC O;  4ZHQ B;  3DGE A;  2Q7E A;  1L0L H;  1XRE A;  1WB8 A;  3T1Y O;  4RWU A;  4K8X A;  4BR6 A;  1GN6 A;  4LF7 O;  3K0G A;  2NN4 A;  1KP2 A;  4FIP C;  4YXW G;  3VOU A;  4TUY B;  2R9A A;  1YCI A;  1BT8 A;  1HWY A;  4YHH B;  1IXM A;  3KCY A;  4RQE A;  1K9M W;  2OYQ A;  4DRX B;  4PHZ A;  3CC7 V;  3I5D A;  2ZE7 A;  3F5W C;  1R6T A;  5EYP B;  2P4K A;  4YJ3 A;  5KX5 A;  1YJ9 V;  1WPB A;  1HP8 A;  5DEC A;  1ZUQ A;  3MD0 A;  1YF2 A;  3L75 H;  1WA8 B;  2ZR2 A;  3OR6 C;  4JI5 O;  4LNU A;  2RDC A;  5EIB C;  3H1L H;  1LUV A;  5LYJ A;  3ZRV A;  5TIS Z;  1JJ2 U;  3FB5 C;  2ZCE A;  1J95 A;  2GSM B;  3JAT A;  1JCH A;  3ASO C;  3ZHV A;  2UXD B;  1IBK O;  4G27 B;  4JI8 B;  4HBN A;  1YTF D;  2A3Q A;  2XAF A;  1RM1 B;  1NTK H;  3N2G A;  4D7T A;  4J10 A;  4IIJ B;  3CX5 F;  1PL4 A;  1V54 C;  5EBW C;  5B1A B;  4NYK A;  3HKD B;  5H5N A;  5L3E A;  2A79 B;  3OGI B;  1M90 W;  4WBN A;  3AG1 B;  1R3L C;  3ZMZ A;  4Z1M G;  4JZ2 A;  1EN5 A;  2IW5 A;  5KA6 A;  2OCC C;  2BE3 A;  3L74 H;  5JJJ B;  2HKO A;  3ZHS A;  4QPK A;  3K59 A;  4GKK O;  5KHH A;  1MZE A;  1QLN A;  2YS8 A;  2HVK C;  4FMT A;  5B3S C;  1YJW V;  5IY5 C;  5B1O A;  4DW0 A;  1FJG B;  5ITZ A;  4LF4 O;  1HNW O;  2CTP A;  2GTS A;  4ZKI A;  4OXS A;  2PI5 A;  1ROP A;  1M57 B;  2JS3 A;  3SYQ A;  1B06 A;  2WSS G;  2DQ3 A;  4FM0 A;  2LFR A;  1VQ8 V;  1KQS U;  1GN3 A;  2BOC C;  1R3K C;  2CTW A;  5JQG A;  2PYJ A;  3SGI A;  2F4V B;  3UQ8 A;  3UKM A;  4UCU A;  3BA8 A;  4EFB A;  3CCQ V;  3CCJ V;  1VQ6 V;  3HR0 A;  3HKE A;  2JDI G;  5JJE B;  2KQX A;  4UB8 Z;  3K3W A;  4QIW F;  4GX1 A;  3A2F A;  1QLE C;  1RP3 B;  1FFX B;  4F6R A;  4DV4 B;  4E2L A;  4DR1 B;  4I55 B;  3SPG A;  5LHI A;  2QM7 A;  3SPI A;  4H37 A;  2FTK A;  3E83 A;  4WFG A;  2Y0P A;  1BE3 H;  2GBO A;  4TV9 B;  4DV7 B;  3JYC A;  1IZ3 A;  2W6I G;  2GUZ B;  5LA6 B;  3G4S V;  1XIL A;  4JI6 B;  1SET A;  3P32 A;  5C8Y A;  4YIP A;  4O4H B;  1H2G A;  2EIN C;  3ZCC A;  5LMU B;  1QU7 A;  4JYC A;  4BWA A;  3CD6 V;  4GZR B;  4JAU A;  1SQX H;  3R65 A;  5JWP A;  4R50 A;  4JI4 B;  4JI1 O;  5LP6 A;  4DV1 O;  2QWQ B;  3SJB C;  4B3S O;  1PNL A;  3AG3 B;  2ZDI C;  2E5L O;  4B3T B;  1ZSP A;  2AGA A;  4FZ1 A;  2UXC B;  5IWA O;  3H9V A;  2E5L B;  5BR8 O;  4GKJ O;  3QNE A;  4LFB O;  2Q68 A;  2Q8V A;  1R3I C;  3DXR A;  4GKJ B;  3G80 A;  3CXH F;  5KLV H;  2EIM B;  2AZ0 A;  2PY5 A;  1VF6 A;  1SES A;  4CBC A;  3BFR A;  4WCE V;  3HKB A;  1M4U A;  2ZR3 A;  3L72 H;  3AEI A;  1M9N A;  1P84 F;  4B7E A;  4LWS A;  1Q90 D;  2Z5U A;  3B2E E;  4A5U B;  4UFZ A;  3CPW U;  3TJT A;  2H94 A;  1L8D A;  1XL6 A;  1AR4 A;  1XMQ O;  1K5Q A;  4O4L A;  4PDM A;  1Y74 A;  2A0L A;  4FLU A;  4Q6G A;  2CH7 B;  2W0F C;  1T5E A;  2ETN A;  3CCE V;  4EB6 B;  4X1K A;  2LGQ A;  1DF5 A;  1PL0 A;  3HB3 B;  3IC7 A;  2W0X A;  2AXT Z;  3GWK C;  2GDS A;  3RGB A;  1BQ0 A;  4LNU B;  1R1B A;  4QE9 A;  3ZRW A;  4JYA B;  1EN4 A;  1OCC C;  5JH7 A;  3ETD A;  1B04 A;  3SYO A;  1QVG U;  2DWD C;  3E8B A;  1GN4 A;  5BMV A;  1AI4 A;  2CTR A;  3G6B A;  2R9I A;  1I5Y A;  3OM3 B;  2ILM A;  3ZMU A;  1Z5V A;  4UV8 A;  4EFE A;  3F5T A;  2OT5 A;  3K57 A;  1ZX3 A;  1V55 C;  1XDC A;  1SER A;  3OMN B;  3R66 A;  1OJH A;  4RO2 A;  4X1I A;  4HAM A;  2VWJ A;  4UXN A;  1AVM A;  2RQ6 A;  2BTO A;  3ZHQ A;  3JD1 A;  1VMG A;  4OX9 B;  1TUE B;  2G38 A;  2Y4T A;  1FXK A;  1YHQ V;  3BRC A;  1SKV A;  4I9Q A;  1JVM A;  5B66 Z;  4WFF A;  3JAR A;  4AIL C;  2EZP A;  3RYI B;  1SQF A;  2C2A A;  1MAB G;  2O57 A;  1AI6 A;  5J2U B;  4AQY B;  3E8H A;  1F51 A;  4Q20 A;  4X65 O;  3FFQ A;  2MW2 B;  5B1B B;  1MA1 A;  3MHS C;  1XMO O;  3JAL A;  3J81 N;  5ITZ B;  3X2Q B;  5GON A;  2QKA A;  2YXY A;  4Z2W A;  2B1G A;  3CRR A;  4I4T A;  1NJI W;  2GV9 A;  4X20 A;  4IHJ A;  2DW4 A;  1KEC A;  4DR2 O;  2D3O W;  1K34 A;  2IJI A;  1YJN V;  2WLM A;  3VQV A;  4CS3 A;  4FLV A;  3ABM C;  4DR5 O;  3RYF A;  2CUG A;  1JA8 A;  3CE2 A;  3TGU H;  4FVM A;  3E22 B;  1NU1 H;  1SZX A;  2EIK C;  5LMN O;  1K4C C;  3KCX A;  2R72 A;  3VQX A;  2VWK A;  1PD3 A;  1YI2 V;  3RT3 C;  5KMG A;  2F43 G;  4J7K A;  2FYU H;  1JOY A;  4ZIB A;  3OEH G;  2E74 B;  4ZI7 A;  4O4I A;  2NLJ C;  2YIB A;  5AG2 A;  2LGW A;  4IYI A;  5CA1 A;  1RSO A;  4JI7 B;  4JI0 B;  4YJ2 B;  3BVO A;  1MSD A;  4BW9 A;  4WFA V;  3AG2 C;  2BSK B;  3BEH A;  4B08 A;  5LP6 B;  2A7W A;  2KB1 A;  3B4S A;  2WLJ A;  4LFA B;  2OIE A;  1TVK B;  4H13 B; 
#chains in the Genus database with same CATH homology
 2DMX A;  2QWP B;  2EJ7 A;  2GUZ B;  2OCH A;  2QSA A;  3APQ A;  2KQX A;  2LO1 A;  2CTQ A;  4IT5 A;  2CTR A;  3UCS C;  2PF4 E;  3APO A;  2CTP A;  1GH6 A;  2DN9 A;  3AG7 A;  1XBL A;  2N05 A;  4J7Z A;  2QWO B;  1IUR A;  2GUZ A;  2Y4T A;  2CTW A;  1BQZ A;  2M6Y A;  1FPO A;  2CUG A;  2LGW A;  2L6L A;  2QWN B;  2YS8 A;  4J80 A;  2N04 A;  1BQ0 A;  2QWQ B;  2QWR B;  2YUA A;  4RWU A;  3BVO A;  3UO3 A;  1WJZ A;  1NZ6 A;  2Y4U A;  1HDJ A;  1FAF A;  1N4C A;  3UO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...