2KQXA

Nmr structure of the j-domain (residues 2-72) in the escherichia coli cbpa
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
ELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYDQMWQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the regulation of the CbpA co-chaperone by its specific modulator CbpM.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Chaperone binding protein
molecule keywords Curved DNA-binding protein
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2kqxA00
2L6LA 2CTRA 1HDJA 2CTQA 2N05A 2CTWA 2QWQB 4IT5A 4J80A 1BQZA 2QWRB 2EJ7A 2KQXA 2DMXA 2GUZA 1NZ6A 2M6YA 2QWNB 1BQ0A 1FPOA 2LGWA 2GUZB 2LO1A 1N4CA 1WJZA 2DN9A 2QWOB 1IURA 3APQA 3UO3A 2YS8A 3UO2A 2Y4UA 1FAFA 3APOA 2CUGA 4J7ZA 1XBLA 2OCHA 3AG7A 3BVOA 2YUAA 4RWUA 2QSAA 2Y4TA 2QWPB 2CTPA 2N04A 2PF4E 1GH6A 3UCSC
chains in the Genus database with same CATH superfamily
3DXRA 1FXKB 2Q7HA 3ZN0A 2P67A 4BWAA 4MTOA 3FB8C 1PNLA 2Q9LA 2VQFO 3OGCC 1K9MW 5C93A 3RBZA 5DECA 2YUAA 3P3PA 4DW1A 1H38A 3K5MA 5BR8B 3G6EV 4TSFG 1AI7A 2CAZC 1X59A 1H8EG 1GM8A 3JATB 1KKDA 4TT3G 5LP6A 1FPOA 1IBKO 4WBNA 2YXHA 2JJ1G 5JQGA 4CS2A 3STZC 1YZBA 5LA6A 1NH2D 3VBBA 1NVPB 4J42A 2EIJC 4NYKA 4BR6A 2WLJA 1Q7YW 2KSDA 2ADQB 2GV9A 2CGOA 4L8JA 1OCRC 2X7RB 3K9AA 4FJCC 5L3GA 3WB2A 1QQCA 3C90A 3AK1A 5B3SC 2B1GA 2P5OA 3OUSA 2GTSA 2LO1A 4MTXA 1FFXA 1NI8A 4PDMA 1U96A 1E1RG 5CA0A 1XMQO 3ZEDA 1JJ2U 3X2QC 3H1KH 2AW9A 2JEXA 4X9QA 2EIKC 1YDXA 1VQMV 1RM1B 4X1YA 4DUZB 4BIOA 1W0KG 3RW0A 3CXHF 4X66O 4LF4O 1AJNA 2P7TC 2UXBO 1ZUQA 3J81N 3IC9A 2RNBA 1WJZA 1D5AA 4EEQA 4PA4A 1VQ9V 4DV2B 1XNRO 5K1PA 2QSAA 2E74B 2ITDC 4P9PA 4CH3A 3H1IH 2R72A 4TUYB 2PGGA 1K73W 3ABKB 4RO2A 4DUYO 1M5IA 5GONB 1RM1C 4TOIA 3G6BA 1WAZA 3T4DA 2LW1A 5L3FA 3A0BZ 3VQWA 4AHCA 3HKDB 5GTIZ 4WBNB 4G2KA 1AVMA 3CCQV 1R3KC 2R9RB 4B3MB 3ZMTA 3TETA 4LH6A 3SPCA 1VQPV 1Q43A 4MVUA 3ZRWA 3RYHA 2KB1A 2W0XA 4UVAA 2JVDA 4O2AA 1W0JG 1BHBA 4KFMA 4FLXA 1IBKB 3OEEG 4FIPC 1V54B 2EX3A 4BIUA 4EB6A 3E22B 3QF7A 2RJZA 4JZ2A 3KZIZ 3K06A 2JDIG 4TUYA 4HAMA 2X6BA 4H33A 1PV0A 4TV9A 1JOYA 1EN5A 1R6KA 5LMUB 2Q7EA 4UB8Z 2JEUA 2UUBO 4LFCO 4ZIBA 4AQYO 2EJRA 1BGYH 4LFAB 1BCCH 4UFZA 5LGTA 3ABUA 3QVNA 3ABTA 1N33O 5L3EA 3FB5C 3RYIB 2DYRC 4FK5C 4B3TO 1LUWA 4ASUG 4DV0O 3QO7A 4NTWA 4X1IB 1MOFA 2VQFB 1XI1A 3JARA 1P7BA 2E5LB 3UT5A 3JCZA 2ZDIA 4X1YB 1SS3A 4QIWF 2DWEC 4UVBA 2N04A 2VRZA 2PF4E 1Y6XA 1MABG 4JI1O 1R3JC 1YVWA 4DV4O 4DR1B 2ZCEA 1OCCC 1Q3EA 3OFNG 3K79A 1LUVA 3HKEA 1RP3B 5IYCO 3SPHA 4PI2A 4DR3O 1TA8A 2JRIA 4JTCB 1R3IC 3WFVA 4R6ZA 1NKDA 5EBWC 3TGUH 3G80A 1DF5A 1VQNV 3MDSA 3ABLB 4KUMA 4ZOLA 1V55B 4JI8B 4J80A 3QO8A 5EZYA 5BR8O 4WFBV 1HNXO 2ZNJA 2GUZA 1M57B 4WFGA 4D6TH 4U7OA 3LDEA 4X1KA 4D7SA 1AP6A 1Y4MA 3MHHC 1CXZB 3RYIA 1U97A 5FPRA 5CA1B 4JI5O 2AHZA 1N36B 3CWBH 2X6AA 1I08A 1N0JA 2WLMA 3UM7A 3CMEV 5IYZB 1BQZA 4EFEA 2NR5A 2KG7A 3OGIB 2W6IG 3E83A 5B1AB 3CPWU 1BE3H 4Z1MG 3HKCA 1NVPD 4J10A 1NH2B 3W7WA 1S5JA 2YI8A 2HG5C 4LF4B 2ADPA 2HHHB 5CB4A 3AG1B 5B1OA 4GKJO 2CTPA 4YIPA 1MZEA 3H1JH 1DTOA 1GKFA 2Q73A 3BY6A 4GCZA 1FD9A 5D5PA 4QJFB 1EN4A 5L3BA 2HFEC 5B3SB 1WLEA 1NZ6A 1F4MA 2ZE7A 4IGGA 3AG2C 1IVSA 1XOUA 3BEHA 2UUCB 4X20B 2GBOA 4FZ0A 3CCEV 1JJOA 3AK2A 3J80N 5A9GA 1QLEB 4LF9O 4YHHB 3JATA 1ROPA 1MZFA 2HHHO 4LFBB 5IJ0B 2FKXA 1H2SB 3RT3C 5E79Z 5CBHA 4DV5O 2YIBD 1K33A 5A2QN 1WB7A 1YSCA 5CN0A 2IJJA 4HBNA 2UXBB 1IZ3A 4H0LB 3ABMB 1N33B 2KG7B 3D36A 4Q6GA 4K8ZA 4GT1A 3FB7C 4IT5A 3FB6C 4BW5A 3N2GA 3OT7A 1SETA 2ZT9B 4X88A 2WSSG 1VQ7V 4JV5O 4HYOA 4W4LA 2ZKOA 1SA0B 4O2BB 4D7TA 1TAEA 5CMUA 1K34A 5CBGA 1PD3A 5KMGB 3ZHTA 5DM6V 4LF6O 5IWAO 1TUBA 1LNQA 1TGOA 2ZM6O 4CC6A 4FM2A 2GHYA 2EILC 3IJ4A 4X62B 4K0KB 3ZMSA 3B77A 1Y76B 1UPGA 2YC0A 1VF6C 1ZAUA 2X0LA 1B04A 3STLC 4IHJB 4NXNB 1QU7A 5LGNA 4WF9V 2BCCH 3QNEA 4Q20A 1F23A 3CYOA 3DXRB 4JI1B 3BAAA 1Q82W 2L35A 4O2AB 2AGAA 3L73H 1J5EO 4CS3A 1SRYA 3K0DA 3JCUZ 4UVCA 3NXSA 1M56C 3CRCA 1JCHA 2CUGA 1V54C 4J7ZA 3LSUA 1BZKA 2QJ1A 1YEWA 3SYCA 5H5NA 5ITZB 1RSOB 2NNUA 1EM1A 4Z2WA 2DE0X 1O9HA 1S0VA 1KC8W 2RDCA 4DR5O 4N23A 4G27B 1F4NA 3FX7A 5B1AC 3SJCC 2LGWA 4ICGA 3W7XA 3K5OA 4K8XA 1XUQA 1H8HG 4NR1A 2QTSA 4BW9A 2F4VO 3SPIA 2X6CA 3VQXA 5LHIA 3FYEB 3CJHB 5D5QA 1VMGA 1NR7A 3T1YO 1I7FA 3L70H 3T1CA 3L74H 1SESA 5FNVA 4DV1O 3ZCCA 3FFQA 4DR2B 4B7EA 3ZMUA 2H3OA 2RN9A 4U3JB 3K3WA 1AI4A 1VF5B 3JALB 2V7QG 4UXNA 3RGBA 3OW2U 2DWDC 4X1KB 5C8YA 2XOKG 4QE7A 4FLTA 3UO2A 2WWWA 3IGAC 4OPHA 1DF4A 1FFTB 3CC7V 4X62O 1PP9H 2FTKA 2NLJC 1PKXA 4MS2A 2JGUA 3MD0A 5J2UB 5KA5A 5JH7A 4DV3O 1P7GA 1GN6A 3O9OA 1SERA 3FKSG 3UQ8A 1SA0A 3WG7C 1KP2A 2F4VB 4FM1A 1FXHA 3ETGA 1RPRA 2OTLV 3S3XA 2P90A 5H9CA 2VQEO 2JS5A 5GW7A 5IY5C 3CC4V 1IBMB 4ZHQA 4FFBA 2QM7A 3KCYA 3VOUA 1JFFA 4I4TB 2YEVA 4DV6O 4TV9B 4XBFA 2EILB 4RUFA 2Q68A 5BZBA 1N32B 2QWOB 2IBZH 3Q4HB 2PYLA 3CCMV 4DRXA 5F2VO 5IYBO 1MG1A 2ZD9A 1Y67A 1IXBA 3ML0A 4X20A 1QLNA 1SQGA 3TXQA 3A0RA 3CCVV 4ZKIA 1AP5A 2OWOA 4B3SO 1SQPH 4JASA 1BS3A 5H6QA 4TQDA 2WLLA 3TCUA 3SJBC 3AG3B 1VP7A 1L1FA 2EZOA 1KP3A 3IAYA 3TK1A 2MW2B 3BRCA 1Y76A 2VWJA 1NR1A 1UJWB 4JTAB 3N2KB 3K58A 1N32O 3SYAA 5BY1A 2BTOA 2QGNA 3H01A 1FJGB 2UXCB 5IY5B 3TJTA 5FL7G 2JIZG 3F5TA 5BMVB 4CS4A 4DV7B 4DUZO 2EIMB 3JAWA 4DV3B 1TVKA 4JI2O 2UU9B 2W0FC 4DYLA 1R6NA 1Z2GA 4MW3A 4X1IA 3Q4HA 1L8DA 3EHBB 5IJ9A 1NS1A 3UKMA 3M7MX 3W7UA 3F7VC 3GWKC 4IL6Z 4UCTA 4UUJC 1KKCA 2ZR2A 4OXSA 1US6A 5CA0B 1SQQH 1M56B 2ZE6A 1XHXA 2WLLB 3ASNB 2N05A 1AJPA 1I5YA 2CE4A 2XT9A 1GN3A 5B66Z 3MAQA 1BQ0A 4JTDB 3B8NA 1S5LZ 2UUAB 1H2LA 4GLXA 1YHQV 3CRMA 2FMLA 3O65A 2PZSA 4YJ2B 1WP7A 2QTOA 4HZ3A 3CMAV 4DV4B 2ZM6B 1M57C 4JYCA 1MSDA 1K5QA 1PL0A 1XILA 1NTMH 4PA7A 1YIJV 3ZRSA 4WCEV 3OAAG 3ZHQA 3CRQA 3E35A 4LF7O 4A5UB 1HR0B 2ATKC 3EFFK 4FFBB 3K9SA 3RWRD 1ZL8A 1PL4A 3T2MA 4G28B 1H2MA 3CXCU 1Y66A 4CBCA 3CC2V 3BA8A 4C7UA 2XAJA 1X4TA 1N4CA 4XDJA 2VS0A 2WA4A 5ITZA 2XAGA 3ABMC 4LNUA 2HJFC 5HFLA 4UB6Z 3D36C 1ENVA 4AI8A 5CA1A 4CH5A 3B4SA 5CB4B 2FYUH 4I5SA 2WLIB 4MVQA 3A0HZ 1Q6UA 2CH7A 4UCVA 4F6RA 2HLDG 1Q90D 3U10A 4QGPA 2GUZB 3L72H 2UUCO 4I7ZB 1I94B 2P06A 1EN6A 3PN1A 3I56V 5HFMA 1OJHA 4K0KO 2Y0PA 4GUNA 3CS5A 3ETDA 5B1NA 2F23A 5L3DA 3CCJV 3JYCA 4FM0A 4H13B 4DV1B 5KA6A 1SQBH 2R9IA 4GX0A 4WFFA 4J41A 1MA1A 2RQ6A 2UU9O 4DUYB 4N21A 3HKDA 5KUKA 4JPRA 1VQ6V 3CCLV 1AILA 1G6UA 4DR7B 4PD4F 2ODMA 4LF5O 2XAQA 1FXKA 4LNUB 4LF7B 2BE3A 2IH1C 5J2TB 1FXVA 3S3WA 2XTAA 1OCRB 3RN4A 2EINB 3K0GA 3BA9A 4I4TA 3RYHB 3JASA 4JI0O 4DR5B 3D3IA 4TQFA 4X66B 4LFBO 5KMGA 3UT5B 3OTOB 4LFAO 3ICXA 4NTXA 1HNZB 1PNMA 2UUAO 1XNQO 1P84F 4O4JB 4X64B 1M9NA 2G38A 2QE7G 4LF8O 3ZHSA 1BT8A 1SKVA 2F95B 3L71H 3W7SA 4CH4A 5IYZA 3WG7B 1IXMA 1YJNV 4EKWA 3OR6C 4LP8A 1NTZH 2XAFA 4DR4O 4YXWG 4UV8A 4H44B 2Y69B 4MW8A 1QVGU 2OYQA 4B3TB 1IDSA 5JCOA 2A0LA 2KKWA 2ZIMA 4UCSA 3C3SA 4ZOLB 2VWKA 3ASOC 4B08A 4DV7O 3HPLC 2LW7A 5IJ9B 5CBFA 1W59A 2E75B 2QDOA 2A7WA 3P32A 2EIMC 1WNSA 5JWPA 4DW0A 5LMUO 1F7YA 1QCEA 1NT2B 2B1IA 4RWUA 1PNKA 5KUMA 4YIOA 4FPPA 1J95A 5BXZA 3CCRV 3OE7G 4PELA 2K9PA 1HDJA 2WAMA 4MVZA 4PDRA 3JASB 2P22C 4OX9B 1URFA 3N2KA 1XHZA 1AJQA 1GMGA 5GONA 1QHTA 3TXSA 4LWSB 3ZS8C 1G8MA 4DV5B 2CK3G 3P30A 3OMIB 4IYHA 5KLVH 1Q8IA 4FLWA 5EIBC 2Q0OC 2CDYA 3IC7A 4O4LB 2PTMA 2CTRA 2PYJA 1KMIZ 2YSUB 4TV8B 4WFHA 3AEIA 1JMKC 5IWAB 5EC1C 1FKAO 2RMKB 3NR7A 3GVMA 1WPXA 1V9PA 1AR5A 1DGSA 1FXKC 3RVZA 1E1QG 1KB9F 2Q4PA 4B3RO 1B06A 2LFSA 1EFRG 4AILC 1ZX3A 3U0ZA 1MSWD 3WB0A 3E22A 2OT5A 4I0XB 4PA3A 4MVRA 4MT8A 2DYRB 3CEIA 1R3LC 3ZJZA 3R65A 3LSSA 1GAXA 5LHHA 3SYQA 5B1BC 4K35A 4JI3O 3CHXA 4ZHQB 2QWPB 3OMNB 1M90W 4CC5A 3HR0A 4FZ1A 1GM9A 3ETQA 1M4UA 4QNHB 1GN2A 3AG4C 1AR1B 2IJKA 5TISZ 2IM9A 4GKKO 1K92A 3E8BA 4B3SB 4LFCB 1HWYA 3AK3A 1HR0O 1V55C 1VQ4V 3ZHRA 5FLXN 4IHJA 4HNAB 2AZ0A 3SYOA 3CSXA 1XBLA 4MVSA 2Y4TA 4LF9B 3OMAB 4LWSA 1KD1W 1JQ0A 4XDKA 2JS3A 2CTQA 3BFRA 4R8CA 3L75H 1GM7A 2ZXWC 1P49A 2FL4A 3CX5F 1PM9A 2Y4UA 1N8RW 4R50A 4DR1O 3OUFA 2HP8A 2OCCB 5GTHZ 3FAVB 3OTFA 1YI2V 3EXAA 3IFXA 5LXTA 3GB7C 2OIEA 4X8AA 4WFEA 1Q81W 2E3CA 4JI3B 2BSKB 1BMFG 3JD1A 3KG2A 1KQSU 3SR2C 2CGNA 2ZE8A 4PV1B 2IU3A 3KCXA 2LFRA 3LUTB 2O57A 1ZWIC 1HW7A 3DC5A 2UXDO 3OEHG 5J2TA 5JVDA 2QA4V 5KAFZ 4JI8O 4QPJA 4JI5B 1AR4A 4I50A 1NQTA 2EJ7A 3DTUB 5JJNB 3T1HO 2ZIOA 2M6YA 1B6QA 1BSMA 5JJEB 1W2BU 2YS8A 3X2QB 2QKAA 2W6JG 4E4EA 5C8YB 1HNXB 3LDCA 4GX1A 5LYJA 5KHKA 3C3TA 4PDLA 1YTFB 4JAUA 5EBMC 1JX9A 1IBLB 4LF8B 4WFAV 2A79B 1VF7A 1KU9A 4LCUC 3L9DA 2E5LO 5KHGA 1D2DA 1Q86W 3CCSV 3D3QA 2Q6AA 5EC2C 2A06H 4UCUA 4NXMO 2AZ2A 4JYYA 2LJ2A 4GKJB 1SQXH 4PA6A 4EB6B 4DV2O 1VQOV 2DW4A 4AQYB 1K97A 2UUBB 2AHYA 3APOA 1CEZA 1VARA 2GSMB 3B40A 2IJIA 3K5NA 1OV9A 1KBHA 2C2AA 3BHPA 2DQ0A 4FMTA 5H6RA 2HKOA 5KX5B 2HVKC 1I0HA 4CZZA 1XL4A 2R9AA 1IBMO 2ZXWB 1ZL8B 4LR3A 1CPYA 1VEWA 4HNAA 5LP6B 3ASOB 1O9GA 1YJWV 3N27A 1N34O 1EZVH 1XL6A 1K7DA 4J11A 1JFFB 4GX2A 3JAKA 1KECA 4YY3B 1AI5A 4P30A 4BAYA 2PI5A 1BL8A 1JA8A 3K5LA 2Y48A 1WP8A 3WB1A 4FLUA 3QTCA 4O4LA 4PA9A 2YIDA 2M7WA 2LQTA 4QE9A 1NBMG 3RYCB 1HNZO 3WU2Z 1A32A 1OCZC 3D8CA 3BABA 3OTOO 4R7CA 4LF6B 3CCUV 1JPXA 2QWRB 1SZTA 2F66C 3SYPA 4DK1A 4JI0B 1GN4A 4X64O 2JJ2G 4I9QA 1QBZA 5DN6G 1ZSPA 4J9ZB 4JV5B 2Z0AA 3THOA 4B7KA 3LNNA 4RQEA 4P9OA 4PDVA 3T1YB 3HKBB 4O4HA 1ZTEA 4DR7O 2BTQA 3SDLA 2OIGA 2YI9A 2GTAA 4JI4O 3T4ZA 3OM3B 2QEXV 3HKCB 4U7NA 4F6RB 4F4LA 2P6JA 5IDJA 2DQ3A 1OCOC 4E2LA 3CP1A 2DJVA 2K1EA 5FPOA 3JAWB 2WPDG 1ORQC 4K3AA 3F5WC 2BSKA 3CD6V 2B9ZA 2YIBA 3AG4B 4JI6B 3ABKC 3VQYA 4KXRA 2JK5C 1LR1A 5JH7B 1VIBA 5FNVB 3E2EA 2Z5UA 4GYCB 4B3MO 2HVJC 5KHIA 4P2ZA 4GX5A 3CB2A 3JD2A 2IJHA 5H2FZ 4KHPO 4CH6A 3GWOA 1TVKB 3JSNA 1NTKH 3SPGA 5L3CA 2EIKB 2EULA 3KKYA 3ASNC 2Q8VA 5E1AC 2YXYA 5CA3A 2V1DA 4YJ3B 2OCCC 3B09A 4H37A 2IH3C 5JJJB 3P3NA 2HR3A 1R1BA 4QPKA 4I55B 2DYSC 4I50B 1HNWB 4DRXB 2UXDB 5LP6C 2PY5A 2VQEB 2OTJV 2YICA 4DR4B 1K4CC 5LOVA 3N2GB 4DXWA 1DLBA 4X89A 3MHSC 5LYJB 3UCSC 5KHJA 2H8PC 3W7TA 4I9WA 3ZHUA 1S3JA 3LNMB 3RYCA 4JYAO 4RAIA 2DN9A 5LMNO 3ABLC 4MVOA 2ZE5A 4MTFA 4MTGA 5LBQA 2B5UA 1OCOB 3HKEB 2ARHA 2YEVB 1VQ5V 1EZJA 1RPOA 2D3OW 1OHHG 2NN4A 3F7YC 1XREA 2HEPA 3OD4A 4XDLA 1WN7A 2KQXA 5KHHA 3CRAA 1OCCB 1G4YB 2ZINA 1TUBB 1Y74B 3A2FA 4IYIA 2DYSB 3T1HB 3HB3B 1GTOA 3M8AA 4GKKB 1ZLZA 1CP9A 3ZRXA 1K8AW 2XUMA 4IIJA 1EBOA 3E89A 4O4IB 4MSWC 4I0XA 1IX9A 2WLKA 4KP4A 3LDDA 5EBLC 4LBEC 3JAMN 4I55A 5KX5A 3DSQA 2CH7B 5EYPA 2P4VA 3E8GA 3RVYA 4JI7B 3UO3A 4J7JA 2RCVA 1P4RA 2UXNA 2XNDG 3AG7A 2EIJB 2H94A 3K57A 1BHAA 3CJHA 3CRRA 1S77D 3E8FA 1KYOF 2N74A 2DOSA 3AG2B 1SF9A 4JZGA 3A8TA 4MVMA 2YDEA 3M99B 1B3QA 4U3JA 2QWNB 3EVKA 1FJGO 2UXCO 2XASA 4U3FH 3AG3C 1T5EA 4X65O 1WA8A 1GH6A 5LHGA 4PI0A 1J5EB 1WPBA 2EINC 3I5DA 2ZR3A 2JGDA 1AROP 4ZI7A 4DR6O 2QM8A 1R73A 2A9HA 3OR7C 4LH7A 2Q67A 1Y74A 5K1XA 1VQKV 2QR4A 4JF3A 1XMOB 2D2CB 5EK0A 5KAIZ 1FAFA 4DR3B 4NB5A 2V4DA 5J9PC 5EYPB 2EBOA 3ZN1A 3SGIA 1IBLO 3DGEA 2L6LA 4YJ2A 4ZBMA 2CTWA 2F1MA 1RFYA 5AG2A 1OZ0A 3ZMVA 4IIJB 4JGSA 3HKBA 1R6TA 2MK3A 1GK9A 4DO2A 1F51A 4JI6O 2Z3YA 1N34B 1GO3F 1H2NA 1OCZB 3FYIB 1QVFU 3J7AU 5EZYB 1XQ8A 1XMQB 5LXTB 2ITCC 1NU1H 1XDCA 2YXLA 2LP7A 3B8MA 3JARB 4JI7O 3RFRA 2FB5A 2XHBA 3E86A 4JYBA 2A3QA 3K04A 3SJQC 4LC1A 5JVDB 3ZRVA 2JGDB 4ZI7B 4EFBA 1S72V 2F43G 5LL6Y 2WLIA 1WA8B 4GZRB 3SJAC 4X65B 4UCRA 4NXNO 1IURA 5B5EZ 1VQ8V 3ZHVA 2Q69A 3U11A 1RSOA 4DV6B 5IE9A 3CE2A 4NVPA 4OGQB 1QR9A 1Q6HA 1M1KW 1SC5B 1QR8A 4JI2B 4BIZA 1GRJA 3ZIAG 2QKCA 1UFIA 2R70A 2QKSA 1THZA 1NJIW 3K08A 4NTYA 2Q5ZA 1YITV 5B1BB 1M93A 2WLNA 4NKGB 4ABMA 2ILMA 1Z5WA 2GDSA 2QWQB 5LOVB 4YY3O 5BMVA 1N36O 3BPZA 3JD4A 4OPAA 4W4KA 5JCOC 1Z5VA 3RYFB 1AB3A 1YF2A 3G67A 5EIBD 2QM4A 4UCOA 1H2GA 1HP8A 4JAVA 4FLVA 1XMOO 1XEQA 2Q0AA 1KUQA 2OCHA 3ZRWB 1HNWO 2BTQB 3JAKB 1JR9A 1YXBA 4NXMB 3JALA 3G4SV 2XAHA 1E79G 4FLZA 2PUSA 2ZNIA 3H1LH 3H9VA 3H1HH 2Y0IA 3JSLA 4DR2O 4B3RB 3ZMZA 1XNQB 3K03A 2WLHA 4JYAB 4J7KA 3ETEA 4DR6B 1VF6A 3R66A 1YCIA 4RUEA 3JD0A 2YIAA 1YJ9V 3SPJA 1K5SA 2LGQA 4O4JA 3K59A 2ZDIC 4O4IA 5IJ0A 1SZXA 3B2EE 5IYDO 1Q5OA 2E76B 4O2BA 1WB8A 1COWG 1G1XB 1MNGA 2WA3A 4LF5B 1L0NH 2UXXA 3LSQA 4TWKA 4UV9A 3PJSK 2P4KA 1K4DC 3FAVA 4DK0A 2AXTZ 2Q7GA 1AI6A 2F93B 1D5NA 1Q6IA 3RYFA 1XNRB 4KL1A 4FFKA 4YJ3A 1TUEB 2IU0A 1PPJH 3VQVA 4JI4B 5J2UA 5IT9N 4F6EA 1JVMA 2BOBC 3QG5A 4J9YB 4YHHO 3I55V 1SQFA 3BCCH 4PJ0Z 2DMXA 1I94O 1S76D 1QLEC 4PHZA 1H2KA 5LMNB 4FLYA 3ZBHA 1SQVH 1VQLV 5LA6B 3BVOA 1DK1A 4RQFA 1I5XA 5JQGB 4KHPB 5LGUA 3ZX6A 1FYJA 2HJDA 1MMMA 1FS0G 1S5HC 4O4HB 3DC6A 3FD9A 4L87A 2EZPA 1FFXB 5DEDA 1YTFD 3E8HA 1K3EA 2IW5A 1N0NA 1QNMA 3APQA 3QO5A 4JAAA 2BOCC 4Z1VA 3AG1C 3JD3A 2ZQMA 2Y69C 2ETNA 3G71V 4FVMA 4TV8A 4DV0B 1L0LH 4OX9O 2PI4A
chains in the Genus database with same CATH topology
2L6LA 2CTRA 1HDJA 2CTQA 2N05A 2CTWA 2QWQB 4IT5A 4J80A 1BQZA 2QWRB 2EJ7A 2KQXA 2DMXA 2GUZA 1NZ6A 2M6YA 2QWNB 1BQ0A 1FPOA 2LGWA 2GUZB 2LO1A 1N4CA 1WJZA 2DN9A 2QWOB 1IURA 3APQA 3UO3A 2YS8A 3UO2A 2Y4UA 1FAFA 3APOA 2CUGA 4J7ZA 1XBLA 2OCHA 3AG7A 3BVOA 2YUAA 4RWUA 2QSAA 2Y4TA 2QWPB 2CTPA 2N04A 2PF4E 1GH6A 3UCSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6L A;  2CTR A;  1HDJ A;  2CTQ A;  2N05 A;  2CTW A;  2QWQ B;  4IT5 A;  4J80 A;  1BQZ A;  2QWR B;  2EJ7 A;  2KQX A;  2DMX A;  2GUZ A;  1NZ6 A;  2M6Y A;  2QWN B;  1BQ0 A;  1FPO A;  2LGW A;  2GUZ B;  2LO1 A;  1N4C A;  1WJZ A;  2DN9 A;  2QWO B;  1IUR A;  3APQ A;  3UO3 A;  2YS8 A;  3UO2 A;  2Y4U A;  1FAF A;  3APO A;  2CUG A;  4J7Z A;  1XBL A;  2OCH A;  3AG7 A;  3BVO A;  2YUA A;  4RWU A;  2QSA A;  2Y4T A;  2QWP B;  2CTP A;  2N04 A;  2PF4 E;  1GH6 A;  3UCS C; 
#chains in the Genus database with same CATH topology
 3DXR A;  1FXK B;  2Q7H A;  3ZN0 A;  2P67 A;  4BWA A;  4MTO A;  3FB8 C;  1PNL A;  2Q9L A;  2VQF O;  3OGC C;  1K9M W;  5C93 A;  3RBZ A;  5DEC A;  2YUA A;  3P3P A;  4DW1 A;  1H38 A;  3K5M A;  5BR8 B;  3G6E V;  4TSF G;  1AI7 A;  2CAZ C;  1X59 A;  1H8E G;  1GM8 A;  3JAT B;  1KKD A;  4TT3 G;  5LP6 A;  1FPO A;  1IBK O;  4WBN A;  2YXH A;  2JJ1 G;  5JQG A;  4CS2 A;  3STZ C;  1YZB A;  5LA6 A;  1NH2 D;  3VBB A;  1NVP B;  4J42 A;  2EIJ C;  4NYK A;  4BR6 A;  2WLJ A;  1Q7Y W;  2KSD A;  2ADQ B;  2GV9 A;  2CGO A;  4L8J A;  1OCR C;  2X7R B;  3K9A A;  4FJC C;  5L3G A;  3WB2 A;  1QQC A;  3C90 A;  3AK1 A;  5B3S C;  2B1G A;  2P5O A;  3OUS A;  2GTS A;  2LO1 A;  4MTX A;  1FFX A;  1NI8 A;  4PDM A;  1U96 A;  1E1R G;  5CA0 A;  1XMQ O;  3ZED A;  1JJ2 U;  3X2Q C;  3H1K H;  2AW9 A;  2JEX A;  4X9Q A;  2EIK C;  1YDX A;  1VQM V;  1RM1 B;  4X1Y A;  4DUZ B;  4BIO A;  1W0K G;  3RW0 A;  3CXH F;  4X66 O;  4LF4 O;  1AJN A;  2P7T C;  2UXB O;  1ZUQ A;  3J81 N;  3IC9 A;  2RNB A;  1WJZ A;  1D5A A;  4EEQ A;  4PA4 A;  1VQ9 V;  4DV2 B;  1XNR O;  5K1P A;  2QSA A;  2E74 B;  2ITD C;  4P9P A;  4CH3 A;  3H1I H;  2R72 A;  4TUY B;  2PGG A;  1K73 W;  3ABK B;  4RO2 A;  4DUY O;  1M5I A;  5GON B;  1RM1 C;  4TOI A;  3G6B A;  1WAZ A;  3T4D A;  2LW1 A;  5L3F A;  3A0B Z;  3VQW A;  4AHC A;  3HKD B;  5GTI Z;  4WBN B;  4G2K A;  1AVM A;  3CCQ V;  1R3K C;  2R9R B;  4B3M B;  3ZMT A;  3TET A;  4LH6 A;  3SPC A;  1VQP V;  1Q43 A;  4MVU A;  3ZRW A;  3RYH A;  2KB1 A;  2W0X A;  4UVA A;  2JVD A;  4O2A A;  1W0J G;  1BHB A;  4KFM A;  4FLX A;  1IBK B;  3OEE G;  4FIP C;  1V54 B;  2EX3 A;  4BIU A;  4EB6 A;  3E22 B;  3QF7 A;  2RJZ A;  4JZ2 A;  3KZI Z;  3K06 A;  2JDI G;  4TUY A;  4HAM A;  2X6B A;  4H33 A;  1PV0 A;  4TV9 A;  1JOY A;  1EN5 A;  1R6K A;  5LMU B;  2Q7E A;  4UB8 Z;  2JEU A;  2UUB O;  4LFC O;  4ZIB A;  4AQY O;  2EJR A;  1BGY H;  4LFA B;  1BCC H;  4UFZ A;  5LGT A;  3ABU A;  3QVN A;  3ABT A;  1N33 O;  5L3E A;  3FB5 C;  3RYI B;  2DYR C;  4FK5 C;  4B3T O;  1LUW A;  4ASU G;  4DV0 O;  3QO7 A;  4NTW A;  4X1I B;  1MOF A;  2VQF B;  1XI1 A;  3JAR A;  1P7B A;  2E5L B;  3UT5 A;  3JCZ A;  2ZDI A;  4X1Y B;  1SS3 A;  4QIW F;  2DWE C;  4UVB A;  2N04 A;  2VRZ A;  2PF4 E;  1Y6X A;  1MAB G;  4JI1 O;  1R3J C;  1YVW A;  4DV4 O;  4DR1 B;  2ZCE A;  1OCC C;  1Q3E A;  3OFN G;  3K79 A;  1LUV A;  3HKE A;  1RP3 B;  5IYC O;  3SPH A;  4PI2 A;  4DR3 O;  1TA8 A;  2JRI A;  4JTC B;  1R3I C;  3WFV A;  4R6Z A;  1NKD A;  5EBW C;  3TGU H;  3G80 A;  1DF5 A;  1VQN V;  3MDS A;  3ABL B;  4KUM A;  4ZOL A;  1V55 B;  4JI8 B;  4J80 A;  3QO8 A;  5EZY A;  5BR8 O;  4WFB V;  1HNX O;  2ZNJ A;  2GUZ A;  1M57 B;  4WFG A;  4D6T H;  4U7O A;  3LDE A;  4X1K A;  4D7S A;  1AP6 A;  1Y4M A;  3MHH C;  1CXZ B;  3RYI A;  1U97 A;  5FPR A;  5CA1 B;  4JI5 O;  2AHZ A;  1N36 B;  3CWB H;  2X6A A;  1I08 A;  1N0J A;  2WLM A;  3UM7 A;  3CME V;  5IYZ B;  1BQZ A;  4EFE A;  2NR5 A;  2KG7 A;  3OGI B;  2W6I G;  3E83 A;  5B1A B;  3CPW U;  1BE3 H;  4Z1M G;  3HKC A;  1NVP D;  4J10 A;  1NH2 B;  3W7W A;  1S5J A;  2YI8 A;  2HG5 C;  4LF4 B;  2ADP A;  2HHH B;  5CB4 A;  3AG1 B;  5B1O A;  4GKJ O;  2CTP A;  4YIP A;  1MZE A;  3H1J H;  1DTO A;  1GKF A;  2Q73 A;  3BY6 A;  4GCZ A;  1FD9 A;  5D5P A;  4QJF B;  1EN4 A;  5L3B A;  2HFE C;  5B3S B;  1WLE A;  1NZ6 A;  1F4M A;  2ZE7 A;  4IGG A;  3AG2 C;  1IVS A;  1XOU A;  3BEH A;  2UUC B;  4X20 B;  2GBO A;  4FZ0 A;  3CCE V;  1JJO A;  3AK2 A;  3J80 N;  5A9G A;  1QLE B;  4LF9 O;  4YHH B;  3JAT A;  1ROP A;  1MZF A;  2HHH O;  4LFB B;  5IJ0 B;  2FKX A;  1H2S B;  3RT3 C;  5E79 Z;  5CBH A;  4DV5 O;  2YIB D;  1K33 A;  5A2Q N;  1WB7 A;  1YSC A;  5CN0 A;  2IJJ A;  4HBN A;  2UXB B;  1IZ3 A;  4H0L B;  3ABM B;  1N33 B;  2KG7 B;  3D36 A;  4Q6G A;  4K8Z A;  4GT1 A;  3FB7 C;  4IT5 A;  3FB6 C;  4BW5 A;  3N2G A;  3OT7 A;  1SET A;  2ZT9 B;  4X88 A;  2WSS G;  1VQ7 V;  4JV5 O;  4HYO A;  4W4L A;  2ZKO A;  1SA0 B;  4O2B B;  4D7T A;  1TAE A;  5CMU A;  1K34 A;  5CBG A;  1PD3 A;  5KMG B;  3ZHT A;  5DM6 V;  4LF6 O;  5IWA O;  1TUB A;  1LNQ A;  1TGO A;  2ZM6 O;  4CC6 A;  4FM2 A;  2GHY A;  2EIL C;  3IJ4 A;  4X62 B;  4K0K B;  3ZMS A;  3B77 A;  1Y76 B;  1UPG A;  2YC0 A;  1VF6 C;  1ZAU A;  2X0L A;  1B04 A;  3STL C;  4IHJ B;  4NXN B;  1QU7 A;  5LGN A;  4WF9 V;  2BCC H;  3QNE A;  4Q20 A;  1F23 A;  3CYO A;  3DXR B;  4JI1 B;  3BAA A;  1Q82 W;  2L35 A;  4O2A B;  2AGA A;  3L73 H;  1J5E O;  4CS3 A;  1SRY A;  3K0D A;  3JCU Z;  4UVC A;  3NXS A;  1M56 C;  3CRC A;  1JCH A;  2CUG A;  1V54 C;  4J7Z A;  3LSU A;  1BZK A;  2QJ1 A;  1YEW A;  3SYC A;  5H5N A;  5ITZ B;  1RSO B;  2NNU A;  1EM1 A;  4Z2W A;  2DE0 X;  1O9H A;  1S0V A;  1KC8 W;  2RDC A;  4DR5 O;  4N23 A;  4G27 B;  1F4N A;  3FX7 A;  5B1A C;  3SJC C;  2LGW A;  4ICG A;  3W7X A;  3K5O A;  4K8X A;  1XUQ A;  1H8H G;  4NR1 A;  2QTS A;  4BW9 A;  2F4V O;  3SPI A;  2X6C A;  3VQX A;  5LHI A;  3FYE B;  3CJH B;  5D5Q A;  1VMG A;  1NR7 A;  3T1Y O;  1I7F A;  3L70 H;  3T1C A;  3L74 H;  1SES A;  5FNV A;  4DV1 O;  3ZCC A;  3FFQ A;  4DR2 B;  4B7E A;  3ZMU A;  2H3O A;  2RN9 A;  4U3J B;  3K3W A;  1AI4 A;  1VF5 B;  3JAL B;  2V7Q G;  4UXN A;  3RGB A;  3OW2 U;  2DWD C;  4X1K B;  5C8Y A;  2XOK G;  4QE7 A;  4FLT A;  3UO2 A;  2WWW A;  3IGA C;  4OPH A;  1DF4 A;  1FFT B;  3CC7 V;  4X62 O;  1PP9 H;  2FTK A;  2NLJ C;  1PKX A;  4MS2 A;  2JGU A;  3MD0 A;  5J2U B;  5KA5 A;  5JH7 A;  4DV3 O;  1P7G A;  1GN6 A;  3O9O A;  1SER A;  3FKS G;  3UQ8 A;  1SA0 A;  3WG7 C;  1KP2 A;  2F4V B;  4FM1 A;  1FXH A;  3ETG A;  1RPR A;  2OTL V;  3S3X A;  2P90 A;  5H9C A;  2VQE O;  2JS5 A;  5GW7 A;  5IY5 C;  3CC4 V;  1IBM B;  4ZHQ A;  4FFB A;  2QM7 A;  3KCY A;  3VOU A;  1JFF A;  4I4T B;  2YEV A;  4DV6 O;  4TV9 B;  4XBF A;  2EIL B;  4RUF A;  2Q68 A;  5BZB A;  1N32 B;  2QWO B;  2IBZ H;  3Q4H B;  2PYL A;  3CCM V;  4DRX A;  5F2V O;  5IYB O;  1MG1 A;  2ZD9 A;  1Y67 A;  1IXB A;  3ML0 A;  4X20 A;  1QLN A;  1SQG A;  3TXQ A;  3A0R A;  3CCV V;  4ZKI A;  1AP5 A;  2OWO A;  4B3S O;  1SQP H;  4JAS A;  1BS3 A;  5H6Q A;  4TQD A;  2WLL A;  3TCU A;  3SJB C;  3AG3 B;  1VP7 A;  1L1F A;  2EZO A;  1KP3 A;  3IAY A;  3TK1 A;  2MW2 B;  3BRC A;  1Y76 A;  2VWJ A;  1NR1 A;  1UJW B;  4JTA B;  3N2K B;  3K58 A;  1N32 O;  3SYA A;  5BY1 A;  2BTO A;  2QGN A;  3H01 A;  1FJG B;  2UXC B;  5IY5 B;  3TJT A;  5FL7 G;  2JIZ G;  3F5T A;  5BMV B;  4CS4 A;  4DV7 B;  4DUZ O;  2EIM B;  3JAW A;  4DV3 B;  1TVK A;  4JI2 O;  2UU9 B;  2W0F C;  4DYL A;  1R6N A;  1Z2G A;  4MW3 A;  4X1I A;  3Q4H A;  1L8D A;  3EHB B;  5IJ9 A;  1NS1 A;  3UKM A;  3M7M X;  3W7U A;  3F7V C;  3GWK C;  4IL6 Z;  4UCT A;  4UUJ C;  1KKC A;  2ZR2 A;  4OXS A;  1US6 A;  5CA0 B;  1SQQ H;  1M56 B;  2ZE6 A;  1XHX A;  2WLL B;  3ASN B;  2N05 A;  1AJP A;  1I5Y A;  2CE4 A;  2XT9 A;  1GN3 A;  5B66 Z;  3MAQ A;  1BQ0 A;  4JTD B;  3B8N A;  1S5L Z;  2UUA B;  1H2L A;  4GLX A;  1YHQ V;  3CRM A;  2FML A;  3O65 A;  2PZS A;  4YJ2 B;  1WP7 A;  2QTO A;  4HZ3 A;  3CMA V;  4DV4 B;  2ZM6 B;  1M57 C;  4JYC A;  1MSD A;  1K5Q A;  1PL0 A;  1XIL A;  1NTM H;  4PA7 A;  1YIJ V;  3ZRS A;  4WCE V;  3OAA G;  3ZHQ A;  3CRQ A;  3E35 A;  4LF7 O;  4A5U B;  1HR0 B;  2ATK C;  3EFF K;  4FFB B;  3K9S A;  3RWR D;  1ZL8 A;  1PL4 A;  3T2M A;  4G28 B;  1H2M A;  3CXC U;  1Y66 A;  4CBC A;  3CC2 V;  3BA8 A;  4C7U A;  2XAJ A;  1X4T A;  1N4C A;  4XDJ A;  2VS0 A;  2WA4 A;  5ITZ A;  2XAG A;  3ABM C;  4LNU A;  2HJF C;  5HFL A;  4UB6 Z;  3D36 C;  1ENV A;  4AI8 A;  5CA1 A;  4CH5 A;  3B4S A;  5CB4 B;  2FYU H;  4I5S A;  2WLI B;  4MVQ A;  3A0H Z;  1Q6U A;  2CH7 A;  4UCV A;  4F6R A;  2HLD G;  1Q90 D;  3U10 A;  4QGP A;  2GUZ B;  3L72 H;  2UUC O;  4I7Z B;  1I94 B;  2P06 A;  1EN6 A;  3PN1 A;  3I56 V;  5HFM A;  1OJH A;  4K0K O;  2Y0P A;  4GUN A;  3CS5 A;  3ETD A;  5B1N A;  2F23 A;  5L3D A;  3CCJ V;  3JYC A;  4FM0 A;  4H13 B;  4DV1 B;  5KA6 A;  1SQB H;  2R9I A;  4GX0 A;  4WFF A;  4J41 A;  1MA1 A;  2RQ6 A;  2UU9 O;  4DUY B;  4N21 A;  3HKD A;  5KUK A;  4JPR A;  1VQ6 V;  3CCL V;  1AIL A;  1G6U A;  4DR7 B;  4PD4 F;  2ODM A;  4LF5 O;  2XAQ A;  1FXK A;  4LNU B;  4LF7 B;  2BE3 A;  2IH1 C;  5J2T B;  1FXV A;  3S3W A;  2XTA A;  1OCR B;  3RN4 A;  2EIN B;  3K0G A;  3BA9 A;  4I4T A;  3RYH B;  3JAS A;  4JI0 O;  4DR5 B;  3D3I A;  4TQF A;  4X66 B;  4LFB O;  5KMG A;  3UT5 B;  3OTO B;  4LFA O;  3ICX A;  4NTX A;  1HNZ B;  1PNM A;  2UUA O;  1XNQ O;  1P84 F;  4O4J B;  4X64 B;  1M9N A;  2G38 A;  2QE7 G;  4LF8 O;  3ZHS A;  1BT8 A;  1SKV A;  2F95 B;  3L71 H;  3W7S A;  4CH4 A;  5IYZ A;  3WG7 B;  1IXM A;  1YJN V;  4EKW A;  3OR6 C;  4LP8 A;  1NTZ H;  2XAF A;  4DR4 O;  4YXW G;  4UV8 A;  4H44 B;  2Y69 B;  4MW8 A;  1QVG U;  2OYQ A;  4B3T B;  1IDS A;  5JCO A;  2A0L A;  2KKW A;  2ZIM A;  4UCS A;  3C3S A;  4ZOL B;  2VWK A;  3ASO C;  4B08 A;  4DV7 O;  3HPL C;  2LW7 A;  5IJ9 B;  5CBF A;  1W59 A;  2E75 B;  2QDO A;  2A7W A;  3P32 A;  2EIM C;  1WNS A;  5JWP A;  4DW0 A;  5LMU O;  1F7Y A;  1QCE A;  1NT2 B;  2B1I A;  4RWU A;  1PNK A;  5KUM A;  4YIO A;  4FPP A;  1J95 A;  5BXZ A;  3CCR V;  3OE7 G;  4PEL A;  2K9P A;  1HDJ A;  2WAM A;  4MVZ A;  4PDR A;  3JAS B;  2P22 C;  4OX9 B;  1URF A;  3N2K A;  1XHZ A;  1AJQ A;  1GMG A;  5GON A;  1QHT A;  3TXS A;  4LWS B;  3ZS8 C;  1G8M A;  4DV5 B;  2CK3 G;  3P30 A;  3OMI B;  4IYH A;  5KLV H;  1Q8I A;  4FLW A;  5EIB C;  2Q0O C;  2CDY A;  3IC7 A;  4O4L B;  2PTM A;  2CTR A;  2PYJ A;  1KMI Z;  2YSU B;  4TV8 B;  4WFH A;  3AEI A;  1JMK C;  5IWA B;  5EC1 C;  1FKA O;  2RMK B;  3NR7 A;  3GVM A;  1WPX A;  1V9P A;  1AR5 A;  1DGS A;  1FXK C;  3RVZ A;  1E1Q G;  1KB9 F;  2Q4P A;  4B3R O;  1B06 A;  2LFS A;  1EFR G;  4AIL C;  1ZX3 A;  3U0Z A;  1MSW D;  3WB0 A;  3E22 A;  2OT5 A;  4I0X B;  4PA3 A;  4MVR A;  4MT8 A;  2DYR B;  3CEI A;  1R3L C;  3ZJZ A;  3R65 A;  3LSS A;  1GAX A;  5LHH A;  3SYQ A;  5B1B C;  4K35 A;  4JI3 O;  3CHX A;  4ZHQ B;  2QWP B;  3OMN B;  1M90 W;  4CC5 A;  3HR0 A;  4FZ1 A;  1GM9 A;  3ETQ A;  1M4U A;  4QNH B;  1GN2 A;  3AG4 C;  1AR1 B;  2IJK A;  5TIS Z;  2IM9 A;  4GKK O;  1K92 A;  3E8B A;  4B3S B;  4LFC B;  1HWY A;  3AK3 A;  1HR0 O;  1V55 C;  1VQ4 V;  3ZHR A;  5FLX N;  4IHJ A;  4HNA B;  2AZ0 A;  3SYO A;  3CSX A;  1XBL A;  4MVS A;  2Y4T A;  4LF9 B;  3OMA B;  4LWS A;  1KD1 W;  1JQ0 A;  4XDK A;  2JS3 A;  2CTQ A;  3BFR A;  4R8C A;  3L75 H;  1GM7 A;  2ZXW C;  1P49 A;  2FL4 A;  3CX5 F;  1PM9 A;  2Y4U A;  1N8R W;  4R50 A;  4DR1 O;  3OUF A;  2HP8 A;  2OCC B;  5GTH Z;  3FAV B;  3OTF A;  1YI2 V;  3EXA A;  3IFX A;  5LXT A;  3GB7 C;  2OIE A;  4X8A A;  4WFE A;  1Q81 W;  2E3C A;  4JI3 B;  2BSK B;  1BMF G;  3JD1 A;  3KG2 A;  1KQS U;  3SR2 C;  2CGN A;  2ZE8 A;  4PV1 B;  2IU3 A;  3KCX A;  2LFR A;  3LUT B;  2O57 A;  1ZWI C;  1HW7 A;  3DC5 A;  2UXD O;  3OEH G;  5J2T A;  5JVD A;  2QA4 V;  5KAF Z;  4JI8 O;  4QPJ A;  4JI5 B;  1AR4 A;  4I50 A;  1NQT A;  2EJ7 A;  3DTU B;  5JJN B;  3T1H O;  2ZIO A;  2M6Y A;  1B6Q A;  1BSM A;  5JJE B;  1W2B U;  2YS8 A;  3X2Q B;  2QKA A;  2W6J G;  4E4E A;  5C8Y B;  1HNX B;  3LDC A;  4GX1 A;  5LYJ A;  5KHK A;  3C3T A;  4PDL A;  1YTF B;  4JAU A;  5EBM C;  1JX9 A;  1IBL B;  4LF8 B;  4WFA V;  2A79 B;  1VF7 A;  1KU9 A;  4LCU C;  3L9D A;  2E5L O;  5KHG A;  1D2D A;  1Q86 W;  3CCS V;  3D3Q A;  2Q6A A;  5EC2 C;  2A06 H;  4UCU A;  4NXM O;  2AZ2 A;  4JYY A;  2LJ2 A;  4GKJ B;  1SQX H;  4PA6 A;  4EB6 B;  4DV2 O;  1VQO V;  2DW4 A;  4AQY B;  1K97 A;  2UUB B;  2AHY A;  3APO A;  1CEZ A;  1VAR A;  2GSM B;  3B40 A;  2IJI A;  3K5N A;  1OV9 A;  1KBH A;  2C2A A;  3BHP A;  2DQ0 A;  4FMT A;  5H6R A;  2HKO A;  5KX5 B;  2HVK C;  1I0H A;  4CZZ A;  1XL4 A;  2R9A A;  1IBM O;  2ZXW B;  1ZL8 B;  4LR3 A;  1CPY A;  1VEW A;  4HNA A;  5LP6 B;  3ASO B;  1O9G A;  1YJW V;  3N27 A;  1N34 O;  1EZV H;  1XL6 A;  1K7D A;  4J11 A;  1JFF B;  4GX2 A;  3JAK A;  1KEC A;  4YY3 B;  1AI5 A;  4P30 A;  4BAY A;  2PI5 A;  1BL8 A;  1JA8 A;  3K5L A;  2Y48 A;  1WP8 A;  3WB1 A;  4FLU A;  3QTC A;  4O4L A;  4PA9 A;  2YID A;  2M7W A;  2LQT A;  4QE9 A;  1NBM G;  3RYC B;  1HNZ O;  3WU2 Z;  1A32 A;  1OCZ C;  3D8C A;  3BAB A;  3OTO O;  4R7C A;  4LF6 B;  3CCU V;  1JPX A;  2QWR B;  1SZT A;  2F66 C;  3SYP A;  4DK1 A;  4JI0 B;  1GN4 A;  4X64 O;  2JJ2 G;  4I9Q A;  1QBZ A;  5DN6 G;  1ZSP A;  4J9Z B;  4JV5 B;  2Z0A A;  3THO A;  4B7K A;  3LNN A;  4RQE A;  4P9O A;  4PDV A;  3T1Y B;  3HKB B;  4O4H A;  1ZTE A;  4DR7 O;  2BTQ A;  3SDL A;  2OIG A;  2YI9 A;  2GTA A;  4JI4 O;  3T4Z A;  3OM3 B;  2QEX V;  3HKC B;  4U7N A;  4F6R B;  4F4L A;  2P6J A;  5IDJ A;  2DQ3 A;  1OCO C;  4E2L A;  3CP1 A;  2DJV A;  2K1E A;  5FPO A;  3JAW B;  2WPD G;  1ORQ C;  4K3A A;  3F5W C;  2BSK A;  3CD6 V;  2B9Z A;  2YIB A;  3AG4 B;  4JI6 B;  3ABK C;  3VQY A;  4KXR A;  2JK5 C;  1LR1 A;  5JH7 B;  1VIB A;  5FNV B;  3E2E A;  2Z5U A;  4GYC B;  4B3M O;  2HVJ C;  5KHI A;  4P2Z A;  4GX5 A;  3CB2 A;  3JD2 A;  2IJH A;  5H2F Z;  4KHP O;  4CH6 A;  3GWO A;  1TVK B;  3JSN A;  1NTK H;  3SPG A;  5L3C A;  2EIK B;  2EUL A;  3KKY A;  3ASN C;  2Q8V A;  5E1A C;  2YXY A;  5CA3 A;  2V1D A;  4YJ3 B;  2OCC C;  3B09 A;  4H37 A;  2IH3 C;  5JJJ B;  3P3N A;  2HR3 A;  1R1B A;  4QPK A;  4I55 B;  2DYS C;  4I50 B;  1HNW B;  4DRX B;  2UXD B;  5LP6 C;  2PY5 A;  2VQE B;  2OTJ V;  2YIC A;  4DR4 B;  1K4C C;  5LOV A;  3N2G B;  4DXW A;  1DLB A;  4X89 A;  3MHS C;  5LYJ B;  3UCS C;  5KHJ A;  2H8P C;  3W7T A;  4I9W A;  3ZHU A;  1S3J A;  3LNM B;  3RYC A;  4JYA O;  4RAI A;  2DN9 A;  5LMN O;  3ABL C;  4MVO A;  2ZE5 A;  4MTF A;  4MTG A;  5LBQ A;  2B5U A;  1OCO B;  3HKE B;  2ARH A;  2YEV B;  1VQ5 V;  1EZJ A;  1RPO A;  2D3O W;  1OHH G;  2NN4 A;  3F7Y C;  1XRE A;  2HEP A;  3OD4 A;  4XDL A;  1WN7 A;  2KQX A;  5KHH A;  3CRA A;  1OCC B;  1G4Y B;  2ZIN A;  1TUB B;  1Y74 B;  3A2F A;  4IYI A;  2DYS B;  3T1H B;  3HB3 B;  1GTO A;  3M8A A;  4GKK B;  1ZLZ A;  1CP9 A;  3ZRX A;  1K8A W;  2XUM A;  4IIJ A;  1EBO A;  3E89 A;  4O4I B;  4MSW C;  4I0X A;  1IX9 A;  2WLK A;  4KP4 A;  3LDD A;  5EBL C;  4LBE C;  3JAM N;  4I55 A;  5KX5 A;  3DSQ A;  2CH7 B;  5EYP A;  2P4V A;  3E8G A;  3RVY A;  4JI7 B;  3UO3 A;  4J7J A;  2RCV A;  1P4R A;  2UXN A;  2XND G;  3AG7 A;  2EIJ B;  2H94 A;  3K57 A;  1BHA A;  3CJH A;  3CRR A;  1S77 D;  3E8F A;  1KYO F;  2N74 A;  2DOS A;  3AG2 B;  1SF9 A;  4JZG A;  3A8T A;  4MVM A;  2YDE A;  3M99 B;  1B3Q A;  4U3J A;  2QWN B;  3EVK A;  1FJG O;  2UXC O;  2XAS A;  4U3F H;  3AG3 C;  1T5E A;  4X65 O;  1WA8 A;  1GH6 A;  5LHG A;  4PI0 A;  1J5E B;  1WPB A;  2EIN C;  3I5D A;  2ZR3 A;  2JGD A;  1ARO P;  4ZI7 A;  4DR6 O;  2QM8 A;  1R73 A;  2A9H A;  3OR7 C;  4LH7 A;  2Q67 A;  1Y74 A;  5K1X A;  1VQK V;  2QR4 A;  4JF3 A;  1XMO B;  2D2C B;  5EK0 A;  5KAI Z;  1FAF A;  4DR3 B;  4NB5 A;  2V4D A;  5J9P C;  5EYP B;  2EBO A;  3ZN1 A;  3SGI A;  1IBL O;  3DGE A;  2L6L A;  4YJ2 A;  4ZBM A;  2CTW A;  2F1M A;  1RFY A;  5AG2 A;  1OZ0 A;  3ZMV A;  4IIJ B;  4JGS A;  3HKB A;  1R6T A;  2MK3 A;  1GK9 A;  4DO2 A;  1F51 A;  4JI6 O;  2Z3Y A;  1N34 B;  1GO3 F;  1H2N A;  1OCZ B;  3FYI B;  1QVF U;  3J7A U;  5EZY B;  1XQ8 A;  1XMQ B;  5LXT B;  2ITC C;  1NU1 H;  1XDC A;  2YXL A;  2LP7 A;  3B8M A;  3JAR B;  4JI7 O;  3RFR A;  2FB5 A;  2XHB A;  3E86 A;  4JYB A;  2A3Q A;  3K04 A;  3SJQ C;  4LC1 A;  5JVD B;  3ZRV A;  2JGD B;  4ZI7 B;  4EFB A;  1S72 V;  2F43 G;  5LL6 Y;  2WLI A;  1WA8 B;  4GZR B;  3SJA C;  4X65 B;  4UCR A;  4NXN O;  1IUR A;  5B5E Z;  1VQ8 V;  3ZHV A;  2Q69 A;  3U11 A;  1RSO A;  4DV6 B;  5IE9 A;  3CE2 A;  4NVP A;  4OGQ B;  1QR9 A;  1Q6H A;  1M1K W;  1SC5 B;  1QR8 A;  4JI2 B;  4BIZ A;  1GRJ A;  3ZIA G;  2QKC A;  1UFI A;  2R70 A;  2QKS A;  1THZ A;  1NJI W;  3K08 A;  4NTY A;  2Q5Z A;  1YIT V;  5B1B B;  1M93 A;  2WLN A;  4NKG B;  4ABM A;  2ILM A;  1Z5W A;  2GDS A;  2QWQ B;  5LOV B;  4YY3 O;  5BMV A;  1N36 O;  3BPZ A;  3JD4 A;  4OPA A;  4W4K A;  5JCO C;  1Z5V A;  3RYF B;  1AB3 A;  1YF2 A;  3G67 A;  5EIB D;  2QM4 A;  4UCO A;  1H2G A;  1HP8 A;  4JAV A;  4FLV A;  1XMO O;  1XEQ A;  2Q0A A;  1KUQ A;  2OCH A;  3ZRW B;  1HNW O;  2BTQ B;  3JAK B;  1JR9 A;  1YXB A;  4NXM B;  3JAL A;  3G4S V;  2XAH A;  1E79 G;  4FLZ A;  2PUS A;  2ZNI A;  3H1L H;  3H9V A;  3H1H H;  2Y0I A;  3JSL A;  4DR2 O;  4B3R B;  3ZMZ A;  1XNQ B;  3K03 A;  2WLH A;  4JYA B;  4J7K A;  3ETE A;  4DR6 B;  1VF6 A;  3R66 A;  1YCI A;  4RUE A;  3JD0 A;  2YIA A;  1YJ9 V;  3SPJ A;  1K5S A;  2LGQ A;  4O4J A;  3K59 A;  2ZDI C;  4O4I A;  5IJ0 A;  1SZX A;  3B2E E;  5IYD O;  1Q5O A;  2E76 B;  4O2B A;  1WB8 A;  1COW G;  1G1X B;  1MNG A;  2WA3 A;  4LF5 B;  1L0N H;  2UXX A;  3LSQ A;  4TWK A;  4UV9 A;  3PJS K;  2P4K A;  1K4D C;  3FAV A;  4DK0 A;  2AXT Z;  2Q7G A;  1AI6 A;  2F93 B;  1D5N A;  1Q6I A;  3RYF A;  1XNR B;  4KL1 A;  4FFK A;  4YJ3 A;  1TUE B;  2IU0 A;  1PPJ H;  3VQV A;  4JI4 B;  5J2U A;  5IT9 N;  4F6E A;  1JVM A;  2BOB C;  3QG5 A;  4J9Y B;  4YHH O;  3I55 V;  1SQF A;  3BCC H;  4PJ0 Z;  2DMX A;  1I94 O;  1S76 D;  1QLE C;  4PHZ A;  1H2K A;  5LMN B;  4FLY A;  3ZBH A;  1SQV H;  1VQL V;  5LA6 B;  3BVO A;  1DK1 A;  4RQF A;  1I5X A;  5JQG B;  4KHP B;  5LGU A;  3ZX6 A;  1FYJ A;  2HJD A;  1MMM A;  1FS0 G;  1S5H C;  4O4H B;  3DC6 A;  3FD9 A;  4L87 A;  2EZP A;  1FFX B;  5DED A;  1YTF D;  3E8H A;  1K3E A;  2IW5 A;  1N0N A;  1QNM A;  3APQ A;  3QO5 A;  4JAA A;  2BOC C;  4Z1V A;  3AG1 C;  3JD3 A;  2ZQM A;  2Y69 C;  2ETN A;  3G71 V;  4FVM A;  4TV8 A;  4DV0 B;  1L0L H;  4OX9 O;  2PI4 A; 
#chains in the Genus database with same CATH homology
 2L6L A;  2CTR A;  1HDJ A;  2CTQ A;  2N05 A;  2CTW A;  2QWQ B;  4IT5 A;  4J80 A;  1BQZ A;  2QWR B;  2EJ7 A;  2KQX A;  2DMX A;  2GUZ A;  1NZ6 A;  2M6Y A;  2QWN B;  1BQ0 A;  1FPO A;  2LGW A;  2GUZ B;  2LO1 A;  1N4C A;  1WJZ A;  2DN9 A;  2QWO B;  1IUR A;  3APQ A;  3UO3 A;  2YS8 A;  3UO2 A;  2Y4U A;  1FAF A;  3APO A;  2CUG A;  4J7Z A;  1XBL A;  2OCH A;  3AG7 A;  3BVO A;  2YUA A;  4RWU A;  2QSA A;  2Y4T A;  2QWP B;  2CTP A;  2N04 A;  2PF4 E;  1GH6 A;  3UCS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...