2KR2A

Xenopus laevis malectin complexed with maltose (glcalpha1-4glc)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
190
structure length
190
Chain Sequence
b'GAMSGLADKVIWAVNAGGESHVDVHGIHYRKDPLEGRVGRASDYGMKLPILRSNPEDQVLYQTERYNEDSFGYDIPIKEEGEYVLVLKFAEVYFAQSQQKVFDVRVNGHTVVKDLDIFDRVGHSTAHDEIIPISIKKGKLSVQGEVSTFTGKLSVEFVKGYYDNPKVCALFIMKGTADDVPMLQPHPGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malectin-A
publication title Analysis of the specific interactions between the lectin domain of malectin and diglucosides.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Carbohydrate binding protein
total genus 14
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11721 Malectin Malectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2kr2A00
1W8UA 4CP9A 4YW7A 1GWKA 2LROA 4LKEA 3ZYFA 4A6SA 4AL9A 2WYFA 1WCUA 2KR2A 4YW6A 1HN0A 4CPBA 4CP9B 4LJHA 1W8ZA 1V0AA 2C24A 1OH3A 1UOJA 1L7LA 2K46A 5D21A 4BQ5A 2JWPA 1W9FA 3UT0A 3ZYHA 4LKFA 2LRPA 4LK7A 1OKOA 4BQ2A 1W90A 2Q1FA 3ZYBA 1GWMA 1WMXA 2VXJA 4LKDA 4BQ3A 2O14A 3ORJA 4LK6A 1GWLA 4CPBD 4BQ4A 4YWAA 1W8WA 1W8TA 1WZXA 3F95A
chains in the Genus database with same CATH superfamily
1W8FA 2FDKA 1CJPA 1H9WA 1DGRN 1YFWA 2P17A 2WZR3 4Q8KA 2DFBA 3VBOB 3S57A 2Q1ZB 5LRRA 2D5FA 2WYFA 1WCUA 2VUJA 1J83A 3C7GA 4LEJA 4RYDA 1W6PA 2WZR2 4P00B 5HXMA 5A33A 1UU4A 2CU5A 1VP6A 2WZ8A 1QH6A 2ARXA 5F9TA 4CUGA 3VGIA 2RDSA 2IXLA 2W94A 2XG3A 1D4VB 3G6JB 2ZEWA 4RGGA 3RZZA 5K7PA 1JODA 2H0BA 2XR4A 1LCLA 5FYZA 3LSEA 3R05A 2ATFA 2ILMA 1WMXA 1JYXA 1FPN3 2CYFA 4KBZA 4AGVA 1RXFA 3OGSA 1GNZA 1FPN2 3SHRA 5ACA1 1CAVB 5L7OA 3T2OA 1HRI2 2WS92 1F15A 3POBA 3WP3A 3AFKA 4CDWB 1EV13 1H2KA 4Q4W1 5FY7A 1GP4A 3WUDA 5DDJ2 1Q56A 1SACA 1NA1A 2JG8B 2ZS6B 3HD8B 4TXWA 4JTNA 5DQ0A 4MG2A 4BB3A 1Y9MA 2DVGA 3ZDVA 1ALYA 2VAUA 2GC3A 4AHYA 2WNVB 4WVMA 2TUNA 1LHNA 3IDAA 3UESA 3GZUC 4XFIA 2QDRA 4IEZA 3JU9A 3W9AA 3AKSA 1YNAA 4JKMA 1RXGA 2RMU3 3KT1A 5T3NA 2BVVA 1Q5OA 4XUTA 4NRQA 4XIOA 3D4KA 3T08A 5IJRA 3BTZA 1UNBA 1GYKA 1AYN3 2RMU2 3FHAA 4LHKA 2XQXA 4JQRA 4FP3A 2R043 4LBLA 3QD6A 2FDJA 5J09A 1AYN2 1NQDA 1N1TA 2X5IB 3AVRA 4MUVA 2R042 1RVF3 2WT1A 4AL9A 5FZFA 1WW6A 3IDEA 1OSGA 2JG9B 4FI9A 2WUHA 2B7YA 4GIQA 2VW1A 4XXAA 3GZTB 4GH4B 4YGBA 1LU1A 1RUF3 3B9IA 5C9AA 1C4RA 4DXSA 1FMD1 2P3JA 2PLV2 4YVSC 1AVBA 3H3LA 4HPKB 5C5TA 4QKNA 5FLHA 3H1WA 4Y1XA 1OLMA 1G8WA 3LEKA 4JHZA 4XF4A 4NHMA 1W6MA 2VZ1A 5E6HA 4HOOA 1V9U2 4AQSA 4NWVA 4ES9A 1LECA 3BU0A 1LULA 1WMDA 1YQCA 2G9GA 1W0NA 2Y6GA 3GDBA 2D93A 1TE1B 1L7QA 1S0JA 1U0AA 1AXYA 1ENQA 1W6NB 4K9SA 5B2GB 5JIUA 1XYNA 1VAMA 5EIYB 1W9TA 2RR13 2VVDA 5I8YA 5F3CA 4MVTA 4BQXA 2Q4SA 3M70A 3ZYBA 4K8RB 1K5JA 5EJ3A 5LEJA 3CL1A 4LBJA 3C7HA 4K8FA 4QX0A 5JOZA 4FPCA 3LGRA 5CA6A 5J37A 2ZGUA 1UU5A 2EXIA 2BFUS 3KGZA 4OHXA 1SG3A 4XEZA 5DUWA 1UYZA 4CU9A 2EIEA 1PGL1 4XFBA 3WV6A 5LASA 5A3TA 2JDMA 5BNOB 1OXCA 2VZSA 4LT5A 1SPPB 4HLTA 3WNPA 2GNMA 2WRAA 1ZM1A 3DYMA 4XUOA 2WZPP 4IEPA 3ETPA 3DPRA 4AVVA 4ZXKA 1O8SA 2HWF1 2B9UA 2VG9A 3KLSA 5FK8A 3KCYA 4QGMA 4P5HA 1AYM3 2R1DA 3AP7A 4Z07A 2JB4A 1MS9A 5JOXA 2XL7A 2PHLA 4IQPA 3VHOA 3WNNA 3Q8AA 5JZGA 4N90A 1QIQA 3PUHA 4FQ4A 3MIEA 2DUOA 4NPMA 3TWIA 4TTGA 4FTSA 1Y3TA 4JGZB 1FI2A 1GWKA 4WM8B 5IVBA 2WN3A 5KC5A 4M3CF 3DUIA 4QDSA 5FYTA 2CNAA 2ZZJA 1ZBA1 1O5UA 1W2NA 2ZGQA 3MYXA 3TN91 4P9XA 4YGCA 2E7QA 4UF0B 2DVAA 3ZYIB 1YJKA 2UYAA 2B8MA 2XJQA 5GLUA 4YYOA 2H6CA 4YG6A 3WF3A 3I2FA 1RUC1 4N43B 2YPDA 2C26A 4UOJA 3MIDA 3QLQA 1WLTA 2BRTA 4OFGA 4SBVA 4O9EA 5IVEA 1LHWA 5A7SA 3LAGA 2UY9A 2HEVF 2YG0A 2VQ0A 2YHJA 1YXWA 5DN2A 3ZIWA 1J59A 4ZZ8A 3USUB 2GC1A 1RC6A 3A22A 1NCRB 1SHWB 2ZGOA 3LA7A 1O3TA 3NKGA 1LOEA 3AMNA 3AMPA 1Q8QA 3J7HA 4YW5A 1V6MA 1NCQA 3HJRA 4QWNA 1RUE3 4Y5Z0 2W1SA 3MICA 2QTWB 4Q4Y1 4YFWA 3J7MA 4CUCA 4YZ5A 1RUE2 1WW4A 3MFCA 2QZ3A 2JDHA 4N53C 4TSVA 5LATA 4IV1A 2H6BA 4FAGA 1Y7BA 1BKZA 4PBPA 1AXZA 1GOGA 2XJUA 2RS11 3ZYHA 4DY3A 5J96B 4JRAA 1POV0 1GSLA 3E5XA 4QPIC 3N9MA 2VBPA 5KHIA 4U2AA 4RR3B 4M01A 4TLFA 4YVWA 4Y1UA 1ND2A 2VC9A 2Y6JA 1OMIA 3AZZA 3C3VA 2NP0A 3N9NA 4CP2A 3WT3A 1Q43A 2ZGPA 2OVUA 4FPKA 1WMFA 1N1VA 2I45A 2P1BA 3OPTA 5JOWA 5CNAA 3VBHC 4A42A 1VALA 3BPSA 4YGDA 5FOJB 5FPXA 2RDQA 1VBC1 1G9CA 3H7YA 1ZRFA 2FZ2A 5ACA2 5CVRA 5JIAA 1J1TA 1AXKA 1W2AX 2PHRA 4CEWC 1XSRA 3I2KA 1JOPA 1SLIA 4Q4W2 1E5HA 4LKDA 1GNYA 2V73A 3U4XA 4LLOA 1ENXA 2DUPA 1Y43B 4JGYA 2I74A 4MGYE 3OUIA 1R093 4GD4A 1VR3A 2XVGA 1TMF1 3WDXA 3H0OA 2QQOA 4Q1PA 2RM23 3D0SA 4FFHA 5EJZB 1R092 1STMA 2O8QA 2FBEA 3W59A 1BQPA 4Q4X3 2QQKA 1K5MC 4NRMA 1X82A 2CL2A 3HNBM 3UKNA 3VD5A 2Q5TA 3MV11 5I0RA 1H1MA 3ZIXA 1PM7A 1W05A 1GQPA 4AFAA 1MEC3 2ZX1A 4LKSA 1J3RA 2BOIA 4AEDA 2J22A 3ES4A 3MW2A 2WNUC 4GA9A 4IETA 4L99A 3UGGA 4B7KA 5BNPA 3LCPA 3THCA 3ZPYA 3V0BA 4FXKB 2QQMA 4IEWA 5HCFA 1I6XA 2JIGA 3OY8B 4B4RA 5FYUA 4OHWA 3CKHA 3RI9A 4C91A 5HPOA 3OJBA 3VBFC 5A70A 2IFRA 5JPNB 4M3CB 1ZRDA 4QQOA 2KA3A 4FPFA 4OI2A 3WDVA 1WA4A 5J36A 2VR4A 5A7WB 2VQAA 3PVNA 1SFNA 3SNMA 4FT8A 4LJHA 5CU1A 1RMU1 5GZEA 1AX2A 1YFUA 2WFF3 5GZDA 5LZ6A 2HBUA 2OXBA 3BIWE 5BNNC 1EAH1 1AL21 1I5PA 2ZAAA 3OBAA 1G9AA 2WFF2 2DYCA 3POSA 4DINB 1VIWB 3ZYPA 5CFDA 1LHUA 5KBFA 2UY8A 4J6GA 1HLCA 2AR6A 2JDAA 4P9YA 2MNGA 4LE4A 3TNPB 4OZXA 5FPUA 3FFQA 3TEXA 4LUMA 1JOBA 4BM8A 4XZUG 2ARAA 4D6RA 5A1FA 1TME1 1CQ9A 3LZZA 1ULCA 3OYWA 5L36A 4FTBA 1DIWA 4NWWA 4FPJA 2CWMA 1DQ5A 3DV8A 1JXNA 1V6JA 2VU9A 3LPGA 4YG3A 3ZMOA 1A3KA 2DVBA 1R1ZA 1UU6A 3GBFA 4ISRA 5JR7B 5K0UC 4XTPA 2XLGA 3S30A 3ZFFB 4CYDA 1IQAA 3E5QA 2O8OA 4AR2A 4QHOA 3HQUA 2RS31 4JCKA 3M3EA 4AFCA 4ET7A 3TAYA 2D97A 1PGL2 1NZCA 2Q1FA 3LDRA 4D7SA 2D43A 5FCCA 1MVEA 1OA3A 3NJXA 4OLLA 4PF5A 4E4ZA 4EQVA 1LOGA 1W2UA 2VQUA 2E31A 1DU3D 2GP5A 2QQPA 4HT1T 5FUNA 2RJKA 3F95A 1G9BA 2QDNA 2O0OA 2RDRA 3IAPA 4QPGB 4UAPA 4ZKTB 3TNQA 1PK6B 4MGIE 3RGBA 5C33A 3B9CA 5TSWA 3OEAA 2W1WA 3IMMA 4IESA 2GNTA 2QE3A 2OT7A 5KHGA 3RMYA 3OCPA 2BWCA 3J8F1 1HRV3 2XJTA 4HBNA 3ACFA 1DP0A 5H9QA 2A70A 2VUDA 4FBFA 3AXEA 1HRV2 4XHXA 3ILNA 1CR7A 4XQWA 3GALA 1WLWA 4IEUA 3AYAA 2VBBA 5CKNA 3P6BA 3SQOA 2O14A 3TN93 4Y1YA 1UW8A 3POEA 1AR63 2XUEA 4FPGA 4A7ZA 1ZBA2 3AFGA 3BB6A 3TN92 4CDXC 1DZRA 3BVCA 5F8PA 4A44A 2VZPA 3ROUA 1CD3G 1FOD1 3HN3A 2Q8EA 1AR62 4YW7A 5FZ9A 1G86A 2C9AA 4Z1VA 1HV0A 4M4PA 4LO8A 1COV3 1RUC2 3RRDA 2ZA9A 3KF5A 3VD3A 1KS4A 3I2IA 1W6PB 1IS5A 1X9TA 1NOVA 3PTRB 1M4WA 1OA2A 2W91A 3ZR5A 4DZGA 1DCSA 2VNGA 3ZO0B 2LRPA 2F4PA 3EBRA 3ALQA 1HXS3 3FE5A 1ZX5A 3K3NA 3I7DA 3L2HA 3BTAA 4IV3C 1ZNPA 4ORFA 4XBLA 5HXVA 4CZSA 5FO8B 1MQTC 2X53S 3J7LA 2OW4A 3LFMA 4S2HA 4YVSA 1PGW1 4QX3A 3AYDA 1FV2A 4NUBA 4C90A 4Z2WA 2ZJCA 4EE2A 2WZEA 4Q0UA 2JX9A 1S55A 4HL0A 4Q4Y2 4XJ8A 1JYWA 2DVFA 3CIHA 3BTXA 1W3VA 3LF7A 5FWEA 4YRDA 5FZDA 2KM2A 1Y9QA 1FATA 4OHZA 5DUUA 5JUVA 1QQP3 3WVJA 2R073 5L7OB 5FPVA 4Y26A 3OF1A 1MZ5A 5I91A 2WAAA 4W65A 5FZAA 5JAXA 2R072 2VMDA 1NA1B 4A3XA 4P02B 5FBJA 5CKMA 3RS6A 1OA4A 4XOGA 3G7DA 4N9HA 1HB3A 3UT0A 4ARXA 4Y5SA 4EYUA 3ZDSA 2DU1A 2A3WA 2ZMKA 4WVMB 4RSUA 2WINB 2DBNA 1EUTA 1VBC3 5F5QA 3OBRA 3MIFA 2A3YA 3GCWA 1VBC2 2CGNA 2BUKA 2P6CA 3PIJA 3DXTA 3CU7A 4RD7A 5FZ7A 1DGRA 3E6DA 3MIHA 3UKVA 1V00A 1VPHA 5LEKA 1W9WA 4UI9L 2UU8A 5EXOA 1MZ6A 3IMNA 1RITA 2CY6A 4ZU7A 5IHRA 1CZSA 1UXZA 2PA7A 1YEWA 2PAEA 1IHMA 1LNSA 1ULEA 5FAXA 3V56A 2TBVA 2Q8DA 5KXDA 3K4AA 3H3UA 1OUXA 1KXGA 4AZZA 3AYCA 4MX3A 3C7EA 5IK4A 1O8PA 4F3JA 1TMF2 4R8HA 5FPZA 4KWJA 2ZHMA 2RV9A 2YROA 1UYYA 2WZR1 2ZX0A 2YC2A 2JJ6A 1X8EA 2P3KA 1S4CA 3D0JA 5K4LA 2Q0AA 1WBFA 1EYBA 4PLNA 3U11A 4W6XA 4FTEA 1UQXA 4XFCA 4BA6A 5FQ0A 2FMYA 1WWYA 3IB3A 3IKWA 4H55A 2JE7A 2DCKA 1RL3A 1W6MB 3KCCA 4LBKA 5F37A 4QGNA 1ND3C 2ARCA 1UX7A 2Y0OA 4X8NA 3WNLA 3NKTA 4OULA 4K20A 2Y34A 3FLRA 4META 3GYDA 1IQDC 3PVEA 1FPN1 5E8AA 3O1OA 4QQHA 2JWPA 4D7TA 3RQ0A 1W8HA 2VZUA 3WQ1A 5JCTA 4MZUA 5C4WC 2A3XA 5LA0A 5BPXA 2Z5WA 3O0XA 1EV11 4G3YC 4L11A 2A75A 3MW4A 2WWSA 2BZDA 3ST7A 1CAXA 4U36A 3H50A 1XB9A 4QPYA 1OVPA 1EAH3 1V0AA 1RMU2 2GN3A 2GZWA 4HONA 5I0UA 5A3MA 1RUOA 4E8DA 1EAH2 2ORZA 3T3YA 2ZX3A 1UKGA 3SH4A 4Z92B 5HV0A 4W50A 5FYMA 1JHNA 3NMBA 4OQ9A 4AFDA 5BNQA 4XFGA 1DDLA 5KXCA 1TME3 2IC1A 1REFA 4N7UA 2P2KA 4B29A 2WYSA 1AYN1 2W3JA 2BNOA 1TME2 4RA0A 2PELA 2R041 4N53A 1G6NA 1OKOA 3DPRB 4E9KA 1HQLA 3O1PA 2PHUA 1RGSA 4IW3A 1RVF1 1W9YA 4K21A 4A41A 4XJUA 4PIXA 1MS8A 1N47A 4QPIA 2UURA 3WQ7A 5L19A 3FL7A 2XVLA 4LNVA 4HVQA 5FZHA 5JZGB 2RS33 2CTVA 1S0FA 2VZOA 1CVNA 5FP3A 4XW3A 1RUF1 2RS32 3JXSA 1QU0A 4QD2A 5FXWA 5KR7A 3JZVA 4CP1A 2PHXA 1OFSA 4MLOA 3MLKA 2XHNA 4ZXEA 3ZOIA 2ZACA 1UOBA 3VBHA 5FP9A 1DYPA 4W6WA 5C8CB 3HBZA 4HG6B 4A7YA 5C3SA 4RHV1 3DF0A 5GLVA 4DOUA 3M2MA 4BQ2A 2GAUA 1PNFA 1S0CA 2XLFA 3O1TA 1OLRA 4GWJA 2HWD3 4CEWA 1W9SA 3J8F3 4LK6A 1XJAA 1V6IA 1JZ8A 2HWD2 3IT8A 4WM7C 4MGTA 3J8F2 3WDWA 3T0AA 2ID4A 2LROA 1CAUA 3VD9A 2RR11 4PQQA 3ZSEA 5FXVA 4XDOA 1C8M3 2RHPA 2VQTA 2XB6C 3LOIA 5H9PA 3WZ1A 3KSCA 4DMIA 3S0MA 1WKYA 1K5MA 1VB2A 1FOD3 2XGXA 2EAAA 3THDA 3WG1A 1URXA 3ZLIA 3UK9A 2OS2A 2EALA 1FOD2 1VLNA 5KHHA 4FFIA 5HBAA 1ACCA 2W5FA 4W8JA 2Y38A 3B3QE 2WNUA 1QNWA 3FFZA 4AK3A 1GWLA 2CWSA 4KL1A 2PFWA 4PT6A 4UFJA 4NE9A 1L7RA 4AVAA 3JUUA 4XXPA 4HKLA 4UFIA 4YVWB 1R083 1W04A 1RUJ3 3R4SA 3VBFA 1AYM1 1D4M1 2EIBA 1VB4A 5HI0A 4DIQA 5IVJA 2GP3A 3M3CA 4OVEA 1MS0A 1J58A 4ISQA 4UW6A 1PGW2 4C8DA 4CXXA 1KDKA 2PTMA 4Q0SA 5D21A 1J3PA 4URAA 1OQ1A 1YFYA 2V5DA 2VMCA 3POYA 2HH9A 4NVPA 5AVPA 1POV3 1KRIA 1JU4A 5BNNA 2G9FA 5AC93 3H8UA 2WO1A 2WBKA 2Y60A 1JZ5A 2QQLA 4XC9A 3WY6A 2MEV3 1A78A 1OURA 2D6KA 3LEIA 1LU2A 3KV5A 5GZGA 2MEV2 1CX1A 2Z69A 4JGYB 4BLIA 5JVVA 4EN0A 1ZVFA 1KFUL 2J1EA 3FWEA 1QHDA 5FDBA 3WF4A 2WA3A 4JC1A 3NAPC 3WOGA 4DUXA 1F2NA 1PO13 1MZFA 4CCDA 4RFT0 3D6EA 4MGSA 2XBO3 5FZBA 4QDQA 1JUHA 4UW3A 1PMIA 3SH3A 1YC61 5K0UA 3ZXLA 2XBO2 2XXZA 1YQ2A 1SEFA 3Q8FA 5FFOC 2YU2A 3U07A 1LGBA 1O91A 3APBA 1ENRA 1R1A3 1Q8VA 1LAJA 2D6PA 4DUVA 4RGAA 4AEDB 5LBBA 3V0BB 1C1FA 5BNPB 1HJFA 2C4XA 4IGOA 2BEOA 4PDWC 5T5PA 3J9SA 3AZWA 1DG6A 1HJGA 3HVDA 1YO8A 4R9CA 2G9ZA 3LQCA 2VZRA 4LIVA 1JZ6A 1IKQA 4AVSA 4AGRA 1KEXA 4PCRA 1OLQA 3IIAA 3HQXA 4JDNA 5A3LA 3WLUA 2W52A 3DGTA 1O3SA 5T5LA 3THPA 2A1XA 3V65A 2YDEA 1PHMA 3ZXFA 3AP5A 5LA2A 3B94A 3ZKUA 4Q4V3 4BOWA 3WNMA 4D69A 2X29A 4LPLA 2A6XA 3S7EA 1XNCA 1ZRCA 1JYVA 1ZA4A 1BXHA 2WSUA 3KS7A 5CZKA 5A3OA 4GQ7A 5CB7A 3E1F1 2LUWA 1UMIA 3INAA 3A0NA 4NAOA 5FREA 2BPA2 2NM1A 3NNJA 3PU8A 4CDXA 2D3RA 1SFPA 4UW4A 2NPIA 4YM0A 4JTOA 2NYYA 4NROA 1X36A 1EV12 5ANQA 2A6YA 1OOPB 2Y64A 1D2SA 1UWWA 3GXUA 1W8OA 1RHI3 1ZZ8A 1DQ1A 1NLRA 1VBE1 5FKCA 1HIXA 4OUMA 4ITCA 4PJYA 4Y22A 4CDQC 1QJEA 1O59A 1R091 4AFMA 2X5IC 5FZGA 3VBUC 1Q8SA 4MXWA 2RM21 1YQ8A 5EHDA 3EXUA 4BWOA 3SEPA 3PJYA 2RJLA 4IV3A 4Q4X1 1AX0A 3FUOA 1W0PA 1MQTA 1Y4WA 1RTVA 3I2GA 5GLTA 2GC0A 1C28A 2D6OX 2E51A 2WR9A 3RZKA 1ZZ7A 4LUKA 1O4ZA 2LM3A 3UV9A 3OOXA 1ONAA 1MEC1 2WLQA 5FZ3A 3UYJA 5DZEA 2PQSA 4UFKA 3CZJA 4XABA 2ZABA 4G9SB 4LLFA 2R32A 3ZYGA 1RVF2 1YLLA 3SXWA 1XRUA 4QX2A 4AW7A 4ZZ5A 2ZX2A 2ZHKA 1OC1A 4MYEA 4KWUA 2WO7A 3OGRA 4UWDA 3NNLA 5FP7A 4ONUA 2YMZA 3OGGA 2D6MA 4AVCA 3WW1A 5FYIA 1RUF2 1HW5A 3H42B 3ZXGA 1LODA 4GALA 1PZ9A 4EN9B 2XLAA 4FFGA 3CJXA 4IGQA 2VOKA 2X10A 3EHKA 4P9GA 4RHV3 2EF6A 1JS9A 3T4VA 2WFF1 5A6ZA 2JICA 4AHZA 4E2QA 5A6YA 2ADDA 3NQHA 1S2KA 3OBTA 2WWJA 2LS6A 4RHV2 1D2QA 2W92A 4CP0A 3DL3A 4GKXA 2VTXA 2UWBA 3ZPOA 4Q29A 1UD1A 1I3HA 3DKWA 5CAZA 2HEYF 3MUZ1 4LBNA 3VBRC 4K1YA 2ZGLA 3VDCA 3DECA 1GP5A 4GKYA 2YBSA 2RDNA 3KQ4B 5BNOC 3ETQA 3SEEA 4EN7B 1APNA 2RR12 4XAEA 5JR2A 5I0SA 2ZAHA 4IEOA 3WQ0A 3WW2A 5I8SA 2JD9A 5F2WA 2GMPA 2FDGA 4QX5A 4UBGA 2DU0A 4XILA 2NMNA 3F2ZA 1RUI1 1H4GA 3VKLA 2XJRA 1KQRA 3U1XA 4E2GA 5CFCB 1ULFA 2R0FA 2RS51 4GMP0 2Y33A 1ULDA 1J84A 1ND3A 2IWGB 4CA9A 5IVVA 1NE4A 3B02A 4A45A 4YPJA 4ZU4A 1GR3A 2Q8CA 3SCHA 1BLZA 5FMOL 4PF1A 2W08A 5FO7B 1D4M3 3FZ3A 5D2AA 4MV2A 1JUIA 4AVTA 5JSPA 1QJX1 1LGNA 4IDZA 1VMHA 4PI2A 2X09A 3N7JA 5C4WA 1AYM2 1D4M2 2FDIA 5FWJA 1JZ3A 3LIGA 1DGWA 2HKXA 3AMMA 2QZ2A 4YWAA 1C5IA 4HKWA 3CMGA 1HRV1 2PXJA 3WXPA 3V0AA 1GKBA 3ZXAC 4A6OA 1IPSA 3ES1A 2BGPA 4YW4A 5LBCA 2WN2A 2G1MA 1U5ZA 5E89A 5FUIA 4NHKA 2YUEA 3HOBA 5T54A 3VN4A 1K45A 2VCCA 5DAVA 1K42A 5G04L 2JEMA 1AR61 1GICA 4KWKA 3BN6A 2BV4A 5FK7A 4JQTA 4EZHA 2A73B 4D6QA 1JBCA 1EP0A 1MS1A 1SBFA 5IVYA 3SCFA 1UY4A 1SLTA 5C70A 2QQUA 3RWNA 3PMSA 3JB4C 4R52A 1HX6A 1O5LA 1Q3EA 1DQ0A 1F4AA 3MV01 3U37A 1F35A 1COV1 2XDVA 3QACA 4DQAA 3JCIA 3SH5A 3DYPA 1NXMA 4C1WA 3VDDB 2W46A 4MH0E 3ZMNA 1P8JA 4BE3A 5JMCA 2FD8A 5FYYA 5FQ0B 4CDUC 1O4TA 4LA2A 3NO8A 4LITA 1W6QA 3ASIA 1QDCA 1YI9A 4FOYA 4FVVA 1HXS1 3S6PA 5FPAA 4XDPA 4N8MA 3SCGA 1FNZA 5A6XA 4E8CA 1WD3A 3EJKA 4UFMA 2ARBA 1HV1A 4BMEA 4NIDA 5H9RA 5IFPA 5LY2A 5JSOA 4LHSA 1UZ0A 1DQ4A 3VL9A 1ULPA 2AENA 3J26N 2R30A 3J7NA 4LHNA 2DVDA 2Y6LA 3W20A 3GBGA 2WAOA 5HCBA 2GH8A 2ZHLA 3VZKA 1IOAA 1UXXX 2XOMA 4KG0A 4P08A 4R4ZA 5DZFA 1QQP1 3I3MA 2R071 3HR9A 4HMZA 3KWVA 1NLQA 4L8QA 4COVA 3BI3A 5B4XA 5AFEA 4DPNA 3M8LA 3U0ZA 5F39A 2CDPA 1CAXB 4WM7A 1H8TC 1QJU3 3HNMA 3NV3A 3NV4A 3S7IA 3WCRA 1S2BA 4V1PA 4I3GA 1DLLA 4XBQA 1QJU2 5FLJA 4NO4A 4AAPA 3M3IA 2FDFA 4AEMA 1G7YA 1PM4A 3BOWA 3PVBB 4RS5C 3PUQA 5FXXA 1ZZ6A 3WG2A 4UFLA 3RPQA 2VVEA 3MLLA 4AVBA 1XE0A 1WW7A 1E5SA 1XE8A 1F5FA 4NRPA 1QJZA 1BBT3 4LO4B 5KXEA 1F4HA 3AZVA 4Q5OA 2FMDA 5F6LB 5GLZA 4X6RB 2OPKA 4N53B 1VBE3 3ZFEC 3VUOA 3AMHA 2BU9A 3CO2A 1C57A 3KCXA 2A6WA 2HJIA 1A8DA 3CJIB 1VBE2 4LA3A 1Z7S3 2D7FA 4CP9A 3PJQA 1UOGA 1UIJA 3ZXKA 1GV9A 1D0HA 2ZEYA 1Z7S2 2AC1A 1H0BA 2J1SA 2RM22 1XNTA 1NKGA 3I3DA 4P14A 4Y4RA 4LBOA 4M00A 1I5ZA 1VMJA 4I0AA 1I1EA 2P6HA 3WG4A 1VBD3 2JDKA 3NNFA 4Q4X2 4TZDA 3BIEA 1KDMA 1PO23 4C1XA 3OTFA 4LIUA 3O1VA 1ZREA 5FO9B 5A3NA 1FNYA 1HQWA 2RE9A 5F1RA 4F7ZA 2E6VA 1YWKA 4E4HA 2OPWA 1PIV3 1MEC2 2HEWF 1O3RA 3MZHA 3A0KA 5J48A 2YYOA 5FOBB 3OSDA 1K12A 4ZS2A 3RYKA 1OH4A 1OFNA 1PIV2 3O1MA 4QGLA 2WIIB 3U78A 4CEWB 3I3EA 1QDOA 2VNRA 4GB33 3JD71 1LTEA 1RUG1 1GNHA 3NV1A 5F6KA 3BUCA 2V4AA 3WDTA 2BGOA 5BY5A 1D7PM 3K46A 5F5CA 1QNYA 3VBSC 3NAPA 5BXXA 2YPJA 2B4KA 1AJKA 4OZOA 4C0HA 3WINE 4COWA 1WLCA 4URTA 2JDZA 3WHUA 2ZX4A 3LKJA 4QM9A 4NIGA 2CGPA 1HN1A 1K5MB 1VRH3 1F31A 1XYOA 2GNBA 2YFZA 4ZHNA 1Q8PA 1W28A 4WZCA 1YQ5A 2VL4A 3ZFFC 3ZYRA 5IK7A 2ZGKA 4CUAA 1OQEA 4XCBA 3VD4A 2C5DA 1E5IA 2SBAA 4PDWA 1NYWA 1X7NA 3RDIA 4NAMA 2IXKA 4AQ2A 3USSA 4XAAA 3VBFB 4YZ3A 4P9JA 4EN6B 3H3ZA 3D82A 4Z82A 1FV3A 5F3EA 4AI8A 4OHYA 1WGPA 1RUI3 1XNDA 1US3A 1BCXA 4QPGC 4DB5A 1PK6C 2RS53 3N9OA 4S2DA 5DAXA 1RUI2 3HAGA 2FDHA 3ZSJA 2GALA 2JE9A 2RS52 1DGLA 2VCAA 4KGQA 3UGHA 3WR0A 1CZVA 5BNNB 1XNKA 1DHKB 1YUDA 3UNPA 3K77A 1V6OA 4RQPC 2DFCA 5FMCA 1C1LA 3LOBA 1QJX3 2WO2A 3Q8EA 4IXLA 4YLZA 2Y0IA 5FZEA 2V72A 4YM2A 2W68A 5ABJC 1ZZBA 3VHPA 4I09A 1QJX2 3ILRA 2YV8A 1I9RA 3H9AA 5FMDA 2HWD1 3N9PA 2HBTA 1ZRRA 3DKQA 3MGUA 1LR5A 1W9FA 3IZOA 3FN9A 2EXJA 1QXJA 2XONA 1JU3A 5K0UB 4CDQA 1RYYA 3WEZA 4PQ9A 1H1IA 4KWLA 3RWKX 5GZCA 2VMIA 2X5IA 1N3PA 4Q27A 4Y1ZA 3U14A 3VBUA 1NT0A 5M0TA 1CGPA 1H9PA 1N3OA 1C8M1 1XYPA 2J1UA 2JB8A 2JXAA 2WT2A 2ZKNA 4KQ7A 4WVVA 3WSOA 4ZS3A 4MHRA 1POQA 3RYPA 2DDUA 3TRSB 2C0ZA 3JQXA 4XFFA 3WF0A 2AH2A 4QHZA 1JN2P 1GP6A 1QF3A 2XWJB 2NQYA 2QVSB 3A4UA 4LOTA 4W6YA 3IPVA 3JBG1 5GM0A 4NHYA 2Q30A 1YI7A 1COV2 2EAKA 1X50A 4HETA 4IEYA 1FXZA 1WA6X 4FP2A 4BISA 1RINA 4K7JA 3I2OA 2R063 3FBMA 1UMZA 1ZYBA 4BQYA 3RYRA 2VY0A 1R081 1VRBA 1RUJ1 1H2LA 3GHNA 1XU1A 4HN1A 1UAIA 4BIFA 2EXKA 5J1XA 3AYEA 1XQNA 1XSQA 1HXS2 3AP4A 2DURA 3CDZB 4JKLA 1W6NA 4RL7A 5A6QA 5FLIA 3EQEA 1XOYA 1T6GC 2W2IA 4WVWA 2ZGSA 4UW5A 1POV1 4AFBA 1AX1A 3W5MA 4QB2A 4CDXB 5AC91 3WD5A 4GJYA 4Q0VA 2HYKA 1QQP2 1JOJA 2MEV1 1BZWA 4K3UA 4P5YA 1GQHA 4JAAA 1SLAA 3NJVA 2DTYA 3LWCA 5FYCA 3VBRA 4XQ4A 4EN8B 1LHOA 3VHNA 5CIRA 4Y22B 1ODMA 5BNOA 1DFQA 3NRUA 3PVOA 1PO11 4LMFA 4BQ4A 2ZGMA 1KFXL 3B7MA 4IE0A 2XBO1 4GULA 3PUAA 3AZXA 4IV3B 4XJWA 1NAEA 3RZLA 1AUYA 1MQTB 4M4RA 2CAVA 3K4DA 3S5AA 3J4UH 3R0RA 1DLCA 3MF6A 4QU2A 4QKFA 1HB4A 1OPOA 1LJ7A 4CXYA 1R1A1 4CCKA 3LA3A 3GJAA 1VBA3 3MIBA 4H14A 4CEYC 4OCTA 5FZKA 1NXD1 5BYNA 4I2OA 1LOBA 2QQNA 3I2JA 1U5XA 2WDBA 2AREA 2BOJA 5CKQA 3RJRA 2ZGRA 3URFA 2E7TA 3MF9A 1VBB3 1JZ4A 5IFTA 5C9AB 5LRSA 2SLIA 2VBDA 3BODA 1VBB2 5T5JA 1YIPA 1PMJX 1X33A 2XH6A 1UY0A 3P3PA 4MO3M 3WDUA 2VJXA 5IW0A 2VULA 3U10A 4FFFA 1AR71 4FOQA 4MXVA 4B4QA 4Q4V1 3RVHA 1TEIA 1OD5A 3AKRA 3C7FA 5G05L 1UZYA 4COUA 3JD73 1RUG3 1JYIA 1ULGA 2BW8A 5H9SA 2C9KA 5C3OA 1UF2C 5JWPA 5KC6A 3AL5A 3JD72 1RUG2 2QNKA 5DABA 2D40A 5A7QA 5DPNA 1C3HA 1W2OA 4M3CE 3ON7A 3E5UA 4QPWA 4QU1A 1CPMA 2OZ6A 4QQLA 1WCQA 1WUVA 4BYYA 3AM2A 5LY1A 1RHI1 2IXHA 1MS3A 1RUD3 1PVC3 2Z42A 4EROA 2EIGA 5IVCA 4D0QA 2ZOEB 1HN0A 2ZZQA 5HCHA 1KD7A 1PVC2 3T0DA 4LQRA 4CDUA 3FX3A 1WW5A 2HWE3 2KD7A 5F32A 1XNAA 4QXHA 1OH3A 3WW3A 4BQ5A 3W21A 5EZWA 4YZ1A 3X29B 3KMHA 4BJ0A 3E6CC 1ND3B 3PHMA 3NJZA 3ZSKA 1W90A 2ZPXA 5FJKA 1N3QA 3P3NA 1TG7A 1RUNA 1JZ7A 4QAWA 1UX6A 3O5SA 1VAVA 4LO6B 4IEQA 1BYHA 1KGYA 3AZYA 3BOPA 3Q8CA 1S0DA 3EMRA 3AKPA 5FPLA 4GWIA 5C4WB 1DZQA 5C8CC 5JSRA 3AX4A 1UYXA 2IXIA 1OF4A 1W6OA 2VZTA 1MS4A 1V70A 2PHWA 5F3IA 3ZN5A 4BIOA 2R6QA 4GMP3 1H8TA 3V0AB 2BJSA 1UO9A 2VTXJ 1LHVA 1HQNA 5FJHA 2DUQA 2IXJA 1GZCA 2P5BA 5C3PA 3N7LA 3WF1A 1SCSA 4D7YA 3KF3A 3N7KA 3VV1A 4RS5A 3RJ2X 1AR83 2V09A 5D8AC 3H7JA 3OBZA 4BH9A 3HNYM 1BVVA 1AR82 3N9QA 2FCTA 4AEKA 3PMEA 1H2NA 2Q8OA 5IK5A 4GAZA 4IE5A 1BEV3 4G4FA 5A3WA 5LBFA 3ZFEA 2ZGNA 1AJOA 3QOPA 3K48A 5FY5A 1BEV2 4AAXA 3OG2A 4NIAA 3VZNA 2MHFA 2XKPA 3KHCA 2KR2A 2VUAA 3POIA 3LDBA 4LULA 2VMGA 3WP5A 2CAUA 5CYYA 1US2A 1LGCA 2JIJA 3ZYJB 1C8M2 1NCQB 4L0PA 4DUWA 4XQDA 2D6NA 4YG0A 2YY1A 4I30A 4Y20A 5LA9A 2YBKA 4LO7A 2GSYA 2WL1A 5GKAC 4XETA 2W1QA 2OIIA 3RFRA 3JBG3 2P3IA 2CHHA 4IEVA 1YIFA 2NZ9A 4IEXA 4IV1B 2QQWA 2VOVA 4TWTA 1DYOA 5EV7A 3UJOA 2A7AA 1CPNA 1WCKA 5JPMB 3JBG2 5A7WA 1RUH3 4Y5TA 1QOTA 4NIIA 3OD0A 3WX5A 5F5IA 4HKOA 1OKQA 1RUH2 4AHWA 1WD4A 3B5LB 2PHFA 5LBEA 2W47A 3ENRA 3GHMA 5FZMA 1ND2B 4B4PA 3TEZA 2WT0A 2VMHA 4YM3A 1FAYA 4FO9A 4BQWA 1R082 2ETEA 1RUJ2 1A34A 4E27A 5T5OA 1ASJ3 5K9YA 5EYYA 3WQBA 2XPJA 1H1AA 5C6CA 3VBSA 3ZN6A 3ZR6A 4ATEA 2WNEA 1ASJ2 1QXPA 2VZ3A 3HQRA 3JB8A 1B35C 2W0XA 2QCSB 3GBWA 4WVZA 2XL9A 4Y24A 4NR1A 3RZJA 3ZFGC 5LW9A 4XJAA 4WBBA 3P5BA 1B09A 4BK4A 5A3PA 3FJSA 3AL6A 3IAQA 5AC92 3SMHA 1T6BX 5L9RA 4QB6A 3MO4A 3POFA 5FZLA 5E16A 1C8NA 3NSTA 1OT5A 2ENRA 1NZIA 3I4IA 4BU2A 4QM8A 2VPVA 2A6ZA 4IUGA 4Q2FA 4AI0A 4CTEA 4P9IA 4CP9B 4LR4A 1IS4A 2IFWA 4PIZA 5DAWA 2OA2A 1N1YA 3B01A 1DGWX 5FZOA 5FYVA 4KH9A 5FYBA 3RG0A 1SQ4A 4AOCA 1PO12 3TEYA 4FPLA 5F5AA 4AYUA 3HWJA 1SFYA 1CAWA 5JLVA 2E9QA 3OPWA 3ACGA 3P1IA 3PTYA 1QKQA 2BVBA 3VBOC 4QPGA 4CU8A 4DY5A 4J1WA 5L9VA 4F8AA 1PK6A 4Q0PA 3LB9A 1BJQA 1UCXA 2OUHA 4XE9A 4NPRA 3RZMA 1R1A2 5ANNA 5B4NA 2B46X 1EPZA 4Y33A 4ASKA 3QBQA 2OZJA 4M0HA 4PI0A 4RQPA 5GLWA 3VLBB 2EA7A 2YU1A 2E33A 5FBZA 5EFUA 1XBFA 3CNAA 3ITQA 3T2PA 2AGSA 5ABJA 1UOFA 3IWZA 2RJ2A 4B1LA 3LPFA 4XVHA 1L3JA 1DYKA 1J3QA 2NLRA 3NAPB 4LKFA 2GDFA 4CDWC 1S0EA 1AR73 4DEVA 1PNGA 4OMCA 1J1LA 2WJSA 1QJU1 4P9LA 2MPFA 4DRVA 2JG8C 1AR72 5ERLA 2I2SA 1OLME 2WWUA 3N4MA 1OOPC 2JKBA 2ERFA 3OGJA 1A6CA 4Q4V2 3ATGA 4LBQD 5CFDB 1QY4A 2OQ6A 2BNMA 4Z8BA 2GNDA 2WNVC 3BCWA 3FMGA 3HT2A 4HZFA 4H3WA 5FY8A 1S0GA 3TEWA 4EJRA 4DFSA 3LIHA 3OYWB 2XJSA 4XUQA 1BBT1 5CADA 4PDWB 1XU2A 3MEPA 3GM8A 5IATA 5FZ8A 2Z2SB 3K51A 4XFAA 3ACIA 2WNOA 4GXLA 2VMFA 2AZ5A 3MIGA 4YW1A 3WP4A 1LENA 1RHI2 1Z7S1 2Y6FA 4O7XA 4I0WB 3C7OA 3ACLA 1HRI3 2WS93 3KVBA 1BHGA 2JG9C 2HLEA 3AXDA 4HK8A 1DF0A 2PAKA 1LESA 1AF9A 3IIIA 4R9DA 5DDJ3 4GH4C 2PHTA 4XJZA 5LK7B 3NJYA 3RZHA 1HB1A 1EPWA 2J1RA 1VBD1 4LE3A 4D6SA 2Y6HA 4ATFA 4R9BA 1PO21 1GZWA 3LD8A 4JDOA 4QKBA 3S5QA 4DNYA 5IK8A 3SITA 5T50A 3KV6A 4IE4A 1GZ9A 4CPBA 1VE0A 4BXSV 1PIV1 5J98B 1E5RA 3Q8BA 4LBQA 3VZMA 4OYUA 2K46A 1L7LA 4AI3A 3NW4A 2DTWA 1KS5A 1IZ3A 3FLPA 2J1AA 4AI2A 1H4HA 1PZ7A 1CN1A 2OX0A 4GB31 2ZTNA 4C0BA 4AGGA 3ORJA 2EIDA 3RMXA 3HMYA 1MACA 2LTNA 4TN7A 5BUVA 4CDQB 2VOTA 4ASMB 4ASLA 2WA4A 3TYJA 1OBNA 4PLMA 3VBUB 1QOOA 5FZ0A 4COYA 3L9JT 2AYHA 2XKOA 2AEZA 4MSVA 5E88A 1UN1A 1K3IA 1X8MA 1X9PA 1VRH1 2K2SA 4IE7A 2LW8A 3VZLA 4XUNA 1PGSA 2PLV3 2ZHNA 4EZ4A 2H0VA 2GMMA 4HXCA 3U75A 3HBKA 3IPVB 3MLJA 2RVAA 4XJ9A 4EWDA 5D1IA 1GMMA 2DCZA 4CEYA 2YC0A 3MUY1 2QQVA 2X05A 3AJZA 1DQ6A 1V9U3 5CFCC 3LEGA 4DXRA 4JZRA 4QQPA 1OQDA 2PYTA 5JI9A 3M7AA 2JD4A 3SLIA 2JENA 4D3WA 3I2HA 2J1TA 3KT7A 5FYSA 4YVSB 3RSJA 3AKTA 3WNOA 3HN1A 1Z0HA 1ZBE3 4UT5A 3UETA 5EYXA 1H30A 2D5HA 3ELNA 3ECQA 4FOWA 1ZBE2 2VMEA 4BK5A 3D8CA 3KB5A 3PUSA 5IVFA 1CESA 2VNOA 5DUVA 4DXZA 2BYVE 2ES3A 4XFHA 2VH9A 2F6BA 2ZMNA 4YZ4A 5FPBA 5BV6A 3HEIA 1VJ2A 4JGZC 2HYXA 3R4DB 3I8TA 5F3GA 4XPVA 4WM8C 2R1BA 4QHBA 2C6SA 2ZEXA 1QEXA 5IT6A 2N7GA 3VBRB 3T2TA 2FHRA 2VECA 4QXCA 1W8UA 1BK0A 2R16A 1JYNA 2DBIA 4OUEA 3POGA 4FPOB 1ODNA 3A23A 3WNXA 5FIXA 2OYZA 5FZCA 1CIWA 4N43C 3M1HA 3POWA 4JDMA 4BCUA 3GZEA 2WQ8A 3AC0A 1KITA 2XUMA 1OVSA 3AVSA 5F2SA 1C5HA 1OF3A 5LB6A 2YZ4A 1KJRA 3FHQA 3WDYA 4FSJA 2RG4A 3BYWA 3B00A 3CF6E 4KGGA 4KI5M 3VDDC 1ENSA 3MPBA 5FZ4A 2Y26A 4HSJA 4NIHA 3H1YA 3V64A 3E6BA 3TBDA 1N1SA 4O65A 5EP9A 5DXDA 1NCRC 2GC2A 2HWB3 3BKZA 4JX0A 4E4DX 2B9VA 4X6QB 4AF9A 5JDBA 1TVGA 1CX4A 4OI4A 3O0VA 1F9KA 2HWB2 5EWSA 4YSFA 4LOSA 2UYBA 1TQ5A 2R0HA 1W8TA 2TNFA 4NPLA 4Y3OA 2GN7A 4TYSA 3T2QA 1NY72 4TLGA 3T30A 2ET7A 3NV2A 2ET1A 5C8CA 3ZXJA 2XJVA 4OQ8A 2R061 2PN5A 3CLPA 2EICA 1BVP1 3ZX7A 1O6UA 4RR3C 2QFEA 1LOAA 3BALA 3IM0A 4KMQA 1GBGA 3I97A 4AWDA 1QOSA 1NE6A 2UWCA 4CCEA 3FLTA 2E26A 1BMV2 3ME2A 5FYHA 5FMBA 5D8AA 1LEMA 2B5HA 3M3QA 2VZQA 3WNKA 1OD3A 3H8XA 2E63A 3FBYA 4I3PA 3OD4A 1JYTA 2ORXA 4KU7A 3I59A 4HK9A 5T52A 4ZU5A 1W06A 3WP6A 1PMHX 4KNCA 1W3XA 4HSLA 4CSWA 5JXIA 3ZSMA 2JDNA 2ZMLA 2IZWA 4AQ6A 1YQ6A 1GOFA 1XE7A 1U5YA 4J1XA 2ZCWA 1JZ2A 1NQJA 4PHZA 3TOJA 4IERA 3HIFA 3W58A 4YFZA 3CJIC 4GJZA 4Q8LA 5FZ6A 4BDVB 4LHLA 4CDUB 1G9DA 4OMDA 5SV5A 1MR5A 4AI9A 1UY2A 3PLQA 2AUYA 2K9ZA 1BK1A 2DCTA 4ES8A 3KHBA 3VD7A 3I2DA 2G4IA 3IDCB 4V2VA 1BBT2 2J42A 2D98A 2A5ZA 4ZONA 4I0BA 5A32A 2ZGTA 4HVRA 5SV8A 3KV4A 4COZA 2Z79A 1VBA1 5A7PA 1TNFA 5JOYA 2VOXA 2QQIA 2XMLA 1JH5A 1PZ8A 3DN7A 4NHLA 4QB1A 1JYCA 4QPIB 4FAHA 3O12A 4Q1RA 4JKKA 5ACA3 4YW2A 3T0BA 1W6OB 2QKDA 5FY4A 3RZGA 1S0IA 1VBB1 1AL0G 3VKFC 3ZVXA 4KG8A 3PURA 1CJDA 4Q4W3 3ZSLA 1H8TB 2ZBJA 1UIKA 3DEMA 3N3HA 5EJ1B 1VBD2 2Y8KA 3I49A 3VBHB 1PO22 2FCVA 4RS5B 1B35A 4B8EA 3GNEA 2BTVC 5T55A 3O1UA 5CBLA 3MHZA 3ZFGA 4BHPA 1PX3A 4QX7A 5EPAA 1IKPA 5C71A 1NX9A 4H7LA 5FY0A 4Y1VA 5JXHA 4QDRA 4J25A 1SCRA 4Y4YA 4XF9A 1W39A 3ZFEB 2VVFA 3U4SA 5LA1A 4M0NA 1U5IA 4GB32 5FY1A 4INDA 4DO0A 2PQQA 1CAUB 3M3OA 1SLBA 3OPZA 3CZUA 3N36A 1XNBA 3PDQA 4MGKE 1TNRA 1JW6A 3SC7X 4AHXA 1MS5A 4UXAA 4K1ZA 4S2FA 1HB2A 4A7KA 4YZ2A 1RUD1 5AFBA 1PVC1 3ACHA 3D5OA 4NJ4A 5LCWL 3MPPG 2OKXA 3LFIA 2CSGA 2BQPA 2FCUA 1VRH2 3KZ4C 4Y20B 1UL9A 2WQZC 2IVJA 2JDYA 2X8KA 4KU8A 3VBOA 1FMD3 2HWE1 3KQRA 4WZFA 5FZ1A 4YW3A 1XC6A 2BP6A 1FMD2 2WNUB 3ZYFA 5FY9A 1QWRA 3O7OA 4RFRB 2G19A 1HDKA 3QH6A 4EWEA 3ZM8A 5EQUA 1FX5A 1GLHA 2PMWB 1IG0A 1QH7A 5C3QA 3T09A 3NWKA 2HWC1 4LXLA 5L9BA 1UPSA 4XACA 3C2UA 3VZJA 4LTAA 5DAPA 1LOFC 3VBSB 1CAVA 3ZN6B 4CDWA 4HN0A 4Q26A 3VZOA 1WCDJ 2P37A 2VE1A 3SISA 3UKTA 2R49A 4GMP1 3VDBA 4AE2A 4H2AA 1V6NA 2JG8A 5FP8A 1OOPA 1S0BA 3BGAA 4QQ2A 2K0GA 2F4LA 3LDKA 1OPMA 4FPHA 1YYNA 4XCAA 4QMAA 1AR81 4PLOA 1UYPA 2WNVA 1OHFA 2TEPA 4EWAA 2YGMA 3R6SA 4XIKA 1W8ZA 3ZXDA 3LE0A 1GANA 2D6LX 3OUHA 4ARYA 3OGVA 4D94A 5A1AA 1UPIA 2AEYA 2QUOA 5J7MA 1BEV1 5DUXA 5FZOB 1IS6A 4FCAA 5APAA 2FQPA 1LB2A 2YGLA 2HWF3 3H1MA 1CAWB 2WABA 5GALA 4N9IA 1GU3A 2HWF2 3BU7A 1EY2A 2JG9A 3UJQA 5CEHA 5I0DA 4XMIA 4BPZA 3HPNA 1D0GA 3CQOA 5FP4A 4GH4A 4MOAA 3ZN4A 5FRAA 4RGKA 4YW6A 4ZY9A 1AR91 4K6BA 4AXOA 1R64A 4GWNA 4GWMA 3NL1A 4RQPB 3NNGA 3PL0A 4HPKA 4K40A 5F7UA 2C1FA 1ZZCA 3W5NA 1YCIA 1RUH1 1IGOA 2P3YA 4UYBA 2WFPA 5ABJB 2XHKA 5FUPA 1ZBA3 5FKBA 3TB0A 5FXZA 3T4HB 5L7OC 3K3OA 3Q9OA 2R062 4FXGB 4JHTA 4QT6A 3T1LA 4B3NA 2ADEA 3UGFA 1RUC3 1OI6A 1S1AA 1ASJ1 2B42B 1NA1C 3EO6A 4HFSA 5E1RA 5A7OA 3RNSA 4LORA 2OUJA 1QJY1 3QH7A 1VAKA 3VKMA 4DXTA 4RN5A 5JXJA 3EYPA 4XHBA 3FC0A 4NOTA 4D8MA 5FMOS 4JRLA 3I54A 2VZVA 2W1UA 3O1RA 4XF0A 3IN9A 1W03A 4BXFA 2O1QA 4XTMA 4XBNA 3GJBA 3KT4A 4QX1A 1JTZX 3VL8A 2J1VA 4CU6A 4BQ3A 4Q4Y3 4XF3A 4LBMA 1DZTA 3N7MA 1YFXA 2Q1MA 5KXBA 1SMVA 4L92A 5CFCA 1WBLA 1Z78A 2XWBB 1SPPA 2P4EA 2RS13 2WLPA 3EB7A 4MXWB 1WLDA 4S2GA 3N35A 1UZWA 3RI8A 1UZZA 1W2TA 3ZKYA 2RS12 2WSVA 4O61A 2V4VA 3HT1A 5CISA 1H6XA 4B1MA 2GMEA 4R4XA 5FTTC 4ZPIA 3B93A 1CIYA 4A3ZA 1GZWB 2DWRA 5C9AC 2CGOA 2XVKA 5I93A 1UOJA 2ZXQA 1Q8OA 3WHTA 1XXNA 4A4AA 1QXRA 2GH2A 2ZEZA 4LK7A 1JI6A 4LBQB 1MPXA 2R7EB 1VBA2 4QX8A 5FV3A 1YHFA 2YXSA 5FZIA 3WW4A 4CVUA 3WCSA 1KJLA 1IG3A 4JGZA 4I02A 4NHXA 2L9LA 2VCBA 1UKRA 4WM8A 3K2OA 2JKXA 3ILFA 2OQ7A 4WV8A 2VNVA 4DRRA 4NMIA 1GFF2 4JVAA 3NVCA 4BLJA 4UF0A 1W99A 4XMAA 4E2SA 2D3PA 3C8XA 1S2EA 3PUIA 4JV4A 4Z2AA 2Z4FA 4XF1A 1M06G 2BDRA 1TMF3 4N43A 2Y6KA 3MBWA 3O0WA 4HANA 1G9FA 3DXUA 4CCJA 1ZRIA 1NG0A 4X8PA 2JECA 4YM1A 1GZTA 1SDWA 4YGEA 4OHVA 1LRHA 3VDDA 3KD4A 1REEA 3USUA 3THTA 2V5YA 2XJPA 1O4YA 3LEMA 1NCRA 1DBNA 3I3QA 4A2UA 4CEYB 3WG3A 2ZKLA 5DZGA 1W8NA 5HV4A 1PX4A 1JMUB 1V6KA 3JQWA 5KHKA 1O3QA 5L73A 4XURA 3DPRC 2FZ1A 5IAXA 3D3AA 4YARA 1RUD2 1UY3A 2PHDA 4QXKA 4DEQA 3QCWA 3MDPA 5LK5A 1HRI1 2WS91 5IAVA 2P34A 5C8WA 4F83A 4HVOA 4XDQA 2AACA 5A3UA 2VW2A 3OUJA 2HWE2 3AMQA 4RR3A 5JZGC 5DDJ1 2BBVA 4CXWA 2VTFA 3LSDA 4O9GA 1W0OA 1MZEA 5JXGA 1RMU3 2J7MA 1UMHA 3N9LA 1AL23 3FUQA 3O1SA 4W4ZA 2VCMA 2HWC3 1QGLA 2E7AA 1F8VA 1AL22 4FQZA 5LWBA 1CWPA 4OI1A 1SBEA 3GCXA 5JMOA 2XQRA 2HWC2 1WMEA 5KWRA 2BFUL 3SKVA 2BGCA 3LA2A 4LO5B 5K8SA 2RMU1 4V2WA 5AVAA 5KHJA 1YRZA 4QKDA 4R9AA 5CG9A 1SDDB 4MHUA 5GJ6A 1RB8G 1QJFA 4XUPA 5DG2A 1ZZ9A 2A71A 4BQ1A 2VXJA 1F5JA 3CJIA 3O14A 1AZDA 1W8WA 2CV6A 2VXRA 3MI8A 4CCNA 4L97A 3L2YA 4FPEA 5A7NA 2YBPA 2BBAA 2PLV1 3WF2A 1NCQC 3VDAA 1SLCA 4A6SA 2VD7A 3AK0A 5C5UA 3K4ZA 1UZVA 3UL2A 2YB7A 1LOCA 2IVIB 1GOHA 2VM9A 3DCQA 4PBOA 1SBDA 1YJLA 2YC4A 3KM5A 1RJ8A 4IV1C 4MGZE 2DF7A 3DYOA 1V9U1 2B39A 2C24A 4AEJA 3MFAA 4FPYA 1SZBA 5CG8A 1W6QB 1E57A 1H8VA 1HKDA 1V6LA 3AJYA 1NLSA 2LALA 2JDUA 4AQTA 2I07B 2WO3A 3OY8A 3KVAA 3IDBB 4E4SA 1AR93 2QQJA 4YVWC 5IYYA 3E97A 3KV9A 5GZFA 2VGDA 5C3RA 1ND2C 5C7GA 3H8OA 3R4UA 1ZBE1 4M3CA 1AR92 3VKNA 1OUSA 3CHXA 1SLLA 1ZA7A 1WCSA 2CDOA 2A6VA 4UBHA 1ULOA 2VW0A 2F17A 5D8AB 4NN0A 1FYUA 1AHSA 2E32A 3NNMA 4H7MA 4OUSA 4CU7A 3BPZA 1LKNA 4AG4A 1H6YA 3GZAA 3I59B 1EUUA 1Y9GA 2EXHA 4L2NA 1LEDA 3GF6A 4EV0A 4CCLA 4WM7B 3T1MA 4MGQA 3VKOA 3PNAA 3OEBA 1O7FA 1QJY3 5JI7A 3SKJE 2VO5A 2WQ4A 4CCOA 2PAMA 3OB8A 4FOVA 4CRQA 1GWMA 1QJY2 4JGYC 4DS0A 3POJA 4QXBA 4OI0A 2EVXA 3AKQA 1IPKA 1TZOA 1H2MA 2W95A 3M4FA 1RIRA 2IUWA 4B7EA 1QMJA 1WZXA 3IBMA 4N7IA 5I8TA 3ZXEA 3WUCA 4XZPA 1UY1A 2WC2A 4CCMA 5IWFA 4SLIA 1RJ7A 2KXLA 3ZFFA 5FR3A 2BNNA 2NMOA 5A32B 1GUIA 4IGPA 4IE6A 4GZ9A 1IPJA 3AP9A 2HWB1 2UWAA 3VHRA 5DAQA 4CUBA 3H8RA 4IL7A 1CONA 2NN8A 1NY71 4AEDC 2BWAA 5BNPC 2DCJA 2D3SA 1CZTA 3K75B 2JE8A 2VUCA 3PIGA 5DG1A 5J3UA 3BTYA 4BMBA 4PIYA 4BZ4A 2IXCA 3B69A 5A80A 1GQGA 2VOWA 1REDA 1ST8A 2QBXA 1T2XA 1LOFA 2DV9A 5ISLA 4AI1A 3MW3A 4MADA 2YFUA 1NUKA 2D44A 2QJVA 3CBNA 1B35B 1PVXA 1VMFA 5A33B 3I3BA 2JDPA 2WKKA 3PU3A 4I01A 4LKEA 4XYXA 3ZFGB 1BMV1 1XPWA 1FT9A 1IS3A 4CCCA 3VB9A 3AB0A 2W9XA 1A8MA 5I0TA 5IUQA 3KGLA 2B45X 5CFDC 4Q0QA 4CE8A 3A7QA 1U12A 2E53A 2W39A 4P9WA 2DCYA 2GU9A 3ABZA 3CEWA 4L9BA 1DQ2A 3A21A 3FHIB 4YNIA 2W87A 1MVQA 1RUE1 2BERA 4UFHA 5DMYA 4CPBD 3GGLA 3AP6A 5A1LA 5HCAA 1JHJA 4KBBA
chains in the Genus database with same CATH topology
1W8UA 4CP9A 4YW7A 1GWKA 2LROA 4LKEA 3ZYFA 4A6SA 4AL9A 2WYFA 1WCUA 2KR2A 4YW6A 1HN0A 4CPBA 4CP9B 4LJHA 1W8ZA 1V0AA 2C24A 1OH3A 1UOJA 1L7LA 2K46A 5D21A 4BQ5A 2JWPA 1W9FA 3UT0A 3ZYHA 4LKFA 2LRPA 4LK7A 1OKOA 4BQ2A 1W90A 2Q1FA 3ZYBA 1GWMA 1WMXA 2VXJA 4LKDA 4BQ3A 2O14A 3ORJA 4LK6A 1GWLA 4CPBD 4BQ4A 4YWAA 1W8WA 1W8TA 1WZXA 3F95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8U A;  4CP9 A;  4YW7 A;  1GWK A;  2LRO A;  4LKE A;  3ZYF A;  4A6S A;  4AL9 A;  2WYF A;  1WCU A;  2KR2 A;  4YW6 A;  1HN0 A;  4CPB A;  4CP9 B;  4LJH A;  1W8Z A;  1V0A A;  2C24 A;  1OH3 A;  1UOJ A;  1L7L A;  2K46 A;  5D21 A;  4BQ5 A;  2JWP A;  1W9F A;  3UT0 A;  3ZYH A;  4LKF A;  2LRP A;  4LK7 A;  1OKO A;  4BQ2 A;  1W90 A;  2Q1F A;  3ZYB A;  1GWM A;  1WMX A;  2VXJ A;  4LKD A;  4BQ3 A;  2O14 A;  3ORJ A;  4LK6 A;  1GWL A;  4CPB D;  4BQ4 A;  4YWA A;  1W8W A;  1W8T A;  1WZX A;  3F95 A; 
#chains in the Genus database with same CATH topology
 1W8F A;  2FDK A;  1CJP A;  1H9W A;  1DGR N;  1YFW A;  2P17 A;  2WZR 3;  4Q8K A;  2DFB A;  3VBO B;  3S57 A;  2Q1Z B;  5LRR A;  2D5F A;  2WYF A;  1WCU A;  2VUJ A;  1J83 A;  3C7G A;  4LEJ A;  4RYD A;  1W6P A;  2WZR 2;  4P00 B;  5HXM A;  5A33 A;  1UU4 A;  2CU5 A;  1VP6 A;  2WZ8 A;  1QH6 A;  2ARX A;  5F9T A;  4CUG A;  3VGI A;  2RDS A;  2IXL A;  2W94 A;  2XG3 A;  1D4V B;  3G6J B;  2ZEW A;  4RGG A;  3RZZ A;  5K7P A;  1JOD A;  2H0B A;  2XR4 A;  1LCL A;  5FYZ A;  3LSE A;  3R05 A;  2ATF A;  2ILM A;  1WMX A;  1JYX A;  1FPN 3;  2CYF A;  4KBZ A;  4AGV A;  1RXF A;  3OGS A;  1GNZ A;  1FPN 2;  3SHR A;  5ACA 1;  1CAV B;  5L7O A;  3T2O A;  1HRI 2;  2WS9 2;  1F15 A;  3POB A;  3WP3 A;  3AFK A;  4CDW B;  1EV1 3;  1H2K A;  4Q4W 1;  5FY7 A;  1GP4 A;  3WUD A;  5DDJ 2;  1Q56 A;  1SAC A;  1NA1 A;  2JG8 B;  2ZS6 B;  3HD8 B;  4TXW A;  4JTN A;  5DQ0 A;  4MG2 A;  4BB3 A;  1Y9M A;  2DVG A;  3ZDV A;  1ALY A;  2VAU A;  2GC3 A;  4AHY A;  2WNV B;  4WVM A;  2TUN A;  1LHN A;  3IDA A;  3UES A;  3GZU C;  4XFI A;  2QDR A;  4IEZ A;  3JU9 A;  3W9A A;  3AKS A;  1YNA A;  4JKM A;  1RXG A;  2RMU 3;  3KT1 A;  5T3N A;  2BVV A;  1Q5O A;  4XUT A;  4NRQ A;  4XIO A;  3D4K A;  3T08 A;  5IJR A;  3BTZ A;  1UNB A;  1GYK A;  1AYN 3;  2RMU 2;  3FHA A;  4LHK A;  2XQX A;  4JQR A;  4FP3 A;  2R04 3;  4LBL A;  3QD6 A;  2FDJ A;  5J09 A;  1AYN 2;  1NQD A;  1N1T A;  2X5I B;  3AVR A;  4MUV A;  2R04 2;  1RVF 3;  2WT1 A;  4AL9 A;  5FZF A;  1WW6 A;  3IDE A;  1OSG A;  2JG9 B;  4FI9 A;  2WUH A;  2B7Y A;  4GIQ A;  2VW1 A;  4XXA A;  3GZT B;  4GH4 B;  4YGB A;  1LU1 A;  1RUF 3;  3B9I A;  5C9A A;  1C4R A;  4DXS A;  1FMD 1;  2P3J A;  2PLV 2;  4YVS C;  1AVB A;  3H3L A;  4HPK B;  5C5T A;  4QKN A;  5FLH A;  3H1W A;  4Y1X A;  1OLM A;  1G8W A;  3LEK A;  4JHZ A;  4XF4 A;  4NHM A;  1W6M A;  2VZ1 A;  5E6H A;  4HOO A;  1V9U 2;  4AQS A;  4NWV A;  4ES9 A;  1LEC A;  3BU0 A;  1LUL A;  1WMD A;  1YQC A;  2G9G A;  1W0N A;  2Y6G A;  3GDB A;  2D93 A;  1TE1 B;  1L7Q A;  1S0J A;  1U0A A;  1AXY A;  1ENQ A;  1W6N B;  4K9S A;  5B2G B;  5JIU A;  1XYN A;  1VAM A;  5EIY B;  1W9T A;  2RR1 3;  2VVD A;  5I8Y A;  5F3C A;  4MVT A;  4BQX A;  2Q4S A;  3M70 A;  3ZYB A;  4K8R B;  1K5J A;  5EJ3 A;  5LEJ A;  3CL1 A;  4LBJ A;  3C7H A;  4K8F A;  4QX0 A;  5JOZ A;  4FPC A;  3LGR A;  5CA6 A;  5J37 A;  2ZGU A;  1UU5 A;  2EXI A;  2BFU S;  3KGZ A;  4OHX A;  1SG3 A;  4XEZ A;  5DUW A;  1UYZ A;  4CU9 A;  2EIE A;  1PGL 1;  4XFB A;  3WV6 A;  5LAS A;  5A3T A;  2JDM A;  5BNO B;  1OXC A;  2VZS A;  4LT5 A;  1SPP B;  4HLT A;  3WNP A;  2GNM A;  2WRA A;  1ZM1 A;  3DYM A;  4XUO A;  2WZP P;  4IEP A;  3ETP A;  3DPR A;  4AVV A;  4ZXK A;  1O8S A;  2HWF 1;  2B9U A;  2VG9 A;  3KLS A;  5FK8 A;  3KCY A;  4QGM A;  4P5H A;  1AYM 3;  2R1D A;  3AP7 A;  4Z07 A;  2JB4 A;  1MS9 A;  5JOX A;  2XL7 A;  2PHL A;  4IQP A;  3VHO A;  3WNN A;  3Q8A A;  5JZG A;  4N90 A;  1QIQ A;  3PUH A;  4FQ4 A;  3MIE A;  2DUO A;  4NPM A;  3TWI A;  4TTG A;  4FTS A;  1Y3T A;  4JGZ B;  1FI2 A;  1GWK A;  4WM8 B;  5IVB A;  2WN3 A;  5KC5 A;  4M3C F;  3DUI A;  4QDS A;  5FYT A;  2CNA A;  2ZZJ A;  1ZBA 1;  1O5U A;  1W2N A;  2ZGQ A;  3MYX A;  3TN9 1;  4P9X A;  4YGC A;  2E7Q A;  4UF0 B;  2DVA A;  3ZYI B;  1YJK A;  2UYA A;  2B8M A;  2XJQ A;  5GLU A;  4YYO A;  2H6C A;  4YG6 A;  3WF3 A;  3I2F A;  1RUC 1;  4N43 B;  2YPD A;  2C26 A;  4UOJ A;  3MID A;  3QLQ A;  1WLT A;  2BRT A;  4OFG A;  4SBV A;  4O9E A;  5IVE A;  1LHW A;  5A7S A;  3LAG A;  2UY9 A;  2HEV F;  2YG0 A;  2VQ0 A;  2YHJ A;  1YXW A;  5DN2 A;  3ZIW A;  1J59 A;  4ZZ8 A;  3USU B;  2GC1 A;  1RC6 A;  3A22 A;  1NCR B;  1SHW B;  2ZGO A;  3LA7 A;  1O3T A;  3NKG A;  1LOE A;  3AMN A;  3AMP A;  1Q8Q A;  3J7H A;  4YW5 A;  1V6M A;  1NCQ A;  3HJR A;  4QWN A;  1RUE 3;  4Y5Z 0;  2W1S A;  3MIC A;  2QTW B;  4Q4Y 1;  4YFW A;  3J7M A;  4CUC A;  4YZ5 A;  1RUE 2;  1WW4 A;  3MFC A;  2QZ3 A;  2JDH A;  4N53 C;  4TSV A;  5LAT A;  4IV1 A;  2H6B A;  4FAG A;  1Y7B A;  1BKZ A;  4PBP A;  1AXZ A;  1GOG A;  2XJU A;  2RS1 1;  3ZYH A;  4DY3 A;  5J96 B;  4JRA A;  1POV 0;  1GSL A;  3E5X A;  4QPI C;  3N9M A;  2VBP A;  5KHI A;  4U2A A;  4RR3 B;  4M01 A;  4TLF A;  4YVW A;  4Y1U A;  1ND2 A;  2VC9 A;  2Y6J A;  1OMI A;  3AZZ A;  3C3V A;  2NP0 A;  3N9N A;  4CP2 A;  3WT3 A;  1Q43 A;  2ZGP A;  2OVU A;  4FPK A;  1WMF A;  1N1V A;  2I45 A;  2P1B A;  3OPT A;  5JOW A;  5CNA A;  3VBH C;  4A42 A;  1VAL A;  3BPS A;  4YGD A;  5FOJ B;  5FPX A;  2RDQ A;  1VBC 1;  1G9C A;  3H7Y A;  1ZRF A;  2FZ2 A;  5ACA 2;  5CVR A;  5JIA A;  1J1T A;  1AXK A;  1W2A X;  2PHR A;  4CEW C;  1XSR A;  3I2K A;  1JOP A;  1SLI A;  4Q4W 2;  1E5H A;  4LKD A;  1GNY A;  2V73 A;  3U4X A;  4LLO A;  1ENX A;  2DUP A;  1Y43 B;  4JGY A;  2I74 A;  4MGY E;  3OUI A;  1R09 3;  4GD4 A;  1VR3 A;  2XVG A;  1TMF 1;  3WDX A;  3H0O A;  2QQO A;  4Q1P A;  2RM2 3;  3D0S A;  4FFH A;  5EJZ B;  1R09 2;  1STM A;  2O8Q A;  2FBE A;  3W59 A;  1BQP A;  4Q4X 3;  2QQK A;  1K5M C;  4NRM A;  1X82 A;  2CL2 A;  3HNB M;  3UKN A;  3VD5 A;  2Q5T A;  3MV1 1;  5I0R A;  1H1M A;  3ZIX A;  1PM7 A;  1W05 A;  1GQP A;  4AFA A;  1MEC 3;  2ZX1 A;  4LKS A;  1J3R A;  2BOI A;  4AED A;  2J22 A;  3ES4 A;  3MW2 A;  2WNU C;  4GA9 A;  4IET A;  4L99 A;  3UGG A;  4B7K A;  5BNP A;  3LCP A;  3THC A;  3ZPY A;  3V0B A;  4FXK B;  2QQM A;  4IEW A;  5HCF A;  1I6X A;  2JIG A;  3OY8 B;  4B4R A;  5FYU A;  4OHW A;  3CKH A;  3RI9 A;  4C91 A;  5HPO A;  3OJB A;  3VBF C;  5A70 A;  2IFR A;  5JPN B;  4M3C B;  1ZRD A;  4QQO A;  2KA3 A;  4FPF A;  4OI2 A;  3WDV A;  1WA4 A;  5J36 A;  2VR4 A;  5A7W B;  2VQA A;  3PVN A;  1SFN A;  3SNM A;  4FT8 A;  4LJH A;  5CU1 A;  1RMU 1;  5GZE A;  1AX2 A;  1YFU A;  2WFF 3;  5GZD A;  5LZ6 A;  2HBU A;  2OXB A;  3BIW E;  5BNN C;  1EAH 1;  1AL2 1;  1I5P A;  2ZAA A;  3OBA A;  1G9A A;  2WFF 2;  2DYC A;  3POS A;  4DIN B;  1VIW B;  3ZYP A;  5CFD A;  1LHU A;  5KBF A;  2UY8 A;  4J6G A;  1HLC A;  2AR6 A;  2JDA A;  4P9Y A;  2MNG A;  4LE4 A;  3TNP B;  4OZX A;  5FPU A;  3FFQ A;  3TEX A;  4LUM A;  1JOB A;  4BM8 A;  4XZU G;  2ARA A;  4D6R A;  5A1F A;  1TME 1;  1CQ9 A;  3LZZ A;  1ULC A;  3OYW A;  5L36 A;  4FTB A;  1DIW A;  4NWW A;  4FPJ A;  2CWM A;  1DQ5 A;  3DV8 A;  1JXN A;  1V6J A;  2VU9 A;  3LPG A;  4YG3 A;  3ZMO A;  1A3K A;  2DVB A;  1R1Z A;  1UU6 A;  3GBF A;  4ISR A;  5JR7 B;  5K0U C;  4XTP A;  2XLG A;  3S30 A;  3ZFF B;  4CYD A;  1IQA A;  3E5Q A;  2O8O A;  4AR2 A;  4QHO A;  3HQU A;  2RS3 1;  4JCK A;  3M3E A;  4AFC A;  4ET7 A;  3TAY A;  2D97 A;  1PGL 2;  1NZC A;  2Q1F A;  3LDR A;  4D7S A;  2D43 A;  5FCC A;  1MVE A;  1OA3 A;  3NJX A;  4OLL A;  4PF5 A;  4E4Z A;  4EQV A;  1LOG A;  1W2U A;  2VQU A;  2E31 A;  1DU3 D;  2GP5 A;  2QQP A;  4HT1 T;  5FUN A;  2RJK A;  3F95 A;  1G9B A;  2QDN A;  2O0O A;  2RDR A;  3IAP A;  4QPG B;  4UAP A;  4ZKT B;  3TNQ A;  1PK6 B;  4MGI E;  3RGB A;  5C33 A;  3B9C A;  5TSW A;  3OEA A;  2W1W A;  3IMM A;  4IES A;  2GNT A;  2QE3 A;  2OT7 A;  5KHG A;  3RMY A;  3OCP A;  2BWC A;  3J8F 1;  1HRV 3;  2XJT A;  4HBN A;  3ACF A;  1DP0 A;  5H9Q A;  2A70 A;  2VUD A;  4FBF A;  3AXE A;  1HRV 2;  4XHX A;  3ILN A;  1CR7 A;  4XQW A;  3GAL A;  1WLW A;  4IEU A;  3AYA A;  2VBB A;  5CKN A;  3P6B A;  3SQO A;  2O14 A;  3TN9 3;  4Y1Y A;  1UW8 A;  3POE A;  1AR6 3;  2XUE A;  4FPG A;  4A7Z A;  1ZBA 2;  3AFG A;  3BB6 A;  3TN9 2;  4CDX C;  1DZR A;  3BVC A;  5F8P A;  4A44 A;  2VZP A;  3ROU A;  1CD3 G;  1FOD 1;  3HN3 A;  2Q8E A;  1AR6 2;  4YW7 A;  5FZ9 A;  1G86 A;  2C9A A;  4Z1V A;  1HV0 A;  4M4P A;  4LO8 A;  1COV 3;  1RUC 2;  3RRD A;  2ZA9 A;  3KF5 A;  3VD3 A;  1KS4 A;  3I2I A;  1W6P B;  1IS5 A;  1X9T A;  1NOV A;  3PTR B;  1M4W A;  1OA2 A;  2W91 A;  3ZR5 A;  4DZG A;  1DCS A;  2VNG A;  3ZO0 B;  2LRP A;  2F4P A;  3EBR A;  3ALQ A;  1HXS 3;  3FE5 A;  1ZX5 A;  3K3N A;  3I7D A;  3L2H A;  3BTA A;  4IV3 C;  1ZNP A;  4ORF A;  4XBL A;  5HXV A;  4CZS A;  5FO8 B;  1MQT C;  2X53 S;  3J7L A;  2OW4 A;  3LFM A;  4S2H A;  4YVS A;  1PGW 1;  4QX3 A;  3AYD A;  1FV2 A;  4NUB A;  4C90 A;  4Z2W A;  2ZJC A;  4EE2 A;  2WZE A;  4Q0U A;  2JX9 A;  1S55 A;  4HL0 A;  4Q4Y 2;  4XJ8 A;  1JYW A;  2DVF A;  3CIH A;  3BTX A;  1W3V A;  3LF7 A;  5FWE A;  4YRD A;  5FZD A;  2KM2 A;  1Y9Q A;  1FAT A;  4OHZ A;  5DUU A;  5JUV A;  1QQP 3;  3WVJ A;  2R07 3;  5L7O B;  5FPV A;  4Y26 A;  3OF1 A;  1MZ5 A;  5I91 A;  2WAA A;  4W65 A;  5FZA A;  5JAX A;  2R07 2;  2VMD A;  1NA1 B;  4A3X A;  4P02 B;  5FBJ A;  5CKM A;  3RS6 A;  1OA4 A;  4XOG A;  3G7D A;  4N9H A;  1HB3 A;  3UT0 A;  4ARX A;  4Y5S A;  4EYU A;  3ZDS A;  2DU1 A;  2A3W A;  2ZMK A;  4WVM B;  4RSU A;  2WIN B;  2DBN A;  1EUT A;  1VBC 3;  5F5Q A;  3OBR A;  3MIF A;  2A3Y A;  3GCW A;  1VBC 2;  2CGN A;  2BUK A;  2P6C A;  3PIJ A;  3DXT A;  3CU7 A;  4RD7 A;  5FZ7 A;  1DGR A;  3E6D A;  3MIH A;  3UKV A;  1V00 A;  1VPH A;  5LEK A;  1W9W A;  4UI9 L;  2UU8 A;  5EXO A;  1MZ6 A;  3IMN A;  1RIT A;  2CY6 A;  4ZU7 A;  5IHR A;  1CZS A;  1UXZ A;  2PA7 A;  1YEW A;  2PAE A;  1IHM A;  1LNS A;  1ULE A;  5FAX A;  3V56 A;  2TBV A;  2Q8D A;  5KXD A;  3K4A A;  3H3U A;  1OUX A;  1KXG A;  4AZZ A;  3AYC A;  4MX3 A;  3C7E A;  5IK4 A;  1O8P A;  4F3J A;  1TMF 2;  4R8H A;  5FPZ A;  4KWJ A;  2ZHM A;  2RV9 A;  2YRO A;  1UYY A;  2WZR 1;  2ZX0 A;  2YC2 A;  2JJ6 A;  1X8E A;  2P3K A;  1S4C A;  3D0J A;  5K4L A;  2Q0A A;  1WBF A;  1EYB A;  4PLN A;  3U11 A;  4W6X A;  4FTE A;  1UQX A;  4XFC A;  4BA6 A;  5FQ0 A;  2FMY A;  1WWY A;  3IB3 A;  3IKW A;  4H55 A;  2JE7 A;  2DCK A;  1RL3 A;  1W6M B;  3KCC A;  4LBK A;  5F37 A;  4QGN A;  1ND3 C;  2ARC A;  1UX7 A;  2Y0O A;  4X8N A;  3WNL A;  3NKT A;  4OUL A;  4K20 A;  2Y34 A;  3FLR A;  4MET A;  3GYD A;  1IQD C;  3PVE A;  1FPN 1;  5E8A A;  3O1O A;  4QQH A;  2JWP A;  4D7T A;  3RQ0 A;  1W8H A;  2VZU A;  3WQ1 A;  5JCT A;  4MZU A;  5C4W C;  2A3X A;  5LA0 A;  5BPX A;  2Z5W A;  3O0X A;  1EV1 1;  4G3Y C;  4L11 A;  2A75 A;  3MW4 A;  2WWS A;  2BZD A;  3ST7 A;  1CAX A;  4U36 A;  3H50 A;  1XB9 A;  4QPY A;  1OVP A;  1EAH 3;  1V0A A;  1RMU 2;  2GN3 A;  2GZW A;  4HON A;  5I0U A;  5A3M A;  1RUO A;  4E8D A;  1EAH 2;  2ORZ A;  3T3Y A;  2ZX3 A;  1UKG A;  3SH4 A;  4Z92 B;  5HV0 A;  4W50 A;  5FYM A;  1JHN A;  3NMB A;  4OQ9 A;  4AFD A;  5BNQ A;  4XFG A;  1DDL A;  5KXC A;  1TME 3;  2IC1 A;  1REF A;  4N7U A;  2P2K A;  4B29 A;  2WYS A;  1AYN 1;  2W3J A;  2BNO A;  1TME 2;  4RA0 A;  2PEL A;  2R04 1;  4N53 A;  1G6N A;  1OKO A;  3DPR B;  4E9K A;  1HQL A;  3O1P A;  2PHU A;  1RGS A;  4IW3 A;  1RVF 1;  1W9Y A;  4K21 A;  4A41 A;  4XJU A;  4PIX A;  1MS8 A;  1N47 A;  4QPI A;  2UUR A;  3WQ7 A;  5L19 A;  3FL7 A;  2XVL A;  4LNV A;  4HVQ A;  5FZH A;  5JZG B;  2RS3 3;  2CTV A;  1S0F A;  2VZO A;  1CVN A;  5FP3 A;  4XW3 A;  1RUF 1;  2RS3 2;  3JXS A;  1QU0 A;  4QD2 A;  5FXW A;  5KR7 A;  3JZV A;  4CP1 A;  2PHX A;  1OFS A;  4MLO A;  3MLK A;  2XHN A;  4ZXE A;  3ZOI A;  2ZAC A;  1UOB A;  3VBH A;  5FP9 A;  1DYP A;  4W6W A;  5C8C B;  3HBZ A;  4HG6 B;  4A7Y A;  5C3S A;  4RHV 1;  3DF0 A;  5GLV A;  4DOU A;  3M2M A;  4BQ2 A;  2GAU A;  1PNF A;  1S0C A;  2XLF A;  3O1T A;  1OLR A;  4GWJ A;  2HWD 3;  4CEW A;  1W9S A;  3J8F 3;  4LK6 A;  1XJA A;  1V6I A;  1JZ8 A;  2HWD 2;  3IT8 A;  4WM7 C;  4MGT A;  3J8F 2;  3WDW A;  3T0A A;  2ID4 A;  2LRO A;  1CAU A;  3VD9 A;  2RR1 1;  4PQQ A;  3ZSE A;  5FXV A;  4XDO A;  1C8M 3;  2RHP A;  2VQT A;  2XB6 C;  3LOI A;  5H9P A;  3WZ1 A;  3KSC A;  4DMI A;  3S0M A;  1WKY A;  1K5M A;  1VB2 A;  1FOD 3;  2XGX A;  2EAA A;  3THD A;  3WG1 A;  1URX A;  3ZLI A;  3UK9 A;  2OS2 A;  2EAL A;  1FOD 2;  1VLN A;  5KHH A;  4FFI A;  5HBA A;  1ACC A;  2W5F A;  4W8J A;  2Y38 A;  3B3Q E;  2WNU A;  1QNW A;  3FFZ A;  4AK3 A;  1GWL A;  2CWS A;  4KL1 A;  2PFW A;  4PT6 A;  4UFJ A;  4NE9 A;  1L7R A;  4AVA A;  3JUU A;  4XXP A;  4HKL A;  4UFI A;  4YVW B;  1R08 3;  1W04 A;  1RUJ 3;  3R4S A;  3VBF A;  1AYM 1;  1D4M 1;  2EIB A;  1VB4 A;  5HI0 A;  4DIQ A;  5IVJ A;  2GP3 A;  3M3C A;  4OVE A;  1MS0 A;  1J58 A;  4ISQ A;  4UW6 A;  1PGW 2;  4C8D A;  4CXX A;  1KDK A;  2PTM A;  4Q0S A;  5D21 A;  1J3P A;  4URA A;  1OQ1 A;  1YFY A;  2V5D A;  2VMC A;  3POY A;  2HH9 A;  4NVP A;  5AVP A;  1POV 3;  1KRI A;  1JU4 A;  5BNN A;  2G9F A;  5AC9 3;  3H8U A;  2WO1 A;  2WBK A;  2Y60 A;  1JZ5 A;  2QQL A;  4XC9 A;  3WY6 A;  2MEV 3;  1A78 A;  1OUR A;  2D6K A;  3LEI A;  1LU2 A;  3KV5 A;  5GZG A;  2MEV 2;  1CX1 A;  2Z69 A;  4JGY B;  4BLI A;  5JVV A;  4EN0 A;  1ZVF A;  1KFU L;  2J1E A;  3FWE A;  1QHD A;  5FDB A;  3WF4 A;  2WA3 A;  4JC1 A;  3NAP C;  3WOG A;  4DUX A;  1F2N A;  1PO1 3;  1MZF A;  4CCD A;  4RFT 0;  3D6E A;  4MGS A;  2XBO 3;  5FZB A;  4QDQ A;  1JUH A;  4UW3 A;  1PMI A;  3SH3 A;  1YC6 1;  5K0U A;  3ZXL A;  2XBO 2;  2XXZ A;  1YQ2 A;  1SEF A;  3Q8F A;  5FFO C;  2YU2 A;  3U07 A;  1LGB A;  1O91 A;  3APB A;  1ENR A;  1R1A 3;  1Q8V A;  1LAJ A;  2D6P A;  4DUV A;  4RGA A;  4AED B;  5LBB A;  3V0B B;  1C1F A;  5BNP B;  1HJF A;  2C4X A;  4IGO A;  2BEO A;  4PDW C;  5T5P A;  3J9S A;  3AZW A;  1DG6 A;  1HJG A;  3HVD A;  1YO8 A;  4R9C A;  2G9Z A;  3LQC A;  2VZR A;  4LIV A;  1JZ6 A;  1IKQ A;  4AVS A;  4AGR A;  1KEX A;  4PCR A;  1OLQ A;  3IIA A;  3HQX A;  4JDN A;  5A3L A;  3WLU A;  2W52 A;  3DGT A;  1O3S A;  5T5L A;  3THP A;  2A1X A;  3V65 A;  2YDE A;  1PHM A;  3ZXF A;  3AP5 A;  5LA2 A;  3B94 A;  3ZKU A;  4Q4V 3;  4BOW A;  3WNM A;  4D69 A;  2X29 A;  4LPL A;  2A6X A;  3S7E A;  1XNC A;  1ZRC A;  1JYV A;  1ZA4 A;  1BXH A;  2WSU A;  3KS7 A;  5CZK A;  5A3O A;  4GQ7 A;  5CB7 A;  3E1F 1;  2LUW A;  1UMI A;  3INA A;  3A0N A;  4NAO A;  5FRE A;  2BPA 2;  2NM1 A;  3NNJ A;  3PU8 A;  4CDX A;  2D3R A;  1SFP A;  4UW4 A;  2NPI A;  4YM0 A;  4JTO A;  2NYY A;  4NRO A;  1X36 A;  1EV1 2;  5ANQ A;  2A6Y A;  1OOP B;  2Y64 A;  1D2S A;  1UWW A;  3GXU A;  1W8O A;  1RHI 3;  1ZZ8 A;  1DQ1 A;  1NLR A;  1VBE 1;  5FKC A;  1HIX A;  4OUM A;  4ITC A;  4PJY A;  4Y22 A;  4CDQ C;  1QJE A;  1O59 A;  1R09 1;  4AFM A;  2X5I C;  5FZG A;  3VBU C;  1Q8S A;  4MXW A;  2RM2 1;  1YQ8 A;  5EHD A;  3EXU A;  4BWO A;  3SEP A;  3PJY A;  2RJL A;  4IV3 A;  4Q4X 1;  1AX0 A;  3FUO A;  1W0P A;  1MQT A;  1Y4W A;  1RTV A;  3I2G A;  5GLT A;  2GC0 A;  1C28 A;  2D6O X;  2E51 A;  2WR9 A;  3RZK A;  1ZZ7 A;  4LUK A;  1O4Z A;  2LM3 A;  3UV9 A;  3OOX A;  1ONA A;  1MEC 1;  2WLQ A;  5FZ3 A;  3UYJ A;  5DZE A;  2PQS A;  4UFK A;  3CZJ A;  4XAB A;  2ZAB A;  4G9S B;  4LLF A;  2R32 A;  3ZYG A;  1RVF 2;  1YLL A;  3SXW A;  1XRU A;  4QX2 A;  4AW7 A;  4ZZ5 A;  2ZX2 A;  2ZHK A;  1OC1 A;  4MYE A;  4KWU A;  2WO7 A;  3OGR A;  4UWD A;  3NNL A;  5FP7 A;  4ONU A;  2YMZ A;  3OGG A;  2D6M A;  4AVC A;  3WW1 A;  5FYI A;  1RUF 2;  1HW5 A;  3H42 B;  3ZXG A;  1LOD A;  4GAL A;  1PZ9 A;  4EN9 B;  2XLA A;  4FFG A;  3CJX A;  4IGQ A;  2VOK A;  2X10 A;  3EHK A;  4P9G A;  4RHV 3;  2EF6 A;  1JS9 A;  3T4V A;  2WFF 1;  5A6Z A;  2JIC A;  4AHZ A;  4E2Q A;  5A6Y A;  2ADD A;  3NQH A;  1S2K A;  3OBT A;  2WWJ A;  2LS6 A;  4RHV 2;  1D2Q A;  2W92 A;  4CP0 A;  3DL3 A;  4GKX A;  2VTX A;  2UWB A;  3ZPO A;  4Q29 A;  1UD1 A;  1I3H A;  3DKW A;  5CAZ A;  2HEY F;  3MUZ 1;  4LBN A;  3VBR C;  4K1Y A;  2ZGL A;  3VDC A;  3DEC A;  1GP5 A;  4GKY A;  2YBS A;  2RDN A;  3KQ4 B;  5BNO C;  3ETQ A;  3SEE A;  4EN7 B;  1APN A;  2RR1 2;  4XAE A;  5JR2 A;  5I0S A;  2ZAH A;  4IEO A;  3WQ0 A;  3WW2 A;  5I8S A;  2JD9 A;  5F2W A;  2GMP A;  2FDG A;  4QX5 A;  4UBG A;  2DU0 A;  4XIL A;  2NMN A;  3F2Z A;  1RUI 1;  1H4G A;  3VKL A;  2XJR A;  1KQR A;  3U1X A;  4E2G A;  5CFC B;  1ULF A;  2R0F A;  2RS5 1;  4GMP 0;  2Y33 A;  1ULD A;  1J84 A;  1ND3 A;  2IWG B;  4CA9 A;  5IVV A;  1NE4 A;  3B02 A;  4A45 A;  4YPJ A;  4ZU4 A;  1GR3 A;  2Q8C A;  3SCH A;  1BLZ A;  5FMO L;  4PF1 A;  2W08 A;  5FO7 B;  1D4M 3;  3FZ3 A;  5D2A A;  4MV2 A;  1JUI A;  4AVT A;  5JSP A;  1QJX 1;  1LGN A;  4IDZ A;  1VMH A;  4PI2 A;  2X09 A;  3N7J A;  5C4W A;  1AYM 2;  1D4M 2;  2FDI A;  5FWJ A;  1JZ3 A;  3LIG A;  1DGW A;  2HKX A;  3AMM A;  2QZ2 A;  4YWA A;  1C5I A;  4HKW A;  3CMG A;  1HRV 1;  2PXJ A;  3WXP A;  3V0A A;  1GKB A;  3ZXA C;  4A6O A;  1IPS A;  3ES1 A;  2BGP A;  4YW4 A;  5LBC A;  2WN2 A;  2G1M A;  1U5Z A;  5E89 A;  5FUI A;  4NHK A;  2YUE A;  3HOB A;  5T54 A;  3VN4 A;  1K45 A;  2VCC A;  5DAV A;  1K42 A;  5G04 L;  2JEM A;  1AR6 1;  1GIC A;  4KWK A;  3BN6 A;  2BV4 A;  5FK7 A;  4JQT A;  4EZH A;  2A73 B;  4D6Q A;  1JBC A;  1EP0 A;  1MS1 A;  1SBF A;  5IVY A;  3SCF A;  1UY4 A;  1SLT A;  5C70 A;  2QQU A;  3RWN A;  3PMS A;  3JB4 C;  4R52 A;  1HX6 A;  1O5L A;  1Q3E A;  1DQ0 A;  1F4A A;  3MV0 1;  3U37 A;  1F35 A;  1COV 1;  2XDV A;  3QAC A;  4DQA A;  3JCI A;  3SH5 A;  3DYP A;  1NXM A;  4C1W A;  3VDD B;  2W46 A;  4MH0 E;  3ZMN A;  1P8J A;  4BE3 A;  5JMC A;  2FD8 A;  5FYY A;  5FQ0 B;  4CDU C;  1O4T A;  4LA2 A;  3NO8 A;  4LIT A;  1W6Q A;  3ASI A;  1QDC A;  1YI9 A;  4FOY A;  4FVV A;  1HXS 1;  3S6P A;  5FPA A;  4XDP A;  4N8M A;  3SCG A;  1FNZ A;  5A6X A;  4E8C A;  1WD3 A;  3EJK A;  4UFM A;  2ARB A;  1HV1 A;  4BME A;  4NID A;  5H9R A;  5IFP A;  5LY2 A;  5JSO A;  4LHS A;  1UZ0 A;  1DQ4 A;  3VL9 A;  1ULP A;  2AEN A;  3J26 N;  2R30 A;  3J7N A;  4LHN A;  2DVD A;  2Y6L A;  3W20 A;  3GBG A;  2WAO A;  5HCB A;  2GH8 A;  2ZHL A;  3VZK A;  1IOA A;  1UXX X;  2XOM A;  4KG0 A;  4P08 A;  4R4Z A;  5DZF A;  1QQP 1;  3I3M A;  2R07 1;  3HR9 A;  4HMZ A;  3KWV A;  1NLQ A;  4L8Q A;  4COV A;  3BI3 A;  5B4X A;  5AFE A;  4DPN A;  3M8L A;  3U0Z A;  5F39 A;  2CDP A;  1CAX B;  4WM7 A;  1H8T C;  1QJU 3;  3HNM A;  3NV3 A;  3NV4 A;  3S7I A;  3WCR A;  1S2B A;  4V1P A;  4I3G A;  1DLL A;  4XBQ A;  1QJU 2;  5FLJ A;  4NO4 A;  4AAP A;  3M3I A;  2FDF A;  4AEM A;  1G7Y A;  1PM4 A;  3BOW A;  3PVB B;  4RS5 C;  3PUQ A;  5FXX A;  1ZZ6 A;  3WG2 A;  4UFL A;  3RPQ A;  2VVE A;  3MLL A;  4AVB A;  1XE0 A;  1WW7 A;  1E5S A;  1XE8 A;  1F5F A;  4NRP A;  1QJZ A;  1BBT 3;  4LO4 B;  5KXE A;  1F4H A;  3AZV A;  4Q5O A;  2FMD A;  5F6L B;  5GLZ A;  4X6R B;  2OPK A;  4N53 B;  1VBE 3;  3ZFE C;  3VUO A;  3AMH A;  2BU9 A;  3CO2 A;  1C57 A;  3KCX A;  2A6W A;  2HJI A;  1A8D A;  3CJI B;  1VBE 2;  4LA3 A;  1Z7S 3;  2D7F A;  4CP9 A;  3PJQ A;  1UOG A;  1UIJ A;  3ZXK A;  1GV9 A;  1D0H A;  2ZEY A;  1Z7S 2;  2AC1 A;  1H0B A;  2J1S A;  2RM2 2;  1XNT A;  1NKG A;  3I3D A;  4P14 A;  4Y4R A;  4LBO A;  4M00 A;  1I5Z A;  1VMJ A;  4I0A A;  1I1E A;  2P6H A;  3WG4 A;  1VBD 3;  2JDK A;  3NNF A;  4Q4X 2;  4TZD A;  3BIE A;  1KDM A;  1PO2 3;  4C1X A;  3OTF A;  4LIU A;  3O1V A;  1ZRE A;  5FO9 B;  5A3N A;  1FNY A;  1HQW A;  2RE9 A;  5F1R A;  4F7Z A;  2E6V A;  1YWK A;  4E4H A;  2OPW A;  1PIV 3;  1MEC 2;  2HEW F;  1O3R A;  3MZH A;  3A0K A;  5J48 A;  2YYO A;  5FOB B;  3OSD A;  1K12 A;  4ZS2 A;  3RYK A;  1OH4 A;  1OFN A;  1PIV 2;  3O1M A;  4QGL A;  2WII B;  3U78 A;  4CEW B;  3I3E A;  1QDO A;  2VNR A;  4GB3 3;  3JD7 1;  1LTE A;  1RUG 1;  1GNH A;  3NV1 A;  5F6K A;  3BUC A;  2V4A A;  3WDT A;  2BGO A;  5BY5 A;  1D7P M;  3K46 A;  5F5C A;  1QNY A;  3VBS C;  3NAP A;  5BXX A;  2YPJ A;  2B4K A;  1AJK A;  4OZO A;  4C0H A;  3WIN E;  4COW A;  1WLC A;  4URT A;  2JDZ A;  3WHU A;  2ZX4 A;  3LKJ A;  4QM9 A;  4NIG A;  2CGP A;  1HN1 A;  1K5M B;  1VRH 3;  1F31 A;  1XYO A;  2GNB A;  2YFZ A;  4ZHN A;  1Q8P A;  1W28 A;  4WZC A;  1YQ5 A;  2VL4 A;  3ZFF C;  3ZYR A;  5IK7 A;  2ZGK A;  4CUA A;  1OQE A;  4XCB A;  3VD4 A;  2C5D A;  1E5I A;  2SBA A;  4PDW A;  1NYW A;  1X7N A;  3RDI A;  4NAM A;  2IXK A;  4AQ2 A;  3USS A;  4XAA A;  3VBF B;  4YZ3 A;  4P9J A;  4EN6 B;  3H3Z A;  3D82 A;  4Z82 A;  1FV3 A;  5F3E A;  4AI8 A;  4OHY A;  1WGP A;  1RUI 3;  1XND A;  1US3 A;  1BCX A;  4QPG C;  4DB5 A;  1PK6 C;  2RS5 3;  3N9O A;  4S2D A;  5DAX A;  1RUI 2;  3HAG A;  2FDH A;  3ZSJ A;  2GAL A;  2JE9 A;  2RS5 2;  1DGL A;  2VCA A;  4KGQ A;  3UGH A;  3WR0 A;  1CZV A;  5BNN B;  1XNK A;  1DHK B;  1YUD A;  3UNP A;  3K77 A;  1V6O A;  4RQP C;  2DFC A;  5FMC A;  1C1L A;  3LOB A;  1QJX 3;  2WO2 A;  3Q8E A;  4IXL A;  4YLZ A;  2Y0I A;  5FZE A;  2V72 A;  4YM2 A;  2W68 A;  5ABJ C;  1ZZB A;  3VHP A;  4I09 A;  1QJX 2;  3ILR A;  2YV8 A;  1I9R A;  3H9A A;  5FMD A;  2HWD 1;  3N9P A;  2HBT A;  1ZRR A;  3DKQ A;  3MGU A;  1LR5 A;  1W9F A;  3IZO A;  3FN9 A;  2EXJ A;  1QXJ A;  2XON A;  1JU3 A;  5K0U B;  4CDQ A;  1RYY A;  3WEZ A;  4PQ9 A;  1H1I A;  4KWL A;  3RWK X;  5GZC A;  2VMI A;  2X5I A;  1N3P A;  4Q27 A;  4Y1Z A;  3U14 A;  3VBU A;  1NT0 A;  5M0T A;  1CGP A;  1H9P A;  1N3O A;  1C8M 1;  1XYP A;  2J1U A;  2JB8 A;  2JXA A;  2WT2 A;  2ZKN A;  4KQ7 A;  4WVV A;  3WSO A;  4ZS3 A;  4MHR A;  1POQ A;  3RYP A;  2DDU A;  3TRS B;  2C0Z A;  3JQX A;  4XFF A;  3WF0 A;  2AH2 A;  4QHZ A;  1JN2 P;  1GP6 A;  1QF3 A;  2XWJ B;  2NQY A;  2QVS B;  3A4U A;  4LOT A;  4W6Y A;  3IPV A;  3JBG 1;  5GM0 A;  4NHY A;  2Q30 A;  1YI7 A;  1COV 2;  2EAK A;  1X50 A;  4HET A;  4IEY A;  1FXZ A;  1WA6 X;  4FP2 A;  4BIS A;  1RIN A;  4K7J A;  3I2O A;  2R06 3;  3FBM A;  1UMZ A;  1ZYB A;  4BQY A;  3RYR A;  2VY0 A;  1R08 1;  1VRB A;  1RUJ 1;  1H2L A;  3GHN A;  1XU1 A;  4HN1 A;  1UAI A;  4BIF A;  2EXK A;  5J1X A;  3AYE A;  1XQN A;  1XSQ A;  1HXS 2;  3AP4 A;  2DUR A;  3CDZ B;  4JKL A;  1W6N A;  4RL7 A;  5A6Q A;  5FLI A;  3EQE A;  1XOY A;  1T6G C;  2W2I A;  4WVW A;  2ZGS A;  4UW5 A;  1POV 1;  4AFB A;  1AX1 A;  3W5M A;  4QB2 A;  4CDX B;  5AC9 1;  3WD5 A;  4GJY A;  4Q0V A;  2HYK A;  1QQP 2;  1JOJ A;  2MEV 1;  1BZW A;  4K3U A;  4P5Y A;  1GQH A;  4JAA A;  1SLA A;  3NJV A;  2DTY A;  3LWC A;  5FYC A;  3VBR A;  4XQ4 A;  4EN8 B;  1LHO A;  3VHN A;  5CIR A;  4Y22 B;  1ODM A;  5BNO A;  1DFQ A;  3NRU A;  3PVO A;  1PO1 1;  4LMF A;  4BQ4 A;  2ZGM A;  1KFX L;  3B7M A;  4IE0 A;  2XBO 1;  4GUL A;  3PUA A;  3AZX A;  4IV3 B;  4XJW A;  1NAE A;  3RZL A;  1AUY A;  1MQT B;  4M4R A;  2CAV A;  3K4D A;  3S5A A;  3J4U H;  3R0R A;  1DLC A;  3MF6 A;  4QU2 A;  4QKF A;  1HB4 A;  1OPO A;  1LJ7 A;  4CXY A;  1R1A 1;  4CCK A;  3LA3 A;  3GJA A;  1VBA 3;  3MIB A;  4H14 A;  4CEY C;  4OCT A;  5FZK A;  1NXD 1;  5BYN A;  4I2O A;  1LOB A;  2QQN A;  3I2J A;  1U5X A;  2WDB A;  2ARE A;  2BOJ A;  5CKQ A;  3RJR A;  2ZGR A;  3URF A;  2E7T A;  3MF9 A;  1VBB 3;  1JZ4 A;  5IFT A;  5C9A B;  5LRS A;  2SLI A;  2VBD A;  3BOD A;  1VBB 2;  5T5J A;  1YIP A;  1PMJ X;  1X33 A;  2XH6 A;  1UY0 A;  3P3P A;  4MO3 M;  3WDU A;  2VJX A;  5IW0 A;  2VUL A;  3U10 A;  4FFF A;  1AR7 1;  4FOQ A;  4MXV A;  4B4Q A;  4Q4V 1;  3RVH A;  1TEI A;  1OD5 A;  3AKR A;  3C7F A;  5G05 L;  1UZY A;  4COU A;  3JD7 3;  1RUG 3;  1JYI A;  1ULG A;  2BW8 A;  5H9S A;  2C9K A;  5C3O A;  1UF2 C;  5JWP A;  5KC6 A;  3AL5 A;  3JD7 2;  1RUG 2;  2QNK A;  5DAB A;  2D40 A;  5A7Q A;  5DPN A;  1C3H A;  1W2O A;  4M3C E;  3ON7 A;  3E5U A;  4QPW A;  4QU1 A;  1CPM A;  2OZ6 A;  4QQL A;  1WCQ A;  1WUV A;  4BYY A;  3AM2 A;  5LY1 A;  1RHI 1;  2IXH A;  1MS3 A;  1RUD 3;  1PVC 3;  2Z42 A;  4ERO A;  2EIG A;  5IVC A;  4D0Q A;  2ZOE B;  1HN0 A;  2ZZQ A;  5HCH A;  1KD7 A;  1PVC 2;  3T0D A;  4LQR A;  4CDU A;  3FX3 A;  1WW5 A;  2HWE 3;  2KD7 A;  5F32 A;  1XNA A;  4QXH A;  1OH3 A;  3WW3 A;  4BQ5 A;  3W21 A;  5EZW A;  4YZ1 A;  3X29 B;  3KMH A;  4BJ0 A;  3E6C C;  1ND3 B;  3PHM A;  3NJZ A;  3ZSK A;  1W90 A;  2ZPX A;  5FJK A;  1N3Q A;  3P3N A;  1TG7 A;  1RUN A;  1JZ7 A;  4QAW A;  1UX6 A;  3O5S A;  1VAV A;  4LO6 B;  4IEQ A;  1BYH A;  1KGY A;  3AZY A;  3BOP A;  3Q8C A;  1S0D A;  3EMR A;  3AKP A;  5FPL A;  4GWI A;  5C4W B;  1DZQ A;  5C8C C;  5JSR A;  3AX4 A;  1UYX A;  2IXI A;  1OF4 A;  1W6O A;  2VZT A;  1MS4 A;  1V70 A;  2PHW A;  5F3I A;  3ZN5 A;  4BIO A;  2R6Q A;  4GMP 3;  1H8T A;  3V0A B;  2BJS A;  1UO9 A;  2VTX J;  1LHV A;  1HQN A;  5FJH A;  2DUQ A;  2IXJ A;  1GZC A;  2P5B A;  5C3P A;  3N7L A;  3WF1 A;  1SCS A;  4D7Y A;  3KF3 A;  3N7K A;  3VV1 A;  4RS5 A;  3RJ2 X;  1AR8 3;  2V09 A;  5D8A C;  3H7J A;  3OBZ A;  4BH9 A;  3HNY M;  1BVV A;  1AR8 2;  3N9Q A;  2FCT A;  4AEK A;  3PME A;  1H2N A;  2Q8O A;  5IK5 A;  4GAZ A;  4IE5 A;  1BEV 3;  4G4F A;  5A3W A;  5LBF A;  3ZFE A;  2ZGN A;  1AJO A;  3QOP A;  3K48 A;  5FY5 A;  1BEV 2;  4AAX A;  3OG2 A;  4NIA A;  3VZN A;  2MHF A;  2XKP A;  3KHC A;  2KR2 A;  2VUA A;  3POI A;  3LDB A;  4LUL A;  2VMG A;  3WP5 A;  2CAU A;  5CYY A;  1US2 A;  1LGC A;  2JIJ A;  3ZYJ B;  1C8M 2;  1NCQ B;  4L0P A;  4DUW A;  4XQD A;  2D6N A;  4YG0 A;  2YY1 A;  4I30 A;  4Y20 A;  5LA9 A;  2YBK A;  4LO7 A;  2GSY A;  2WL1 A;  5GKA C;  4XET A;  2W1Q A;  2OII A;  3RFR A;  3JBG 3;  2P3I A;  2CHH A;  4IEV A;  1YIF A;  2NZ9 A;  4IEX A;  4IV1 B;  2QQW A;  2VOV A;  4TWT A;  1DYO A;  5EV7 A;  3UJO A;  2A7A A;  1CPN A;  1WCK A;  5JPM B;  3JBG 2;  5A7W A;  1RUH 3;  4Y5T A;  1QOT A;  4NII A;  3OD0 A;  3WX5 A;  5F5I A;  4HKO A;  1OKQ A;  1RUH 2;  4AHW A;  1WD4 A;  3B5L B;  2PHF A;  5LBE A;  2W47 A;  3ENR A;  3GHM A;  5FZM A;  1ND2 B;  4B4P A;  3TEZ A;  2WT0 A;  2VMH A;  4YM3 A;  1FAY A;  4FO9 A;  4BQW A;  1R08 2;  2ETE A;  1RUJ 2;  1A34 A;  4E27 A;  5T5O A;  1ASJ 3;  5K9Y A;  5EYY A;  3WQB A;  2XPJ A;  1H1A A;  5C6C A;  3VBS A;  3ZN6 A;  3ZR6 A;  4ATE A;  2WNE A;  1ASJ 2;  1QXP A;  2VZ3 A;  3HQR A;  3JB8 A;  1B35 C;  2W0X A;  2QCS B;  3GBW A;  4WVZ A;  2XL9 A;  4Y24 A;  4NR1 A;  3RZJ A;  3ZFG C;  5LW9 A;  4XJA A;  4WBB A;  3P5B A;  1B09 A;  4BK4 A;  5A3P A;  3FJS A;  3AL6 A;  3IAQ A;  5AC9 2;  3SMH A;  1T6B X;  5L9R A;  4QB6 A;  3MO4 A;  3POF A;  5FZL A;  5E16 A;  1C8N A;  3NST A;  1OT5 A;  2ENR A;  1NZI A;  3I4I A;  4BU2 A;  4QM8 A;  2VPV A;  2A6Z A;  4IUG A;  4Q2F A;  4AI0 A;  4CTE A;  4P9I A;  4CP9 B;  4LR4 A;  1IS4 A;  2IFW A;  4PIZ A;  5DAW A;  2OA2 A;  1N1Y A;  3B01 A;  1DGW X;  5FZO A;  5FYV A;  4KH9 A;  5FYB A;  3RG0 A;  1SQ4 A;  4AOC A;  1PO1 2;  3TEY A;  4FPL A;  5F5A A;  4AYU A;  3HWJ A;  1SFY A;  1CAW A;  5JLV A;  2E9Q A;  3OPW A;  3ACG A;  3P1I A;  3PTY A;  1QKQ A;  2BVB A;  3VBO C;  4QPG A;  4CU8 A;  4DY5 A;  4J1W A;  5L9V A;  4F8A A;  1PK6 A;  4Q0P A;  3LB9 A;  1BJQ A;  1UCX A;  2OUH A;  4XE9 A;  4NPR A;  3RZM A;  1R1A 2;  5ANN A;  5B4N A;  2B46 X;  1EPZ A;  4Y33 A;  4ASK A;  3QBQ A;  2OZJ A;  4M0H A;  4PI0 A;  4RQP A;  5GLW A;  3VLB B;  2EA7 A;  2YU1 A;  2E33 A;  5FBZ A;  5EFU A;  1XBF A;  3CNA A;  3ITQ A;  3T2P A;  2AGS A;  5ABJ A;  1UOF A;  3IWZ A;  2RJ2 A;  4B1L A;  3LPF A;  4XVH A;  1L3J A;  1DYK A;  1J3Q A;  2NLR A;  3NAP B;  4LKF A;  2GDF A;  4CDW C;  1S0E A;  1AR7 3;  4DEV A;  1PNG A;  4OMC A;  1J1L A;  2WJS A;  1QJU 1;  4P9L A;  2MPF A;  4DRV A;  2JG8 C;  1AR7 2;  5ERL A;  2I2S A;  1OLM E;  2WWU A;  3N4M A;  1OOP C;  2JKB A;  2ERF A;  3OGJ A;  1A6C A;  4Q4V 2;  3ATG A;  4LBQ D;  5CFD B;  1QY4 A;  2OQ6 A;  2BNM A;  4Z8B A;  2GND A;  2WNV C;  3BCW A;  3FMG A;  3HT2 A;  4HZF A;  4H3W A;  5FY8 A;  1S0G A;  3TEW A;  4EJR A;  4DFS A;  3LIH A;  3OYW B;  2XJS A;  4XUQ A;  1BBT 1;  5CAD A;  4PDW B;  1XU2 A;  3MEP A;  3GM8 A;  5IAT A;  5FZ8 A;  2Z2S B;  3K51 A;  4XFA A;  3ACI A;  2WNO A;  4GXL A;  2VMF A;  2AZ5 A;  3MIG A;  4YW1 A;  3WP4 A;  1LEN A;  1RHI 2;  1Z7S 1;  2Y6F A;  4O7X A;  4I0W B;  3C7O A;  3ACL A;  1HRI 3;  2WS9 3;  3KVB A;  1BHG A;  2JG9 C;  2HLE A;  3AXD A;  4HK8 A;  1DF0 A;  2PAK A;  1LES A;  1AF9 A;  3III A;  4R9D A;  5DDJ 3;  4GH4 C;  2PHT A;  4XJZ A;  5LK7 B;  3NJY A;  3RZH A;  1HB1 A;  1EPW A;  2J1R A;  1VBD 1;  4LE3 A;  4D6S A;  2Y6H A;  4ATF A;  4R9B A;  1PO2 1;  1GZW A;  3LD8 A;  4JDO A;  4QKB A;  3S5Q A;  4DNY A;  5IK8 A;  3SIT A;  5T50 A;  3KV6 A;  4IE4 A;  1GZ9 A;  4CPB A;  1VE0 A;  4BXS V;  1PIV 1;  5J98 B;  1E5R A;  3Q8B A;  4LBQ A;  3VZM A;  4OYU A;  2K46 A;  1L7L A;  4AI3 A;  3NW4 A;  2DTW A;  1KS5 A;  1IZ3 A;  3FLP A;  2J1A A;  4AI2 A;  1H4H A;  1PZ7 A;  1CN1 A;  2OX0 A;  4GB3 1;  2ZTN A;  4C0B A;  4AGG A;  3ORJ A;  2EID A;  3RMX A;  3HMY A;  1MAC A;  2LTN A;  4TN7 A;  5BUV A;  4CDQ B;  2VOT A;  4ASM B;  4ASL A;  2WA4 A;  3TYJ A;  1OBN A;  4PLM A;  3VBU B;  1QOO A;  5FZ0 A;  4COY A;  3L9J T;  2AYH A;  2XKO A;  2AEZ A;  4MSV A;  5E88 A;  1UN1 A;  1K3I A;  1X8M A;  1X9P A;  1VRH 1;  2K2S A;  4IE7 A;  2LW8 A;  3VZL A;  4XUN A;  1PGS A;  2PLV 3;  2ZHN A;  4EZ4 A;  2H0V A;  2GMM A;  4HXC A;  3U75 A;  3HBK A;  3IPV B;  3MLJ A;  2RVA A;  4XJ9 A;  4EWD A;  5D1I A;  1GMM A;  2DCZ A;  4CEY A;  2YC0 A;  3MUY 1;  2QQV A;  2X05 A;  3AJZ A;  1DQ6 A;  1V9U 3;  5CFC C;  3LEG A;  4DXR A;  4JZR A;  4QQP A;  1OQD A;  2PYT A;  5JI9 A;  3M7A A;  2JD4 A;  3SLI A;  2JEN A;  4D3W A;  3I2H A;  2J1T A;  3KT7 A;  5FYS A;  4YVS B;  3RSJ A;  3AKT A;  3WNO A;  3HN1 A;  1Z0H A;  1ZBE 3;  4UT5 A;  3UET A;  5EYX A;  1H30 A;  2D5H A;  3ELN A;  3ECQ A;  4FOW A;  1ZBE 2;  2VME A;  4BK5 A;  3D8C A;  3KB5 A;  3PUS A;  5IVF A;  1CES A;  2VNO A;  5DUV A;  4DXZ A;  2BYV E;  2ES3 A;  4XFH A;  2VH9 A;  2F6B A;  2ZMN A;  4YZ4 A;  5FPB A;  5BV6 A;  3HEI A;  1VJ2 A;  4JGZ C;  2HYX A;  3R4D B;  3I8T A;  5F3G A;  4XPV A;  4WM8 C;  2R1B A;  4QHB A;  2C6S A;  2ZEX A;  1QEX A;  5IT6 A;  2N7G A;  3VBR B;  3T2T A;  2FHR A;  2VEC A;  4QXC A;  1W8U A;  1BK0 A;  2R16 A;  1JYN A;  2DBI A;  4OUE A;  3POG A;  4FPO B;  1ODN A;  3A23 A;  3WNX A;  5FIX A;  2OYZ A;  5FZC A;  1CIW A;  4N43 C;  3M1H A;  3POW A;  4JDM A;  4BCU A;  3GZE A;  2WQ8 A;  3AC0 A;  1KIT A;  2XUM A;  1OVS A;  3AVS A;  5F2S A;  1C5H A;  1OF3 A;  5LB6 A;  2YZ4 A;  1KJR A;  3FHQ A;  3WDY A;  4FSJ A;  2RG4 A;  3BYW A;  3B00 A;  3CF6 E;  4KGG A;  4KI5 M;  3VDD C;  1ENS A;  3MPB A;  5FZ4 A;  2Y26 A;  4HSJ A;  4NIH A;  3H1Y A;  3V64 A;  3E6B A;  3TBD A;  1N1S A;  4O65 A;  5EP9 A;  5DXD A;  1NCR C;  2GC2 A;  2HWB 3;  3BKZ A;  4JX0 A;  4E4D X;  2B9V A;  4X6Q B;  4AF9 A;  5JDB A;  1TVG A;  1CX4 A;  4OI4 A;  3O0V A;  1F9K A;  2HWB 2;  5EWS A;  4YSF A;  4LOS A;  2UYB A;  1TQ5 A;  2R0H A;  1W8T A;  2TNF A;  4NPL A;  4Y3O A;  2GN7 A;  4TYS A;  3T2Q A;  1NY7 2;  4TLG A;  3T30 A;  2ET7 A;  3NV2 A;  2ET1 A;  5C8C A;  3ZXJ A;  2XJV A;  4OQ8 A;  2R06 1;  2PN5 A;  3CLP A;  2EIC A;  1BVP 1;  3ZX7 A;  1O6U A;  4RR3 C;  2QFE A;  1LOA A;  3BAL A;  3IM0 A;  4KMQ A;  1GBG A;  3I97 A;  4AWD A;  1QOS A;  1NE6 A;  2UWC A;  4CCE A;  3FLT A;  2E26 A;  1BMV 2;  3ME2 A;  5FYH A;  5FMB A;  5D8A A;  1LEM A;  2B5H A;  3M3Q A;  2VZQ A;  3WNK A;  1OD3 A;  3H8X A;  2E63 A;  3FBY A;  4I3P A;  3OD4 A;  1JYT A;  2ORX A;  4KU7 A;  3I59 A;  4HK9 A;  5T52 A;  4ZU5 A;  1W06 A;  3WP6 A;  1PMH X;  4KNC A;  1W3X A;  4HSL A;  4CSW A;  5JXI A;  3ZSM A;  2JDN A;  2ZML A;  2IZW A;  4AQ6 A;  1YQ6 A;  1GOF A;  1XE7 A;  1U5Y A;  4J1X A;  2ZCW A;  1JZ2 A;  1NQJ A;  4PHZ A;  3TOJ A;  4IER A;  3HIF A;  3W58 A;  4YFZ A;  3CJI C;  4GJZ A;  4Q8L A;  5FZ6 A;  4BDV B;  4LHL A;  4CDU B;  1G9D A;  4OMD A;  5SV5 A;  1MR5 A;  4AI9 A;  1UY2 A;  3PLQ A;  2AUY A;  2K9Z A;  1BK1 A;  2DCT A;  4ES8 A;  3KHB A;  3VD7 A;  3I2D A;  2G4I A;  3IDC B;  4V2V A;  1BBT 2;  2J42 A;  2D98 A;  2A5Z A;  4ZON A;  4I0B A;  5A32 A;  2ZGT A;  4HVR A;  5SV8 A;  3KV4 A;  4COZ A;  2Z79 A;  1VBA 1;  5A7P A;  1TNF A;  5JOY A;  2VOX A;  2QQI A;  2XML A;  1JH5 A;  1PZ8 A;  3DN7 A;  4NHL A;  4QB1 A;  1JYC A;  4QPI B;  4FAH A;  3O12 A;  4Q1R A;  4JKK A;  5ACA 3;  4YW2 A;  3T0B A;  1W6O B;  2QKD A;  5FY4 A;  3RZG A;  1S0I A;  1VBB 1;  1AL0 G;  3VKF C;  3ZVX A;  4KG8 A;  3PUR A;  1CJD A;  4Q4W 3;  3ZSL A;  1H8T B;  2ZBJ A;  1UIK A;  3DEM A;  3N3H A;  5EJ1 B;  1VBD 2;  2Y8K A;  3I49 A;  3VBH B;  1PO2 2;  2FCV A;  4RS5 B;  1B35 A;  4B8E A;  3GNE A;  2BTV C;  5T55 A;  3O1U A;  5CBL A;  3MHZ A;  3ZFG A;  4BHP A;  1PX3 A;  4QX7 A;  5EPA A;  1IKP A;  5C71 A;  1NX9 A;  4H7L A;  5FY0 A;  4Y1V A;  5JXH A;  4QDR A;  4J25 A;  1SCR A;  4Y4Y A;  4XF9 A;  1W39 A;  3ZFE B;  2VVF A;  3U4S A;  5LA1 A;  4M0N A;  1U5I A;  4GB3 2;  5FY1 A;  4IND A;  4DO0 A;  2PQQ A;  1CAU B;  3M3O A;  1SLB A;  3OPZ A;  3CZU A;  3N36 A;  1XNB A;  3PDQ A;  4MGK E;  1TNR A;  1JW6 A;  3SC7 X;  4AHX A;  1MS5 A;  4UXA A;  4K1Z A;  4S2F A;  1HB2 A;  4A7K A;  4YZ2 A;  1RUD 1;  5AFB A;  1PVC 1;  3ACH A;  3D5O A;  4NJ4 A;  5LCW L;  3MPP G;  2OKX A;  3LFI A;  2CSG A;  2BQP A;  2FCU A;  1VRH 2;  3KZ4 C;  4Y20 B;  1UL9 A;  2WQZ C;  2IVJ A;  2JDY A;  2X8K A;  4KU8 A;  3VBO A;  1FMD 3;  2HWE 1;  3KQR A;  4WZF A;  5FZ1 A;  4YW3 A;  1XC6 A;  2BP6 A;  1FMD 2;  2WNU B;  3ZYF A;  5FY9 A;  1QWR A;  3O7O A;  4RFR B;  2G19 A;  1HDK A;  3QH6 A;  4EWE A;  3ZM8 A;  5EQU A;  1FX5 A;  1GLH A;  2PMW B;  1IG0 A;  1QH7 A;  5C3Q A;  3T09 A;  3NWK A;  2HWC 1;  4LXL A;  5L9B A;  1UPS A;  4XAC A;  3C2U A;  3VZJ A;  4LTA A;  5DAP A;  1LOF C;  3VBS B;  1CAV A;  3ZN6 B;  4CDW A;  4HN0 A;  4Q26 A;  3VZO A;  1WCD J;  2P37 A;  2VE1 A;  3SIS A;  3UKT A;  2R49 A;  4GMP 1;  3VDB A;  4AE2 A;  4H2A A;  1V6N A;  2JG8 A;  5FP8 A;  1OOP A;  1S0B A;  3BGA A;  4QQ2 A;  2K0G A;  2F4L A;  3LDK A;  1OPM A;  4FPH A;  1YYN A;  4XCA A;  4QMA A;  1AR8 1;  4PLO A;  1UYP A;  2WNV A;  1OHF A;  2TEP A;  4EWA A;  2YGM A;  3R6S A;  4XIK A;  1W8Z A;  3ZXD A;  3LE0 A;  1GAN A;  2D6L X;  3OUH A;  4ARY A;  3OGV A;  4D94 A;  5A1A A;  1UPI A;  2AEY A;  2QUO A;  5J7M A;  1BEV 1;  5DUX A;  5FZO B;  1IS6 A;  4FCA A;  5APA A;  2FQP A;  1LB2 A;  2YGL A;  2HWF 3;  3H1M A;  1CAW B;  2WAB A;  5GAL A;  4N9I A;  1GU3 A;  2HWF 2;  3BU7 A;  1EY2 A;  2JG9 A;  3UJQ A;  5CEH A;  5I0D A;  4XMI A;  4BPZ A;  3HPN A;  1D0G A;  3CQO A;  5FP4 A;  4GH4 A;  4MOA A;  3ZN4 A;  5FRA A;  4RGK A;  4YW6 A;  4ZY9 A;  1AR9 1;  4K6B A;  4AXO A;  1R64 A;  4GWN A;  4GWM A;  3NL1 A;  4RQP B;  3NNG A;  3PL0 A;  4HPK A;  4K40 A;  5F7U A;  2C1F A;  1ZZC A;  3W5N A;  1YCI A;  1RUH 1;  1IGO A;  2P3Y A;  4UYB A;  2WFP A;  5ABJ B;  2XHK A;  5FUP A;  1ZBA 3;  5FKB A;  3TB0 A;  5FXZ A;  3T4H B;  5L7O C;  3K3O A;  3Q9O A;  2R06 2;  4FXG B;  4JHT A;  4QT6 A;  3T1L A;  4B3N A;  2ADE A;  3UGF A;  1RUC 3;  1OI6 A;  1S1A A;  1ASJ 1;  2B42 B;  1NA1 C;  3EO6 A;  4HFS A;  5E1R A;  5A7O A;  3RNS A;  4LOR A;  2OUJ A;  1QJY 1;  3QH7 A;  1VAK A;  3VKM A;  4DXT A;  4RN5 A;  5JXJ A;  3EYP A;  4XHB A;  3FC0 A;  4NOT A;  4D8M A;  5FMO S;  4JRL A;  3I54 A;  2VZV A;  2W1U A;  3O1R A;  4XF0 A;  3IN9 A;  1W03 A;  4BXF A;  2O1Q A;  4XTM A;  4XBN A;  3GJB A;  3KT4 A;  4QX1 A;  1JTZ X;  3VL8 A;  2J1V A;  4CU6 A;  4BQ3 A;  4Q4Y 3;  4XF3 A;  4LBM A;  1DZT A;  3N7M A;  1YFX A;  2Q1M A;  5KXB A;  1SMV A;  4L92 A;  5CFC A;  1WBL A;  1Z78 A;  2XWB B;  1SPP A;  2P4E A;  2RS1 3;  2WLP A;  3EB7 A;  4MXW B;  1WLD A;  4S2G A;  3N35 A;  1UZW A;  3RI8 A;  1UZZ A;  1W2T A;  3ZKY A;  2RS1 2;  2WSV A;  4O61 A;  2V4V A;  3HT1 A;  5CIS A;  1H6X A;  4B1M A;  2GME A;  4R4X A;  5FTT C;  4ZPI A;  3B93 A;  1CIY A;  4A3Z A;  1GZW B;  2DWR A;  5C9A C;  2CGO A;  2XVK A;  5I93 A;  1UOJ A;  2ZXQ A;  1Q8O A;  3WHT A;  1XXN A;  4A4A A;  1QXR A;  2GH2 A;  2ZEZ A;  4LK7 A;  1JI6 A;  4LBQ B;  1MPX A;  2R7E B;  1VBA 2;  4QX8 A;  5FV3 A;  1YHF A;  2YXS A;  5FZI A;  3WW4 A;  4CVU A;  3WCS A;  1KJL A;  1IG3 A;  4JGZ A;  4I02 A;  4NHX A;  2L9L A;  2VCB A;  1UKR A;  4WM8 A;  3K2O A;  2JKX A;  3ILF A;  2OQ7 A;  4WV8 A;  2VNV A;  4DRR A;  4NMI A;  1GFF 2;  4JVA A;  3NVC A;  4BLJ A;  4UF0 A;  1W99 A;  4XMA A;  4E2S A;  2D3P A;  3C8X A;  1S2E A;  3PUI A;  4JV4 A;  4Z2A A;  2Z4F A;  4XF1 A;  1M06 G;  2BDR A;  1TMF 3;  4N43 A;  2Y6K A;  3MBW A;  3O0W A;  4HAN A;  1G9F A;  3DXU A;  4CCJ A;  1ZRI A;  1NG0 A;  4X8P A;  2JEC A;  4YM1 A;  1GZT A;  1SDW A;  4YGE A;  4OHV A;  1LRH A;  3VDD A;  3KD4 A;  1REE A;  3USU A;  3THT A;  2V5Y A;  2XJP A;  1O4Y A;  3LEM A;  1NCR A;  1DBN A;  3I3Q A;  4A2U A;  4CEY B;  3WG3 A;  2ZKL A;  5DZG A;  1W8N A;  5HV4 A;  1PX4 A;  1JMU B;  1V6K A;  3JQW A;  5KHK A;  1O3Q A;  5L73 A;  4XUR A;  3DPR C;  2FZ1 A;  5IAX A;  3D3A A;  4YAR A;  1RUD 2;  1UY3 A;  2PHD A;  4QXK A;  4DEQ A;  3QCW A;  3MDP A;  5LK5 A;  1HRI 1;  2WS9 1;  5IAV A;  2P34 A;  5C8W A;  4F83 A;  4HVO A;  4XDQ A;  2AAC A;  5A3U A;  2VW2 A;  3OUJ A;  2HWE 2;  3AMQ A;  4RR3 A;  5JZG C;  5DDJ 1;  2BBV A;  4CXW A;  2VTF A;  3LSD A;  4O9G A;  1W0O A;  1MZE A;  5JXG A;  1RMU 3;  2J7M A;  1UMH A;  3N9L A;  1AL2 3;  3FUQ A;  3O1S A;  4W4Z A;  2VCM A;  2HWC 3;  1QGL A;  2E7A A;  1F8V A;  1AL2 2;  4FQZ A;  5LWB A;  1CWP A;  4OI1 A;  1SBE A;  3GCX A;  5JMO A;  2XQR A;  2HWC 2;  1WME A;  5KWR A;  2BFU L;  3SKV A;  2BGC A;  3LA2 A;  4LO5 B;  5K8S A;  2RMU 1;  4V2W A;  5AVA A;  5KHJ A;  1YRZ A;  4QKD A;  4R9A A;  5CG9 A;  1SDD B;  4MHU A;  5GJ6 A;  1RB8 G;  1QJF A;  4XUP A;  5DG2 A;  1ZZ9 A;  2A71 A;  4BQ1 A;  2VXJ A;  1F5J A;  3CJI A;  3O14 A;  1AZD A;  1W8W A;  2CV6 A;  2VXR A;  3MI8 A;  4CCN A;  4L97 A;  3L2Y A;  4FPE A;  5A7N A;  2YBP A;  2BBA A;  2PLV 1;  3WF2 A;  1NCQ C;  3VDA A;  1SLC A;  4A6S A;  2VD7 A;  3AK0 A;  5C5U A;  3K4Z A;  1UZV A;  3UL2 A;  2YB7 A;  1LOC A;  2IVI B;  1GOH A;  2VM9 A;  3DCQ A;  4PBO A;  1SBD A;  1YJL A;  2YC4 A;  3KM5 A;  1RJ8 A;  4IV1 C;  4MGZ E;  2DF7 A;  3DYO A;  1V9U 1;  2B39 A;  2C24 A;  4AEJ A;  3MFA A;  4FPY A;  1SZB A;  5CG8 A;  1W6Q B;  1E57 A;  1H8V A;  1HKD A;  1V6L A;  3AJY A;  1NLS A;  2LAL A;  2JDU A;  4AQT A;  2I07 B;  2WO3 A;  3OY8 A;  3KVA A;  3IDB B;  4E4S A;  1AR9 3;  2QQJ A;  4YVW C;  5IYY A;  3E97 A;  3KV9 A;  5GZF A;  2VGD A;  5C3R A;  1ND2 C;  5C7G A;  3H8O A;  3R4U A;  1ZBE 1;  4M3C A;  1AR9 2;  3VKN A;  1OUS A;  3CHX A;  1SLL A;  1ZA7 A;  1WCS A;  2CDO A;  2A6V A;  4UBH A;  1ULO A;  2VW0 A;  2F17 A;  5D8A B;  4NN0 A;  1FYU A;  1AHS A;  2E32 A;  3NNM A;  4H7M A;  4OUS A;  4CU7 A;  3BPZ A;  1LKN A;  4AG4 A;  1H6Y A;  3GZA A;  3I59 B;  1EUU A;  1Y9G A;  2EXH A;  4L2N A;  1LED A;  3GF6 A;  4EV0 A;  4CCL A;  4WM7 B;  3T1M A;  4MGQ A;  3VKO A;  3PNA A;  3OEB A;  1O7F A;  1QJY 3;  5JI7 A;  3SKJ E;  2VO5 A;  2WQ4 A;  4CCO A;  2PAM A;  3OB8 A;  4FOV A;  4CRQ A;  1GWM A;  1QJY 2;  4JGY C;  4DS0 A;  3POJ A;  4QXB A;  4OI0 A;  2EVX A;  3AKQ A;  1IPK A;  1TZO A;  1H2M A;  2W95 A;  3M4F A;  1RIR A;  2IUW A;  4B7E A;  1QMJ A;  1WZX A;  3IBM A;  4N7I A;  5I8T A;  3ZXE A;  3WUC A;  4XZP A;  1UY1 A;  2WC2 A;  4CCM A;  5IWF A;  4SLI A;  1RJ7 A;  2KXL A;  3ZFF A;  5FR3 A;  2BNN A;  2NMO A;  5A32 B;  1GUI A;  4IGP A;  4IE6 A;  4GZ9 A;  1IPJ A;  3AP9 A;  2HWB 1;  2UWA A;  3VHR A;  5DAQ A;  4CUB A;  3H8R A;  4IL7 A;  1CON A;  2NN8 A;  1NY7 1;  4AED C;  2BWA A;  5BNP C;  2DCJ A;  2D3S A;  1CZT A;  3K75 B;  2JE8 A;  2VUC A;  3PIG A;  5DG1 A;  5J3U A;  3BTY A;  4BMB A;  4PIY A;  4BZ4 A;  2IXC A;  3B69 A;  5A80 A;  1GQG A;  2VOW A;  1RED A;  1ST8 A;  2QBX A;  1T2X A;  1LOF A;  2DV9 A;  5ISL A;  4AI1 A;  3MW3 A;  4MAD A;  2YFU A;  1NUK A;  2D44 A;  2QJV A;  3CBN A;  1B35 B;  1PVX A;  1VMF A;  5A33 B;  3I3B A;  2JDP A;  2WKK A;  3PU3 A;  4I01 A;  4LKE A;  4XYX A;  3ZFG B;  1BMV 1;  1XPW A;  1FT9 A;  1IS3 A;  4CCC A;  3VB9 A;  3AB0 A;  2W9X A;  1A8M A;  5I0T A;  5IUQ A;  3KGL A;  2B45 X;  5CFD C;  4Q0Q A;  4CE8 A;  3A7Q A;  1U12 A;  2E53 A;  2W39 A;  4P9W A;  2DCY A;  2GU9 A;  3ABZ A;  3CEW A;  4L9B A;  1DQ2 A;  3A21 A;  3FHI B;  4YNI A;  2W87 A;  1MVQ A;  1RUE 1;  2BER A;  4UFH A;  5DMY A;  4CPB D;  3GGL A;  3AP6 A;  5A1L A;  5HCA A;  1JHJ A;  4KBB A; 
#chains in the Genus database with same CATH homology
 1W8U A;  4CP9 A;  4YW7 A;  1GWK A;  2LRO A;  4LKE A;  3ZYF A;  4A6S A;  4AL9 A;  2WYF A;  1WCU A;  2KR2 A;  4YW6 A;  1HN0 A;  4CPB A;  4CP9 B;  4LJH A;  1W8Z A;  1V0A A;  2C24 A;  1OH3 A;  1UOJ A;  1L7L A;  2K46 A;  5D21 A;  4BQ5 A;  2JWP A;  1W9F A;  3UT0 A;  3ZYH A;  4LKF A;  2LRP A;  4LK7 A;  1OKO A;  4BQ2 A;  1W90 A;  2Q1F A;  3ZYB A;  1GWM A;  1WMX A;  2VXJ A;  4LKD A;  4BQ3 A;  2O14 A;  3ORJ A;  4LK6 A;  1GWL A;  4CPB D;  4BQ4 A;  4YWA A;  1W8W A;  1W8T A;  1WZX A;  3F95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...