2KR2A

Xenopus laevis malectin complexed with maltose (glcalpha1-4glc)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
190
structure length
190
Chain Sequence
GAMSGLADKVIWAVNAGGESHVDVHGIHYRKDPLEGRVGRASDYGMKLPILRSNPEDQVLYQTERYNEDSFGYDIPIKEEGEYVLVLKFAEVYFAQSQQKVFDVRVNGHTVVKDLDIFDRVGHSTAHDEIIPISIKKGKLSVQGEVSTFTGKLSVEFVKGYYDNPKVCALFIMKGTADDVPMLQPHPGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malectin-A
publication title Analysis of the specific interactions between the lectin domain of malectin and diglucosides.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Carbohydrate binding protein
total genus 14
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11721 Malectin Malectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2kr2A00
1GWLA 4BQ3A 1W8UA 1WCUA 2KR2A 1GWMA 1W8TA 3ORJA 3ZYHA 4CP9A 4A6SA 4LKFA 4LK6A 4LKEA 5D21A 1GWKA 4YWAA 4LJHA 4YW6A 1OKOA 4CPBD 4BQ5A 4BQ4A 4CPBA 1OH3A 1L7LA 1UOJA 2JWPA 1WMXA 2Q1FA 2VXJA 2LROA 4BQ2A 4LKDA 1W90A 1W8ZA 1WZXA 2O14A 2WYFA 2K46A 1W9FA 4LK7A 1HN0A 2LRPA 3UT0A 3ZYFA 1V0AA 4AL9A 4CP9B 1W8WA 3ZYBA 3F95A 4YW7A 2C24A
chains in the Genus database with same CATH superfamily
3VHNA 2EIGA 2WZEA 4HONA 5BNNA 2BBVA 1I5ZA 3PL0A 2ZBJA 4D6SA 1EV13 2C4XA 3THTA 3VLBB 5CG8A 2GSYA 4CP0A 1RJ7A 2DWRA 4QHBA 4NHMA 2HWE1 1H9WA 1NOVA 3FMGA 3K4ZA 4FPOB 2ZX0A 3FFQA 3ZM8A 3HMYA 5C33A 4JAAA 4KL1A 4PDWC 1H4GA 2WQ4A 3ABZA 1R091 2GP5A 5LA2A 5IYYA 4NAOA 3WCRA 5BPXA 3C7GA 3HBKA 2QZ3A 3BIWE 1QJY1 4CP9B 4MOAA 3POWA 1JI6A 4LO4B 4YVWC 3VDDC 2YBPA 1LEMA 2ZHMA 5JXIA 1YFXA 3EMRA 1OLQA 3L9JT 1LCLA 2YGLA 4P00B 4XFHA 3THCA 2YROA 4F7ZA 2V5YA 3HJRA 4GAZA 2WS93 2JG8B 1W3XA 1MZ5A 3N9QA 2ZS6B 1XQNA 3VN4A 4OHXA 3AMHA 5CKNA 2VTFA 2CAUA 1Z7S1 4BJ0A 5FXWA 2YHJA 3H0OA 4AK3A 3AZYA 1H1MA 2H6CA 4KU7A 3WDVA 1IPJA 4X6RB 4UBHA 1FYUA 1VBA1 1XNCA 1LECA 1NCRB 2JEMA 1ASJ2 2PAKA 4KH9A 1UPSA 3TWIA 1RHI3 5CU1A 3WLUA 2IC1A 3M70A 4K21A 2FZ1A 1G9DA 2ERFA 2ZGSA 1SMVA 1TEIA 1R1A3 1S2EA 1NE6A 2JDUA 4RYDA 4K40A 5EJ1B 5EQUA 3POSA 3WG4A 1VAMA 2NLRA 4AAXA 3V0AA 3LA3A 5LY1A 1BHGA 2RDRA 1GFF2 1S0IA 5LW9A 4RR3B 5EZWA 3HIFA 2IXCA 4NWWA 4OMDA 1SFYA 1OUSA 2GC0A 4GKYA 4Y24A 5FY7A 5GLVA 3VBFC 5KHGA 3O1UA 2Q30A 2JE7A 4BQ4A 1S0CA 2WLPA 1JYTA 3O0XA 4FPGA 4GZ9A 1RGSA 2JDHA 3RDIA 2QJVA 4LO5B 4YM3A 2G9ZA 2W2IA 3DKQA 2GP3A 1W90A 4TXWA 1AL23 1VB4A 3MW4A 3WNXA 5C3OA 4DPNA 2RDSA 1NAEA 3NQHA 1S55A 1EV11 1ZA4A 4PBPA 4R52A 4XFAA 1JYWA 3LPFA 2XGXA 4TLGA 5K7PA 1HXS2 5CFCC 2W95A 1QJU3 3PHMA 2D43A 1OI6A 3WQBA 3NKTA 1GQHA 4ZS3A 1K5MC 3BCWA 1ZX5A 5HI0A 2JDMA 3VBOA 1OOPC 1S2KA 1APNA 2XUEA 4N53B 1KDMA 3SKJE 2P3YA 2QQIA 2AR6A 3KLSA 3S7EA 1KS5A 2XXZA 5DQ0A 1PO12 5DG1A 4LA2A 4W65A 3IIIA 1J83A 1HB4A 3T30A 2FDHA 5FPZA 2O14A 3WNNA 5FZEA 1Y43B 1SG3A 5K0UA 4Y5Z0 2WS91 4KWJA 1M06G 1CESA 1MQTC 4XFCA 2W0XA 4JRLA 1B35C 3MIGA 3S30A 2RS12 5JXJA 1W8TA 2XQXA 3CU7A 3H3ZA 1SDDB 1ZBA2 2OT7A 1UF2C 1HB1A 4CU6A 3S5AA 3KHCA 4F3JA 2XJRA 4MUVA 2G4IA 3GHMA 2JJ6A 1RHI1 4HN0A 3W5NA 4UF0B 2ZKLA 4S2DA 3KZ4C 1R1A1 1NQJA 2W3JA 2DFBA 3ZYRA 4WM7C 5L73A 2F6BA 3T0AA 5FPUA 2BWCA 2DTWA 2ZGPA 1S2BA 3LAGA 3M3IA 4XUPA 1VP6A 2WZR3 5FLIA 3B69A 3B00A 4LBJA 3FWEA 2D6OX 3K4DA 4XBNA 3MIBA 5FZCA 4ET7A 5L9VA 3PU3A 3R6SA 4IEOA 4PQQA 4D3WA 1VLNA 4DXRA 3PMEA 1WBLA 4XDQA 4Z82A 5EP9A 3FBMA 3OGRA 4UW6A 1Y9GA 4B7KA 4CXYA 1ENQA 1UL9A 1G9BA 3KV6A 4JGYB 3FHIB 4EV0A 1QMJA 2GAUA 2A3XA 2D93A 3HN3A 1PO23 4E2QA 3I3EA 3I49A 2RDNA 3DPRA 2BERA 3KS7A 4DEQA 2R073 2QQWA 5I0RA 5CZKA 5HCFA 2QQKA 5FDBA 1TME2 3TB0A 1RUG3 3RSJA 1OSGA 4LLFA 3D82A 4JGZB 3AXEA 3RWNA 1QJU1 2ZGTA 4AHYA 1QQP3 3UGFA 4AQSA 5BNPB 1XYPA 4XIOA 2WRAA 4CCKA 1SQ4A 4FPLA 5I93A 1A3KA 5FYIA 1HRV2 1CAVA 2WQ8A 2OYZA 4YFZA 1NG0A 3Q9OA 2CGOA 5BXXA 1RMU2 3HR9A 1KS4A 4QPGB 4UT5A 3M3QA 1GWKA 2E9QA 3RMXA 3VKFC 1VE0A 1MS0A 3FC0A 1DGWA 2Q8DA 1JZ8A 2J1AA 5CFDA 2WFF3 3RZJA 5FO7B 4NIAA 5LA9A 1QOTA 4I02A 4B4RA 2ZGRA 4WVMA 2YPJA 2AYHA 1LOBA 4QWNA 5CVRA 1GZTA 2MEV3 5EYYA 2B9VA 1OQ1A 3OSDA 3JBG1 4NOTA 3A22A 1RUD1 4LORA 4OUMA 4XBLA 1LOAA 2R042 1WLWA 2RG4A 2P6HA 2Y6KA 1DQ2A 1ZZBA 3N36A 5A3WA 2Y6JA 1RJ8A 4FPHA 3WOGA 3WG2A 4C0HA 2B4KA 1I3HA 4Y4YA 1BVP1 2IWGB 2UWAA 1O8PA 3O0VA 4A6SA 3OUIA 1LRHA 5LBEA 3LEGA 3Q8BA 3BIEA 2PHWA 4MSVA 1JODA 4HKOA 5JOYA 5FP8A 4I0WB 1A34A 3TNQA 2D6MA 1H0BA 3JB8A 4W6YA 4ZPIA 2W39A 5T5LA 2XQRA 3OEAA 5J09A 4QX1A 2EXIA 4XILA 3AYDA 5FPBA 2QQPA 3B01A 4ATEA 2FDJA 2ZGMA 4QMAA 2W46A 4S2FA 5BNNC 1W28A 3T1LA 1BBT3 1YIPA 3K51A 5JXHA 1BMV2 5CEHA 4KU8A 2UWCA 2VNRA 1PO21 2VZOA 4IERA 2FDGA 4CP9A 2XHNA 2DCZA 3EXUA 2R071 4IEVA 4YZ1A 1WW5A 4XF1A 2QQMA 1X7NA 4YVSB 2VMGA 1RUG1 3O1RA 3NV3A 1LGCA 1YLLA 3CQOA 5AFEA 1PGW2 2VD7A 4C1XA 1W6QB 4RQPB 1QQP1 2W87A 2RR13 3OPWA 3OD0A 3GHNA 4F83A 2KM2A 2MHFA 3PVEA 5F7UA 5DDJ3 4AQ6A 3AZXA 3J7MA 1MS9A 4QD2A 4FPYA 5IFTA 1WCDJ 3U10A 3FX3A 3LOBA 4LLOA 4GIQA 1UAIA 5F5AA 2ZXQA 3NAPA 5JIUA 4OFGA 2TUNA 2KD7A 1A6CA 2ZGOA 3U4SA 3ZSMA 4BU2A 3SH5A 1XNBA 4C0BA 4KQ7A 5FYVA 5FK7A 1W05A 3WDTA 4BA6A 4DRVA 3BTZA 3DXTA 2WFF1 4ATFA 2WWUA 2C9AA 1IS4A 1W9YA 2JG9B 4GB33 4XEZA 1K5JA 2MEV1 4RR3A 3WSOA 1ZVFA 1C8NA 2QKDA 2X29A 4FVVA 1PX3A 1UZYA 4LBOA 3ZSJA 4DB5A 5F2WA 3ZVXA 1WMFA 4IE7A 5JOZA 4FOVA 4E4HA 3ES4A 3GJAA 5JMCA 1QNWA 1YUDA 1JN2P 3AVSA 4ARYA 5FP7A 4XQDA 3IB3A 4AVSA 2A1XA 5FP3A 3PJQA 3W9AA 5JI7A 5CNAA 3V56A 1NYWA 5M0TA 1STMA 5D8AB 4LK6A 2QQOA 4A6OA 3VZOA 2VNGA 1EAH3 4BISA 1UY4A 4COVA 2GN3A 1BBT1 4QKDA 3AK0A 3O14A 4MGQA 4Q4W2 3LB9A 2VZ3A 5LWBA 2E6VA 1JZ3A 1FPN2 1HJFA 3N9OA 4IETA 2H0VA 1BYHA 2VOWA 3WF1A 1DGWX 4GQ7A 2ARAA 1LTEA 1RL3A 3PU8A 4IEQA 1U5IA 1CAUB 2IVIB 1CJDA 2XB6C 3DYMA 1D4M1 1PNFA 2VMIA 3VBOC 3MLJA 3DUIA 4H14A 3LIGA 4I0BA 3WDXA 1QY4A 1S0FA 1UMHA 5GZGA 1H1IA 4I3GA 2GH8A 4IW3A 2FDKA 3I3DA 4LO6B 1PGL1 4Q0PA 5DDJ1 2JIJA 3NRUA 4BWOA 3UK9A 4Q5OA 3IAPA 4QGLA 5K0UC 1FOD2 4KNCA 2V72A 3JB4C 1AYN1 1CPMA 5JWPA 4UF0A 2ENRA 1SACA 3LSDA 3ZXEA 4PLNA 4UW5A 4COWA 4Q1PA 2W1SA 4QX7A 5IHRA 1IS5A 1C8M3 4CCCA 3BPZA 4GB31 1RUI2 3UKTA 5FOBB 1N1SA 4Y1XA 2R1DA 1VALA 1X36A 1SZBA 2DVDA 2KXLA 2Y60A 2NQYA 2ZGLA 1NZCA 5L36A 5FY4A 5LATA 1RXFA 2DTYA 3M7AA 1UNBA 1Y9MA 1NY71 1HDKA 4P9LA 4JGYA 1RUE1 5C5UA 3SH3A 1YFUA 4L2NA 3IDAA 1VBE3 4QHZA 1VB2A 3AM2A 1W99A 3NMBA 1NA1B 1J1LA 3ITQA 5EXOA 4V2VA 5HPOA 2LROA 1JXNA 1TMF1 4JGZA 2YXSA 4QX2A 2RVAA 3ZIXA 3AMNA 5FKCA 2DCKA 4EWDA 3P5BA 5BNPA 5FKBA 2ZEZA 4C91A 5HXMA 3DPRC 5A33A 2ZEYA 4Q4Y2 3WNKA 4AQTA 3FN9A 1GZCA 5EWSA 3WHUA 5JVVA 5FAXA 5FMBA 2ARXA 1PVC1 2ZEXA 2CHHA 5T54A 4O7XA 1L3JA 1FATA 1H6YA 5FJHA 1W2TA 4HVRA 4K1ZA 3NSTA 3WDWA 2ZHLA 3DKWA 4HANA 4QPGA 1AR83 4LA3A 4OHVA 5E1RA 3LA2A 1WA6X 3MPBA 4H3WA 5FPVA 3SH4A 2HYXA 4M3CE 2JKXA 2ZGQA 3HVDA 1UD1A 2DUPA 5KHJA 1EV12 1RB8G 2WR9A 4LBQB 1S0JA 2XVKA 3C3VA 3NJYA 1OD5A 2K46A 3D0SA 3DCQA 3H1MA 4B3NA 5FCCA 5LBFA 1OQEA 5K9YA 2BJSA 2FCUA 5J48A 5LASA 5A6QA 3DL3A 5A7NA 3VD9A 3RVHA 1OVPA 1VAKA 1CX4A 3ATGA 1ZBE2 2XDVA 5CFDC 4Y33A 4J6GA 2BQPA 4LIVA 4XQWA 1CZVA 2QBXA 4LKEA 5C4WB 2YC2A 2X8KA 3LCPA 1KFUL 5JZGB 4CU7A 4LULA 1QHDA 2B39A 1H8VA 3I4IA 4BQ5A 4AVVA 3HNYM 2QZ2A 2WDBA 4DFSA 1C8M1 3KWVA 1F31A 4Q0UA 5AC93 3TBDA 1PMIA 5G05L 5HXVA 2W1WA 3VV1A 2G19A 5F5QA 4GJZA 4AQ2A 1VBD2 2RJLA 3SCFA 4A7KA 3WG3A 1W39A 2VOXA 2ZAHA 1H2KA 1W03A 2K0GA 1U5YA 2SLIA 3B5LB 5AVAA 1TNFA 3ZYGA 4AFAA 2QUOA 1VBE1 3KB5A 4KBBA 3AL5A 3APBA 3TNPB 1RUOA 2ZX4A 3O12A 4YVSA 2Z42A 1AL0G 1U5XA 1YQ5A 2P4EA 4Y20B 2R063 1R1A2 2K9ZA 3J7LA 2EAAA 1W6QA 3M8LA 1QJX2 4YGCA 5K4LA 4XMAA 2A5ZA 3GBGA 3GZUC 2Q1FA 2F4LA 5JI9A 3EB7A 1L7RA 3POEA 3KVBA 4YW1A 1V6JA 1PMJX 3PLQA 3QH7A 4RGAA 4YYOA 2HWC1 2VG9A 1C5HA 3SNMA 4HFSA 2DUQA 1AYM2 1T6BX 2UU8A 4BM8A 1DYPA 3NJVA 3POJA 4QGMA 2RE9A 1WMEA 3J8F2 3VL8A 1AR81 1B09A 1T6GC 3TYJA 3WX5A 1BK0A 1ULCA 3SXWA 2R7EB 3C7FA 1AL22 4AEDB 2YYOA 4Q0SA 2RS53 3VB9A 4XHBA 2LTNA 1OKQA 2Q5TA 3EQEA 4ZKTB 4ASKA 2J1SA 2JG9A 3NAPC 1D4VB 4L9BA 1RUH3 2FCVA 4AFCA 1PIV1 5A3LA 4LPLA 4NPMA 3CHXA 1XNKA 5JAXA 4ES9A 1GUIA 1OUXA 4BQ2A 2CGNA 5FXXA 4YLZA 3GXUA 4XHXA 3UT0A 2TNFA 4FAGA 1QF3A 5IVJA 1O3RA 1I6XA 4XTPA 1TG7A 2Q0AA 1WWYA 3DV8A 1O4ZA 2AUYA 4HZFA 4RR3C 4DEVA 1A78A 4W6XA 5A1LA 2JE8A 4JDOA 4LUKA 2Z79A 1OFSA 4O65A 4X8PA 5JOXA 1DU3D 4HKWA 4QPYA 3C7EA 3JCIA 2Y6LA 5AC91 3GYDA 5JSPA 4LKFA 1IS3A 3RMYA 5IK5A 3I2GA 1DQ5A 1DGRA 2TBVA 4AE2A 4IL7A 1ZZ8A 2VUCA 4Q4V3 3EJKA 4OHZA 3WNOA 2JWPA 3ZXKA 1LHVA 1H8TB 1XXNA 1W9TA 1WLDA 4META 3WF2A 4CUGA 4Q29A 1SCSA 2HWB1 2AC1A 2DDUA 4ASMB 3POBA 4R9BA 1HN0A 3UJOA 3IM0A 3AYCA 1LENA 1RXGA 2B45X 5CKMA 4GA9A 4FQ4A 4P9XA 1QJZA 2DU1A 1UU4A 1W8UA 2OA2A 5F6LB 1VBB2 2WZR2 4DUXA 1SLBA 3MV11 2HWD2 1SLCA 5D21A 1SBDA 1W2NA 3GNEA 4M00A 1GZ9A 2XBO2 4ONUA 4Q4X1 3VL9A 2CV6A 4BK5A 2CGPA 3H50A 1XNAA 1WKYA 1VMFA 2W52A 1UZ0A 1O3TA 1QGLA 3ENRA 4EZ4A 4LBKA 1WZXA 2ZABA 4QX3A 3VKNA 4JDMA 2TEPA 2RS51 1HB2A 1UY0A 1XSQA 2VAUA 3D0JA 4LK7A 4YG3A 5IJRA 2V5DA 5ACA2 4OUEA 1F35A 4YSFA 1QDOA 2HWE3 5BNOB 1SLIA 2C24A 4YPJA 4BK4A 3IMMA 3R4SA 5FZ0A 1AR92 4QQOA 4CDXA 3VZLA 1LAJA 5CG9A 1VPHA 2NP0A 1OFNA 3IDBB 3USSA 4Q1RA 4EROA 1QJY3 4XUQA 3VUOA 1SCRA 1KFXL 3FLPA 3OY8B 5FBZA 2R6QA 1W2OA 2XLFA 3QBQA 5C8CB 5FPLA 1KXGA 2Q8OA 2HJIA 4MGKE 1KJRA 2OX0A 1NA1A 4M0HA 1O8SA 3D4KA 3O0WA 3OUHA 4UFHA 3I3MA 1Z7S3 2GNDA 2LW8A 4K7JA 4NRMA 4AF9A 4B8EA 4JGYC 2MNGA 3JU9A 3AKSA 2WA3A 4O61A 3ZPOA 2WC2A 1WMDA 1GWMA 1VBA3 4Q4V1 2VBPA 2JDKA 4RL7A 5FOJB 5IVFA 3BPSA 1YWKA 4UAPA 1SLAA 4NHKA 1MS1A 2I45A 3E6BA 4CRQA 3SCGA 4TWTA 1UWWA 4FPEA 3WV6A 4BQYA 4CCNA 2RJKA 5BNPC 4OYUA 1ST8A 1Z78A 4EJRA 5CKQA 2AEZA 5FYMA 4AGVA 1SLLA 4GULA 3VDAA 5J7MA 5JSOA 3GZTB 4JVAA 2C26A 4FFIA 5KHHA 2GN7A 4BQWA 4LBQA 3W59A 2C6SA 4PIYA 4O9GA 3F95A 4QPGC 5FMOL 5I8YA 4OZXA 5E6HA 2QDRA 5GJ6A 4NIGA 1KRIA 3T2PA 3CKHA 3MIEA 4DZGA 4BCUA 3VKOA 1BBT2 2EIDA 5IK7A 4XIKA 4HXCA 3N9NA 1ZRFA 1PZ9A 4E4SA 4XF9A 5F1RA 2DUOA 5C4WA 3MW3A 4U2AA 2JENA 2ZGUA 1MEC3 2BNMA 2VXRA 5JZGA 3UKVA 1LGBA 4R4ZA 4GH4B 3Q8FA 1RVF3 4Q8KA 3ILRA 4GD4A 4LHLA 4XDPA 4XJ9A 2CY6A 1LHOA 1ULDA 2A73B 4FOYA 2RR12 2WNOA 3SCHA 3T08A 1YFWA 5T52A 2B8MA 1UN1A 4XJUA 5DG2A 3VBRC 2OPWA 5A32B 4HK8A 4AGGA 1F8VA 2BNOA 2VQAA 1MS3A 3TOJA 5DDJ2 2H6BA 3SC7X 1CAXB 3WW3A 3QD6A 5FTTC 4IE6A 3KF3A 3MF6A 4CTEA 5H9SA 3K3NA 4PLOA 3VZNA 3RJRA 2VZVA 3A0NA 3GJBA 4I2OA 5A7WB 5A70A 3VD5A 4GXLA 2NPIA 2ZMNA 1VMJA 4Y20A 3SEPA 4JV4A 1U5ZA 1YNAA 3WVJA 1J3QA 1CN1A 2J7MA 1O4TA 5HCBA 1AR72 3ZXGA 3BKZA 4CCJA 3LSEA 4M0NA 5C71A 3GBFA 5HCAA 2FDIA 1O59A 1XB9A 4MADA 3QACA 4YVSC 4YRDA 3ZYFA 4H55A 3KT4A 1YJKA 4RS5B 2JB4A 4C90A 3ZXJA 2WLQA 1NY72 3I97A 5FZOA 3OJBA 2PMWB 3MUZ1 4P14A 5KXDA 3FLTA 1J84A 4HPKB 1NLQA 4J25A 3ZSEA 3O1SA 1G9FA 1ZM1A 4Z07A 3NV4A 4AEDA 4FOQA 1CGPA 4MGTA 4XXPA 2X10A 3J9SA 1K42A 1ULEA 4OI4A 4P9IA 3UETA 3QCWA 5BY5A 4D6QA 3KV9A 2IVJA 4FQZA 1OVSA 1QKQA 1S0GA 2A6WA 5KXEA 1RUJ3 1MZ6A 4TLFA 4L11A 4XABA 3W5MA 4DY5A 1W8OA 2K2SA 3WP4A 4EYUA 1YC61 5GM0A 1UU5A 1EAH2 2G9GA 2QQNA 4I30A 4M3CB 5A3PA 1WW4A 1QXPA 1IZ3A 1NZIA 4PIXA 5BV6A 3MIHA 1PZ7A 3OYWA 3POFA 3MUY1 3VD7A 2WO7A 2JG9C 3AMQA 4B7EA 5HV0A 3HEIA 4GWMA 1AX1A 2DBIA 4Q0QA 2E7AA 4BXSV 2VZTA 5HV4A 2E53A 1MEC1 3OPZA 3IBMA 1CR7A 4P5HA 4BH9A 4UXAA 4DQAA 1JOJA 3CZUA 2VGDA 1RVF1 3UGGA 4LT5A 2D44A 4LQRA 4JKLA 3B94A 2OIIA 3AL6A 3GBWA 4IE4A 2CDPA 1OKOA 2XHKA 1NE4A 5FUIA 1V9U2 2GALA 2LALA 1AJKA 2HLEA 3WHTA 1FV3A 5A7OA 3WNMA 4AXOA 3WUDA 2RS33 1BZWA 1H8TA 1WW7A 4BQ1A 2E26A 2XJVA 2YZ4A 4ASLA 4XZPA 4UYBA 3S0MA 1DZRA 3FHAA 1DQ1A 4CEYB 1MVQA 4ZZ8A 4UOJA 4NRQA 3F2ZA 2WL1A 4BIFA 2FDFA 3AX4A 1UIKA 1V6NA 4NAMA 1HX6A 3LGRA 2Y6GA 3BTXA 1HRI1 1GNYA 1F2NA 1UY3A 1FMD3 3TEWA 3JBG3 1SLTA 5IK4A 2QCSB 1RUD3 3LE0A 4UWDA 1GP6A 2D40A 5LRSA 3H8OA 1LGNA 3RYRA 2D5FA 1V00A 5L7OC 1LHWA 5F3GA 5JOWA 5KC6A 2VCBA 3OGGA 3OB8A 5C5TA 3J7HA 2BOJA 1YQ8A 1YQ6A 3LFIA 3ACLA 2QTWB 5DZEA 4AHZA 4CDQC 1W8ZA 2WYFA 3DXUA 4YM0A 1W6PA 2CTVA 3NO8A 1VBE2 3ZMNA 3AZZA 2IZWA 1DBNA 4QKBA 4CCMA 3W21A 4QAWA 3VZMA 3CL1A 4LIUA 5BNOA 5JCTA 3A4UA 4NIHA 5FLJA 4YW3A 2W08A 4Y3OA 1RUJ1 2PQSA 4XETA 3RGBA 3WP6A 1COV2 1GP5A 2ET7A 2WWJA 3ACHA 1US3A 1KDKA 2CU5A 3LOIA 3MDPA 1UOGA 5FZDA 1YIFA 5C9AB 1FV2A 4P9GA 4PHZA 1OPOA 2V73A 5C3RA 3OY8A 4HT1T 1OLMA 4IV1B 2QDNA 1GOFA 4PLMA 4Q0VA 1W9SA 3BU0A 3RZZA 4RGKA 4COUA 4CDXC 3IMNA 1AF9A 4OQ9A 3ZR6A 1QOOA 4WVVA 2YU1A 4ZU5A 2WWSA 3LEMA 2V4VA 1DP0A 3J7NA 2EXJA 4TN7A 2YB7A 1WCKA 2YBKA 3B93A 4HLTA 1JZ2A 1W06A 2I07B 1AR61 3OCPA 5EFUA 4Z8BA 4RN5A 5ISLA 4XJAA 3PVOA 2WSVA 4XF3A 3VHRA 2RS31 3L2HA 1YI7A 3WW1A 3J26N 1NA1C 3BGAA 3I2OA 4A45A 2XOMA 3UKNA 4XAEA 4YGEA 5GZCA 3VBUB 1GOGA 3E5UA 4OQ8A 3DYOA 4QXHA 3HOBA 4ORFA 4PCRA 5FZHA 3RFRA 1UYYA 2BDRA 2D3RA 4IXLA 1AJOA 1MACA 2PXJA 4MXVA 3ZYPA 3IWZA 4LHNA 4LBQD 2DFCA 4SLIA 1FMD1 3JQXA 4HL0A 1SPPB 2GC3A 4PI0A 4BLIA 5DMYA 2ZGNA 2PHDA 4HG6B 5JLVA 1XYOA 2V09A 3K3OA 1N3PA 2R32A 2Y26A 1RINA 5ERLA 3CO2A 4XDOA 1QOSA 5FK8A 2RDQA 2BPA2 4CU8A 4FTEA 1DGLA 1HIXA 1PZ8A 2R30A 4R9AA 2RM23 1H2LA 2W91A 3INAA 3W58A 3O1PA 5IUQA 1FT9A 3PDQA 1CZSA 3HN1A 1HN1A 4OLLA 4DINB 1XNDA 1Y7BA 4P9YA 4A41A 2A6XA 3L2YA 1V6MA 2R062 2GU9A 2B46X 5FZKA 1JZ7A 1RUC1 4GKXA 2JIGA 4QB1A 2YPDA 1UYPA 2IXLA 4FFHA 5A32A 4K6BA 5C4WC 1F4AA 1JS9A 3KQRA 3WP5A 5JZGC 4LITA 1XJAA 4YGDA 4LBNA 1CAXA 2BTVC 4R9CA 3E6CC 1UZVA 2VL4A 3BTYA 4GWNA 1D4M3 3I54A 2Y8KA 3ACFA 4IUGA 2JG8A 3HPNA 5A7WA 5F5IA 1XE8A 3URFA 1VBC2 2VOVA 1A8MA 5C3SA 4FPJA 4BLJA 3KSCA 2ORXA 3E5XA 1RUNA 4XAAA 1QDCA 4Y22B 2VULA 2VQTA 2Z4FA 5IVYA 3C2UA 1BXHA 5E89A 3N7MA 4INDA 3I2IA 3PJYA 4XCBA 1RUH2 2A3WA 3NL1A 1ALYA 1NCRA 1R1ZA 1AYN3 2PHUA 2VUJA 4OVEA 5DAPA 3OBZA 1ZA7A 2GMEA 4RS5A 2VZPA 3I7DA 3SEEA 2R49A 1DG6A 1J3RA 3VD4A 3HD8B 5FZ4A 1OHFA 4BPZA 3ZO0B 4HPKA 2JD4A 1JU3A 3BUCA 2XL9A 4JTNA 2E33A 1PK6B 3O1MA 1QH6A 1JYCA 3UESA 4N90A 1VJ2A 5KHKA 1LOEA 3A23A 5JXGA 3MFCA 4NUBA 3KGLA 3MO4A 1NLSA 4Y5TA 4YZ4A 3LKJA 4N9HA 1OT5A 2VW0A 3VBSB 2PLV2 2WNUB 1RUE3 2BU9A 5FPAA 4XFBA 4DS0A 1NKGA 4AEDC 4RHV1 1IPSA 2Q1MA 2YDEA 2WAAA 4M3CA 2XJUA 5DPNA 1GNZA 3BI3A 1GU3A 4PQ9A 1S0DA 4N9IA 1AX0A 2RM21 3H7JA 4UW4A 5J3UA 1TMF3 2IXHA 3ORJA 4CP1A 2FMYA 5JIAA 2HEVF 5CFCB 3I2FA 1ASJ3 2C5DA 4GWIA 4UFJA 3MLKA 3LEIA 4IV3B 1JYVA 3WF3A 2BFUS 3B3QE 3UNPA 4N53A 1X33A 4H7LA 2BOIA 1UCXA 4XF4A 2VW1A 1QNYA 3JD72 4QB6A 1OOPB 1PVC3 1UZWA 2VZQA 3MI8A 1W0NA 2HBUA 2UYBA 4K20A 4K3UA 4BE3A 1ZRCA 2D6PA 3PUHA 1R082 1BQPA 2XJQA 4Q27A 4CEYA 2W1QA 2D6KA 1EP0A 1WGPA 2XMLA 5FXZA 3BTAA 3U4XA 4XE9A 2VW2A 4BQXA 5FWEA 5F5CA 1KJLA 2J1TA 3I59B 1H8TC 2QQJA 3CIHA 3NWKA 4AZZA 2HWE2 2UY9A 4RA0A 4QKFA 5FMCA 1MS8A 5FY5A 3K2OA 5EIYB 3AP4A 5F8PA 2VTXA 1Q5OA 1HXS3 1R092 1WMXA 5DUXA 2BBAA 5ABJB 5J96B 3T4VA 2CDOA 1ULPA 2ARCA 2E31A 2UURA 1JU4A 1GMMA 1DZTA 2OQ6A 1QJY2 3P3NA 1IPKA 2R16A 3NNMA 4ITCA 4P02B 3TEZA 3Q8EA 5A6ZA 1XOYA 1JTZX 3M4FA 2ZZQA 4ES8A 5T5PA 2J22A 2JDNA 1JMUB 4CCOA 3RJ2X 3T1MA 1UW8A 1SDWA 2BP6A 4XFFA 2CWSA 3ALQA 4L99A 4CXWA 4H2AA 2QVSB 4A2UA 3HQXA 1Z7S2 1X9TA 3GALA 4P08A 2GMMA 2WA4A 1ZZ6A 2HKXA 4MG2A 3CNAA 1XSRA 4QPIB 5A6YA 3THDA 1HKDA 2EF6A 3ZXFA 3OGSA 1G86A 4EN6B 1VBA2 2P2KA 4D69A 5C9AA 3M3OA 4LKSA 2G9FA 3MPPG 1UQXA 5CYYA 3TRSB 1DLLA 2IXIA 5J98B 2CNAA 1OA3A 2C0ZA 4YM1A 5BNOC 1GSLA 3IN9A 3OEBA 3BOWA 4ISQA 4ZY9A 1E5HA 2ILMA 1GV9A 2P17A 4XMIA 1WCQA 1ZBA3 2RJ2A 3RI9A 1TQ5A 1X8EA 4LO8A 1JYXA 4IESA 4A7ZA 1ASJ1 2DV9A 1F5JA 1HB3A 2DCYA 2PFWA 5EJ3A 1W8NA 1C1FA 2JDYA 3B9IA 5DAQA 4YZ5A 2AEYA 3G6JB 4LHSA 2HWC3 5FZ1A 1PX4A 2NN8A 4AR2A 1YCIA 5GZEA 3AXDA 4AEMA 2EA7A 4W6WA 1OLRA 4Y1VA 4C8DA 1FAYA 4XUTA 1V70A 5FY0A 5L9BA 3ACGA 4MO3M 3VBHB 1WD3A 4JDNA 3NV2A 4FP3A 3FHQA 3H1WA 4LR4A 1OBNA 3JZVA 1RITA 2XLGA 2B5HA 3WF4A 4LKDA 1LNSA 5FJKA 3HWJA 4FI9A 1NXD1 4HSLA 3ZLIA 4D8MA 3AJYA 1Q8VA 5A3NA 5JPMB 5HCHA 3BYWA 3UV9A 1URXA 4QXBA 4XW3A 3I2DA 3WD5A 4IEYA 1SPPA 2YY1A 1PIV3 1ZRRA 4J1XA 3T4HB 4G9SB 4XTMA 4Y26A 1HQWA 1TME3 4Y5SA 1HXS1 1AZDA 2ZX3A 1W6MB 1D0HA 1UX7A 1FX5A 2W94A 3IAQA 3PUQA 3QLQA 2Y0OA 1ND3B 2DYCA 3E97A 3MBWA 4KGQA 4Y1YA 2WN3A 5FMDA 4B1MA 1A8DA 4D94A 3QOPA 1S0EA 1HRV3 1OF4A 1G7YA 1YYNA 1YQ2A 4CSWA 3KCYA 2GZWA 1I5PA 3AP6A 2WS92 1C1LA 2Q8EA 1ZRDA 2ZMLA 2FMDA 2JX9A 1RMU3 2X09A 1PO11 4Q8LA 4U36A 1V0AA 4RFRB 5FR3A 1JZ4A 2Y38A 1OA2A 2O0OA 3T0DA 4BMBA 3U1XA 2AACA 2KR2A 2HWB3 5F3IA 2PYTA 5IVCA 4QT6A 3ACIA 1YI9A 1RHI2 5B2GB 4ZHNA 3SHRA 1WLTA 1Y4WA 1H9PA 1LODA 4NVPA 4NWVA 2RS11 4YW2A 4GALA 1ZBA1 1QU0A 2AREA 2XR4A 4GMP0 5H9PA 3CMGA 4RQPA 1BEV3 4CPBA 4E8CA 3C7OA 3KT7A 3LZZA 4XCAA 1LKNA 2R0HA 3ME2A 4CDWB 1J59A 3RI8A 1W0OA 3SLIA 2RMU3 4Y22A 2ZMKA 3ZFEB 5LRRA 2WABA 3ZSLA 1W8HA 4LBLA 5FLHA 3GZAA 3N3HA 4Q4X3 5FYUA 3WZ1A 1UY2A 2NMOA 1UKRA 3FBYA 1RUJ2 4PJYA 1DCSA 2JG8C 1F15A 1NCQB 2EXKA 4M01A 3PTRB 4MV2A 4RD7A 3O1TA 2NMNA 1CWPA 1F4HA 1GR3A 1OF3A 1VRH3 2WJSA 1C3HA 3LWCA 4DY3A 5IFPA 1XU1A 4NPLA 2ZGKA 4W8JA 1GQPA 4MX3A 3WY6A 5FZ8A 1V6KA 3ES1A 1JZ5A 1PK6A 1UXXX 4QM8A 1JYNA 3P6BA 4A44A 2W9XA 3B02A 1QJU2 1CONA 1NCRC 1U0AA 1OH3A 1CJPA 3H9AA 3LEKA 4RS5C 3H7YA 4X6QB 2VOTA 3PIGA 3E6DA 4H7MA 1Q8PA 5J1XA 2ZTNA 4Y4RA 4W50A 2PN5A 1WA4A 2D6LX 3EBRA 1TME1 3VBSA 3OBAA 2WNUA 3IZOA 2BZDA 1UZZA 3D8CA 2EALA 5I91A 5I8TA 4UFKA 3V0AB 1JOPA 1W2UA 3K46A 1EY2A 2LS6A 3VKMA 4CEWC 2W5FA 3NNJA 2PAEA 3WDUA 1HRV1 3LF7A 4QQ2A 1GICA 5FYCA 5A3TA 3VDCA 5B4NA 5IAXA 2WO3A 3R05A 4MVTA 3MV01 1RMU1 1WD4A 4XF0A 5D8AA 1HV1A 3ZFFB 3FZ3A 4WM8B 3N9PA 3PUAA 4IV3A 3U37A 3SKVA 5FYBA 2GNTA 3JBG2 4A4AA 3S57A 2VH9A 4A42A 5IVEA 2YG0A 4CZSA 4A7YA 1RUD2 2XJSA 5CISA 4FO9A 3D5OA 4RFT0 2OUHA 3T09A 5DAXA 3T3YA 5I0TA 3R4UA 1ZREA 3PVBB 4QQLA 4W4ZA 2JICA 1CAUA 4OHYA 4S2GA 1HV0A 5F3CA 1LESA 1X9PA 3KQ4B 2OXBA 4XXAA 1BEV1 3O7OA 4N53C 5DUWA 5FQ0B 2R041 3ZYIB 3VBOB 5FYTA 5C6CA 4BMEA 5FZLA 4CUBA 4CYDA 3H3LA 4CU9A 1EPWA 1ODNA 2RMU1 3I59A 1FNZA 3LIHA 4AI8A 1GOHA 4CP2A 1F9KA 2ATFA 1BK1A 4OI2A 2PHXA 3K48A 3KGZA 4HK9A 2JDAA 3PUIA 4CEYC 1E5RA 4JQRA 5FZGA 1P8JA 4D7TA 2CYFA 5DXDA 3VZKA 5ABJA 4YG0A 1IQDC 3WP3A 2D7FA 4QXCA 1PO22 1VRH1 5C8WA 1DQ4A 3AKQA 2R072 5TSWA 1LEDA 4V2WA 4M4RA 4DMIA 3AB0A 1RUG2 1I9RA 3T0BA 1LHNA 2A71A 2QFEA 2VBBA 3SISA 3UGHA 1GYKA 4Q4W3 3U0ZA 3LDRA 1BMV1 2ZX2A 3H3UA 2W92A 1QQP2 1FPN3 4KWKA 3HAGA 3MLLA 2PAMA 2X05A 2E32A 3IPVB 1POQA 4QPIA 2VMHA 4MLOA 1UPIA 3H42B 1PGW1 4K1YA 3WW2A 1GNHA 2P1BA 4YZ3A 1O3SA 3N35A 1AXKA 4IEWA 4AVBA 3DN7A 1D2SA 4EWEA 5JUVA 4E4DX 1G8WA 5FZ6A 4NPRA 3WDYA 2BYVE 1VAVA 2O8QA 2UYAA 3ZFGB 5D2AA 2HWF3 2ZZJA 1MVEA 1W8WA 2QQUA 1NX9A 2WFF2 1FOD3 1S1AA 3RNSA 4JKMA 3DYPA 5F32A 4JC1A 4EZHA 5T50A 5C9AC 1XYNA 2VMFA 4OZOA 2MEV2 1ULGA 5IAVA 3DPRB 4XURA 1NQDA 4UFLA 2JECA 3ZDSA 4FTBA 5FZ7A 1SBFA 4JGZC 1VIWB 4FXGB 1OH4A 2P34A 1M4WA 2C9KA 3VBHA 1J58A 1RUI3 1YEWA 2A75A 3FJSA 5FXVA 4AOCA 3MFAA 2OQ7A 3MZHA 3ZXDA 4DUVA 2VVFA 3OBTA 4CA9A 4LNVA 4PF1A 1QH7A 1VR3A 1JBCA 1HLCA 1LR5A 1U12A 3D3AA 4Q26A 4URTA 3RYKA 1CAVB 1X50A 4AL9A 4TZDA 2ZKNA 4CCEA 4MGZE 3U07A 1JHNA 2R0FA 4K9SA 3SMHA 3OBRA 1NUKA 5A3OA 2P3JA 3U14A 3LD8A 1Q8OA 3LPGA 1EUUA 1NT0A 2Q4SA 3N9MA 1R64A 5A80A 4G3YC 3PUSA 4E2SA 1GZWB 5SV8A 4CCLA 3H8XA 1YJLA 2D5HA 5LEKA 4NO4A 1AHSA 3LDBA 5EHDA 1ND3A 3OGJA 5APAA 2FCTA 3JXSA 3POIA 4JTOA 2VZRA 5LBBA 1G9AA 4Q4Y3 3AMPA 3WQ0A 1D4M2 4Q4W1 2ZAAA 3S7IA 4ISRA 4CDUB 1W9FA 4IEXA 4L97A 1XE7A 1FPN1 3HBZA 3ZN4A 1POV0 1ENXA 1PGL2 2ZHKA 1UMIA 5GLWA 1DGRN 3B7MA 5KC5A 2BVVA 3WNPA 1OXCA 5A7QA 3I3BA 3KV5A 3A21A 2VCAA 3WCSA 3BOPA 2VCCA 3GM8A 1AYN2 5E16A 3N7LA 1YFYA 4CPBD 3USUB 4LE4A 2HWF1 1HRI3 4X8NA 1FNYA 1O91A 2DURA 2J1UA 1QEXA 4HOOA 1FOD1 3ZDVA 4CDWA 1C28A 2VZUA 1ZBE3 3KCCA 3KHBA 4GB32 4QDRA 3RG0A 2XPJA 1RUF3 4FCAA 3ZFEA 4Z2AA 1UO9A 1Q8QA 3BU7A 4IDZA 2B9UA 1Q56A 2BGOA 1AVBA 2XG3A 5FRAA 5JR2A 1WBFA 5FWJA 1US2A 1H1AA 4RQPC 1NCQA 1MPXA 3WUCA 2JB8A 1RUE2 1GKBA 1RUI1 4PT6A 3DF0A 2Y6HA 4S2HA 4XUNA 4J1WA 1ULOA 1YRZA 1VBD3 1N1YA 3OG2A 4QU1A 5CIRA 3K75B 4MHUA 1YHFA 4LBMA 4XOGA 4JHZA 1TMF2 2Z2SB 3AYAA 2CL2A 5F39A 5J37A 3N7JA 3RPQA 1YQCA 5KHIA 5FZFA 4DO0A 3NAPB 4CUAA 3AKTA 5EV7A 4C1WA 2ORZA 4NIDA 2ES3A 4BDVB 2DVGA 2EAKA 2B7YA 2YGMA 1J3PA 3RRDA 1PK6C 2D6NA 3RS6A 1PVC2 2CWMA 1QJX3 4LO7A 5ANQA 5HBAA 4M4PA 3S5QA 3WXPA 2VBDA 4KWUA 4EWAA 1BVVA 1ZZ9A 2NM1A 2JDPA 4Q4Y1 1SHWB 1MS4A 3N9LA 5GKAC 2IFWA 1W6NB 4URAA 3VBSC 1AYM3 2WNUC 4N8MA 4R8HA 1N1VA 4HETA 3ZFFA 2NZ9A 1AR63 3ZN6B 4WM8A 3J8F3 3OTFA 1NXMA 2VTXJ 4YG6A 2VECA 3WG1A 3U78A 3ZIWA 5L7OB 3Q8AA 2HYKA 3NVCA 2ETEA 4ZONA 2XLAA 5C7GA 2XH6A 1GQGA 3VKLA 2WNEA 4E9KA 1D2QA 1Z0HA 4I01A 4YW5A 5DN2A 5D8AC 3TN93 4UFIA 1GWLA 4BB3A 2IUWA 4IV3C 4JQTA 5I0DA 3K4AA 5FREA 1OURA 2W1UA 3S6PA 2ZACA 5FQ0A 3OGVA 4ZXKA 3RZHA 4FP2A 1D7PM 1C8M2 1ZBE1 2Z69A 1ZRIA 1RUF1 3M3CA 5E88A 2WNVB 4GJYA 4N43B 4WVZA 3AP7A 3PTYA 4WBBA 3WNLA 4Z1VA 2FQPA 4LE3A 2VXJA 3V64A 3GGLA 3ILNA 4IEZA 5FYZA 2X5IB 3IDEA 3KMHA 3MGUA 2CSGA 4QQPA 1PVXA 4EN9B 4NE9A 4ZU4A 4TYSA 4P9WA 4AEKA 1IHMA 3CEWA 1VBD1 4D7YA 3M3EA 3IDCB 3AKPA 1MZEA 3AYEA 2Q1ZB 2UY8A 4R9DA 1W2AX 3OUJA 3ZN5A 1RUC3 3BVCA 2WUHA 5ABJC 4EN7B 1OA4A 1UIJA 2VY0A 3IPVA 2BFUL 1BJQA 4PBOA 4XC9A 5AFBA 4LTAA 3V65A 2HWC2 3A0KA 1K12A 3C7HA 2E7TA 1QJX1 1G6NA 5C8CA 1LOFA 1VBB3 1H2MA 3P3PA 3HNBM 5I0UA 5DAVA 4AFBA 4CEWB 5KBFA 1AR82 3TEYA 4MXWB 3P1IA 2HWD3 4QQHA 5T5OA 5FPXA 3ZFGA 2XBO3 4QPIC 2GDFA 5FMOS 5C3QA 5CA6A 1AYM1 2BUKA 2VQ0A 2WFPA 5CBLA 1BCXA 1W0PA 4UI9L 5FYYA 1JYIA 5IT6A 3CJIB 3J8F1 4IEPA 5K8SA 2XWJB 1BLZA 2DVFA 4MGSA 5T55A 2VMEA 3NNGA 1PIV2 1AL21 3CDZB 3LDKA 4SBVA 3JUUA 5JSRA 3VGIA 4DNYA 5ACA3 2ZHNA 1J1TA 1REDA 2LM3A 3FUOA 4TTGA 4LOSA 5DZFA 4AHXA 3HNMA 3TN91 1H30A 1AR93 1ND2B 3BALA 2JE9A 1DZQA 1ZZ7A 4IGPA 2IXJA 3ZYJB 4FPFA 2DF7A 4N7IA 1IKPA 3GCWA 5A33B 4XBQA 3ZPYA 3RZLA 2ET1A 4Z92B 3B9CA 4EN0A 2XONA 2XUMA 3VZJA 5BYNA 2W47A 2BWAA 5AC92 3D6EA 5GZFA 2YUEA 3MF9A 4AG4A 2V4AA 3VBHC 2FBEA 2VCMA 2QNKA 4UFMA 1LU2A 5FO8B 2OZ6A 4CCDA 4RHV3 4F8AA 4MZUA 1GZWA 1OQDA 4MH0E 4YW6A 1RTVA 4ZS2A 2HWB2 2YFUA 1XC6A 4XJWA 3PIJA 2RV9A 2IFRA 4XJZA 4QDQA 2QQVA 4GH4A 3KCXA 1AUYA 2ID4A 1XE0A 2ADEA 3NW4A 2VM9A 2LRPA 3AKRA 1BEV2 1XRUA 3I8TA 4CDUA 4QDSA 2GC2A 1IG0A 4E27A 1O3QA 1N3OA 1L7QA 1T2XA 4PDWB 4YW7A 1ND3C 2VZ1A 2HEYF 1TVGA 2AENA 2RMU2 2WO2A 3HT2A 3K77A 4L0PA 4NROA 4QKNA 5DAWA 3VBRB 3ZMOA 3ZR5A 3IIAA 1KD7A 4FPKA 1ENRA 2J42A 4FFFA 4Q4X2 4WVWA 5C70A 3V0BB 4GMP3 4YVWB 3VDDB 5FP9A 2O8OA 5DUVA 4GWJA 2D3PA 1VBB1 1Q8SA 2WZR1 3KVAA 4YWAA 2D98A 4HSJA 4PI2A 2GNMA 2VUAA 2WIIB 2HWD1 5A7PA 4IQPA 1VRH2 4LUMA 2DCTA 4MGYE 2BRTA 1LULA 3USUA 2XBO1 3CJXA 2RS52 5LCWL 2WQZC 2SBAA 4IE0A 2VNOA 3DECA 5FYSA 1QXRA 4ZXEA 5FP4A 4AYUA 2ZX1A 4IEUA 4XACA 1OC1A 4YM2A 5FZBA 1OPMA 3ON7A 5H9RA 2XKPA 2B42B 1E57A 3OD4A 4KG0A 3PNAA 4BQ3A 5LK7B 2EICA 3E1F1 5ACA1 3AVRA 5LZ6A 3H8RA 4CDWC 3EHKA 2BGPA 2WO1A 3ZKYA 5LA1A 1AR91 3ROUA 3OOXA 2VVEA 2E51A 3ZFEC 4AVAA 2XJTA 1W9WA 1JHJA 5FIXA 1W8FA 4DXSA 1GBGA 5IVBA 5DZGA 4AFDA 3I2HA 2VPVA 2GNBA 2AH2A 3PMSA 2A7AA 4EN8B 2F17A 4JRAA 3LQCA 1NCQC 5FFOC 1JH5A 1LU1A 4QGNA 4WV8A 5L19A 3VBFB 3VD3A 3WINE 1IKQA 1TNRA 4KI5M 3AMMA 3RZGA 2YFZA 1W04A 1MZFA 3G7DA 5EPAA 4Q4V2 4M3CF 4YNIA 1E5SA 4CUCA 2OVUA 1EYBA 1BKZA 3UJQA 4ARXA 4RGGA 1NLRA 5CAZA 3U11A 3CF6E 3WQ7A 2BVBA 4IGOA 1OLME 2A70A 5D1IA 1AR73 1W6OB 2J1RA 1IGOA 4KMQA 4XFIA 1UOBA 1RIRA 2MPFA 5F2SA 3RYPA 3TAYA 3T2QA 2XKOA 3PVNA 1JZ6A 3M1HA 4BHPA 1W6NA 3UL2A 1H2NA 5A1FA 3ETPA 1QIQA 2VVDA 4OHWA 1K5MB 3LFMA 4QX0A 4YGBA 1CVNA 3I2KA 4NHLA 2I74A 4NRPA 3WEZA 1S4CA 1VRBA 3KM5A 4QB2A 4XUOA 1JOBA 1MR5A 3ZN6A 5KXCA 1YXWA 1HJGA 3MYXA 5L7OA 3I2JA 2YMZA 3RQ0A 4BYYA 5I0SA 2FHRA 4BIOA 4GMP1 2Z5WA 4I3PA 4OCTA 2NYYA 4AGRA 4KG8A 1HW5A 1DYOA 1K3IA 1UY1A 2R1BA 3ZFFC 5FY1A 5A3UA 5FY8A 4WM8C 1DLCA 4DRRA 4FTSA 3HQRA 5A7SA 5B4XA 3O1VA 3RWKX 1CAWB 5GZDA 5IW0A 1TZOA 2GMPA 3ETQA 1MQTB 1ZNPA 1B35B 3AP5A 4JZRA 2WN2A 2WNVA 1O4YA 1XU2A 4AI1A 2WT1A 2QQLA 4N43A 3THPA 4OI1A 1C57A 4P9JA 2JDZA 3ELNA 4EE2A 3N4MA 4XQ4A 1DQ0A 2I2SA 3ECQA 3POYA 3ZKUA 5BUVA 4P5YA 3MHZA 1PM4A 1Y3TA 5FZ9A 1SFPA 4G4FA 3T2OA 2X5IA 4MYEA 2RR11 4WM7B 4CDQB 4E2GA 2WBKA 3AFKA 4NMIA 5LB6A 4OUSA 2WYSA 1V9U3 3ASIA 3KF5A 1O5LA 1UU6A 3IKWA 1QWRA 4D7SA 5BNQA 5C3PA 2E63A 3MIDA 3FFZA 4IGQA 2Q8CA 1FXZA 4XZUG 1CIWA 1PO13 2HWF2 2WAOA 4KWLA 2EIBA 2QE3A 5FV3A 2A6VA 2HEWF 2W68A 1W3VA 4JKKA 5CB7A 2IXKA 3MW2A 5JR7B 3H8UA 4B1LA 1UOJA 3NNFA 3KT1A 1D0GA 2VJXA 4FBFA 4BXFA 3KV4A 5F6KA 2D3SA 5IATA 4UBGA 1GLHA 4IV1A 3ST7A 5JPNB 2RS13 4Q2FA 1AR71 4D0QA 3GF6A 1KEXA 4CEWA 4HBNA 1EPZA 4DUWA 5L9RA 4MXWA 1KITA 1N3QA 5LK5A 1SFNA 5A6XA 2FD8A 4CDXB 1DFQA 2JD9A 2P5BA 1ONAA 4AEJA 5JMOA 1K45A 2GC1A 2P37A 1SEFA 2E7QA 3CJIA 3POGA 1LOFC 5C8CC 5F37A 1XBFA 4JX0A 1OMIA 1I1EA 3CLPA 1Q3EA 2XJPA 4AFMA 2EIEA 3ZFGC 2OKXA 3OF1A 4O9EA 4AAPA 3VBUA 1LOGA 3SITA 3VDBA 1N1TA 4HKLA 4I0AA 3ZOIA 5LA0A 1C5IA 5LBCA 1ND2A 2WSUA 1DQ6A 2HH9A 4FXKB 4CXXA 2BGCA 1MEC2 1COV3 3ILFA 4NR1A 4ZZ5A 1EAH1 3JQWA 1FI2A 2XVLA 4FT8A 4KBZA 1RVF2 2X53S 3DGTA 2VOKA 2L9LA 2GH2A 2A3YA 1CD3G 3FUQA 1X82A 5I8SA 4LEJA 1RYYA 1CZTA 1G9CA 2JXAA 1QXJA 5EJZB 5FBJA 1ZZCA 3BB6A 4XYXA 3I3QA 5KXBA 4JHTA 2VE1A 2VC9A 4B4PA 1GANA 1UX6A 2YU2A 4LMFA 5KR7A 2YV8A 3C8XA 1V9U1 2PA7A 5IWFA 1POV3 2OW4A 2DCJA 3RZMA 4AI3A 3ZXLA 5T5JA 1UKGA 2DU0A 4L8QA 4L92A 1HRI2 1TE1B 2YBSA 4MHRA 3GCXA 4NHXA 4V1PA 5BNNB 4PDWA 4LHKA 1V6IA 1RUF2 3VHPA 1PGSA 3EO6A 2CAVA 2XL7A 3MIFA 2WZPP 3VBRA 2VUDA 4Z2WA 1DDLA 3WW4A 4GH4C 4YW4A 3V0BA 3FL7A 1YO8A 1O6UA 2N7GA 4YVWA 3VDDA 1LB2A 4CDUC 1Y9QA 5GLUA 5FZIA 1AXYA 1L7LA 2O1QA 2R043 3NV1A 5GLTA 1IS6A 4QU2A 1WLCA 1PHMA 2Y64A 1V6OA 3CZJA 4NN0A 2A6YA 5IK8A 2ADDA 2Y6FA 2DVAA 1UMZA 3AP9A 2LUWA 1JUHA 1E5IA 4JCKA 1H4HA 3CBNA 3IT8A 3GZEA 5AVPA 3WR0A 3J4UH 2PHLA 2XVGA 3NKGA 4NIIA 4XPVA 4AWDA 4WZCA 5G04L 1AX2A 5FO9B 3QH6A 1COV1 2VQUA 3Q8CA 2ZA9A 5F3EA 3U75A 3WF0A 4Y1UA 1DIWA 1DHKB 1HQLA 3ZXAC 1GP4A 4HVOA 5FZ3A 4PIZA 3FE5A 4KGGA 2HBTA 4NJ4A 4WZFA 4BZ4A 3VBFA 5FZOB 1AR62 5A1AA 3AC0A 2VR4A 1ENSA 3N7KA 1VBC3 2RS32 3NJZA 4NHYA 4QX8A 5DUUA 4MGIE 2G1MA 2ZOEB 4XJ8A 1WCSA 1W6OA 3VHOA 2EVXA 4QM9A 1LOCA 1O7FA 1POV1 2OZJA 2VMCA 4LJHA 5E8AA 3TN92 3AJZA 4YFWA 5CFCA 4DXZA 4OMCA 1UYZA 4QX5A 1K5MA 1FMD2 1REEA 4FFGA 5H9QA 5A3MA 5T3NA 1OD3A 5DABA 2WT0A 1UOFA 3FLRA 3OYWB 1OOPA 2XWBB 1UYXA 3A7QA 4COYA 4ZU7A 2AGSA 2BV4A 4TSVA 5J36A 2C1FA 3ZYBA 3R4DB 5FUNA 2Y0IA 3PURA 2DVBA 2OUJA 1WCUA 1H6XA 1UXZA 4XFGA 4AI9A 4D6RA 2PQQA 2BNNA 2PLV3 1Q43A 1O5UA 3BODA 1PMHX 2UWBA 1S0BA 1CAWA 1IG3A 5GALA 1REFA 1SBEA 2ZCWA 2YC0A 1MQTA 2BEOA 4HN1A 4RSUA 3NNLA 1PNGA 4FOWA 1ULFA 4B4QA 5JDBA 2YC4A 1B35A 1X8MA 1ACCA 1VMHA 2RHPA 5FUPA 1RUC2 4PF5A 4LOTA 3H1YA 1F5FA 4AHWA 3DEMA 4COZA 5K0UB 2PHFA 1KGYA 2VMDA 3AZVA 3O1OA 4CE8A 1ODMA 2R061 2EXHA 5GLZA 2Y33A 5KWRA 4QXKA 2ZJCA 4AW7A 4K8FA 4Y1ZA 4WM7A 4CDQA 1WUVA 2WNVC 4AVCA 4CVUA 4AI0A 3AFGA 4N43C 4N7UA 3JD73 2D97A 3ZYHA 4UW3A 2ARBA 2KA3A 1QJFA 2ZEWA 3LA7A 1EUTA 5F9TA 1R083 3KD4A 2PHRA 4QPWA 4FAHA 2BW8A 1HQNA 2J1EA 1RC6A 2X5IC 4E8DA 1V6LA 2WKKA 1XNTA 4FPCA 1W6PB 5ANNA 1VBC1 1N47A 2AZ5A 4OULA 3MEPA 2FZ2A 3BN6A 3HT1A 2A6ZA 3RZKA 2WT2A 2PHTA 1C4RA 1CIYA 5FY9A 1RUH1 5FZMA 3X29B 3EYPA 2WINB 4IE5A 4AI2A 1R093 4A3XA 1ZYBA 4OI0A 1AXZA 1CPNA 2H0BA 4IV1C 4DIQA 2OPKA 2ZPXA 3AZWA 1DF0A 1JUIA 1PM7A 2P3KA 3OPTA 1IQAA 4LXLA 4XVHA 3R0RA 3WQ1A 1LHUA 2VZSA 3WT3A 5SV5A 1JW6A 4HVQA 4RHV2 5IVVA 4YZ2A 1KQRA 3NJXA 1XPWA 4YARA 1LJ7A 2RM22 3CJIC 2OS2A 2PLV1 5CADA 4EQVA 5LY2A 2P3IA 3MICA 3UYJA 4R4XA 4I09A 4AVTA 5FZAA 4A3ZA 4B29A 3W20A 3VBUC 3TEXA 2DBNA 2PELA 1CQ9A 5EYXA 4DOUA 1ND2C 3ZX7A 1W6MA 2PTMA 1IOAA 1DYKA 5CFDB 5FYHA 5LEJA 4DXTA 4WVMB 1CX1A 4E4ZA 1WW6A 3GDBA 2VO5A 2Y34A 2F4PA 3E5QA 3T2TA 3M2MA 3O5SA 2WZ8A 2VNVA 4FSJA 2J1VA 3JD71 3ZSKA 1MS5A 1QJEA 2VU9A 4BOWA 3HQUA 4K8RB 2P6CA 2JKBA 3SQOA 1R081 4HMZA 4QHOA
chains in the Genus database with same CATH topology
1GWLA 4BQ3A 1W8UA 1WCUA 2KR2A 1GWMA 1W8TA 3ORJA 3ZYHA 4CP9A 4A6SA 4LKFA 4LK6A 4LKEA 5D21A 1GWKA 4YWAA 4LJHA 4YW6A 1OKOA 4CPBD 4BQ5A 4BQ4A 4CPBA 1OH3A 1L7LA 1UOJA 2JWPA 1WMXA 2Q1FA 2VXJA 2LROA 4BQ2A 4LKDA 1W90A 1W8ZA 1WZXA 2O14A 2WYFA 2K46A 1W9FA 4LK7A 1HN0A 2LRPA 3UT0A 3ZYFA 1V0AA 4AL9A 4CP9B 1W8WA 3ZYBA 3F95A 4YW7A 2C24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWL A;  4BQ3 A;  1W8U A;  1WCU A;  2KR2 A;  1GWM A;  1W8T A;  3ORJ A;  3ZYH A;  4CP9 A;  4A6S A;  4LKF A;  4LK6 A;  4LKE A;  5D21 A;  1GWK A;  4YWA A;  4LJH A;  4YW6 A;  1OKO A;  4CPB D;  4BQ5 A;  4BQ4 A;  4CPB A;  1OH3 A;  1L7L A;  1UOJ A;  2JWP A;  1WMX A;  2Q1F A;  2VXJ A;  2LRO A;  4BQ2 A;  4LKD A;  1W90 A;  1W8Z A;  1WZX A;  2O14 A;  2WYF A;  2K46 A;  1W9F A;  4LK7 A;  1HN0 A;  2LRP A;  3UT0 A;  3ZYF A;  1V0A A;  4AL9 A;  4CP9 B;  1W8W A;  3ZYB A;  3F95 A;  4YW7 A;  2C24 A; 
#chains in the Genus database with same CATH topology
 3VHN A;  2EIG A;  2WZE A;  4HON A;  5BNN A;  2BBV A;  1I5Z A;  3PL0 A;  2ZBJ A;  4D6S A;  1EV1 3;  2C4X A;  3THT A;  3VLB B;  5CG8 A;  2GSY A;  4CP0 A;  1RJ7 A;  2DWR A;  4QHB A;  4NHM A;  2HWE 1;  1H9W A;  1NOV A;  3FMG A;  3K4Z A;  4FPO B;  2ZX0 A;  3FFQ A;  3ZM8 A;  3HMY A;  5C33 A;  4JAA A;  4KL1 A;  4PDW C;  1H4G A;  2WQ4 A;  3ABZ A;  1R09 1;  2GP5 A;  5LA2 A;  5IYY A;  4NAO A;  3WCR A;  5BPX A;  3C7G A;  3HBK A;  2QZ3 A;  3BIW E;  1QJY 1;  4CP9 B;  4MOA A;  3POW A;  1JI6 A;  4LO4 B;  4YVW C;  3VDD C;  2YBP A;  1LEM A;  2ZHM A;  5JXI A;  1YFX A;  3EMR A;  1OLQ A;  3L9J T;  1LCL A;  2YGL A;  4P00 B;  4XFH A;  3THC A;  2YRO A;  4F7Z A;  2V5Y A;  3HJR A;  4GAZ A;  2WS9 3;  2JG8 B;  1W3X A;  1MZ5 A;  3N9Q A;  2ZS6 B;  1XQN A;  3VN4 A;  4OHX A;  3AMH A;  5CKN A;  2VTF A;  2CAU A;  1Z7S 1;  4BJ0 A;  5FXW A;  2YHJ A;  3H0O A;  4AK3 A;  3AZY A;  1H1M A;  2H6C A;  4KU7 A;  3WDV A;  1IPJ A;  4X6R B;  4UBH A;  1FYU A;  1VBA 1;  1XNC A;  1LEC A;  1NCR B;  2JEM A;  1ASJ 2;  2PAK A;  4KH9 A;  1UPS A;  3TWI A;  1RHI 3;  5CU1 A;  3WLU A;  2IC1 A;  3M70 A;  4K21 A;  2FZ1 A;  1G9D A;  2ERF A;  2ZGS A;  1SMV A;  1TEI A;  1R1A 3;  1S2E A;  1NE6 A;  2JDU A;  4RYD A;  4K40 A;  5EJ1 B;  5EQU A;  3POS A;  3WG4 A;  1VAM A;  2NLR A;  4AAX A;  3V0A A;  3LA3 A;  5LY1 A;  1BHG A;  2RDR A;  1GFF 2;  1S0I A;  5LW9 A;  4RR3 B;  5EZW A;  3HIF A;  2IXC A;  4NWW A;  4OMD A;  1SFY A;  1OUS A;  2GC0 A;  4GKY A;  4Y24 A;  5FY7 A;  5GLV A;  3VBF C;  5KHG A;  3O1U A;  2Q30 A;  2JE7 A;  4BQ4 A;  1S0C A;  2WLP A;  1JYT A;  3O0X A;  4FPG A;  4GZ9 A;  1RGS A;  2JDH A;  3RDI A;  2QJV A;  4LO5 B;  4YM3 A;  2G9Z A;  2W2I A;  3DKQ A;  2GP3 A;  1W90 A;  4TXW A;  1AL2 3;  1VB4 A;  3MW4 A;  3WNX A;  5C3O A;  4DPN A;  2RDS A;  1NAE A;  3NQH A;  1S55 A;  1EV1 1;  1ZA4 A;  4PBP A;  4R52 A;  4XFA A;  1JYW A;  3LPF A;  2XGX A;  4TLG A;  5K7P A;  1HXS 2;  5CFC C;  2W95 A;  1QJU 3;  3PHM A;  2D43 A;  1OI6 A;  3WQB A;  3NKT A;  1GQH A;  4ZS3 A;  1K5M C;  3BCW A;  1ZX5 A;  5HI0 A;  2JDM A;  3VBO A;  1OOP C;  1S2K A;  1APN A;  2XUE A;  4N53 B;  1KDM A;  3SKJ E;  2P3Y A;  2QQI A;  2AR6 A;  3KLS A;  3S7E A;  1KS5 A;  2XXZ A;  5DQ0 A;  1PO1 2;  5DG1 A;  4LA2 A;  4W65 A;  3III A;  1J83 A;  1HB4 A;  3T30 A;  2FDH A;  5FPZ A;  2O14 A;  3WNN A;  5FZE A;  1Y43 B;  1SG3 A;  5K0U A;  4Y5Z 0;  2WS9 1;  4KWJ A;  1M06 G;  1CES A;  1MQT C;  4XFC A;  2W0X A;  4JRL A;  1B35 C;  3MIG A;  3S30 A;  2RS1 2;  5JXJ A;  1W8T A;  2XQX A;  3CU7 A;  3H3Z A;  1SDD B;  1ZBA 2;  2OT7 A;  1UF2 C;  1HB1 A;  4CU6 A;  3S5A A;  3KHC A;  4F3J A;  2XJR A;  4MUV A;  2G4I A;  3GHM A;  2JJ6 A;  1RHI 1;  4HN0 A;  3W5N A;  4UF0 B;  2ZKL A;  4S2D A;  3KZ4 C;  1R1A 1;  1NQJ A;  2W3J A;  2DFB A;  3ZYR A;  4WM7 C;  5L73 A;  2F6B A;  3T0A A;  5FPU A;  2BWC A;  2DTW A;  2ZGP A;  1S2B A;  3LAG A;  3M3I A;  4XUP A;  1VP6 A;  2WZR 3;  5FLI A;  3B69 A;  3B00 A;  4LBJ A;  3FWE A;  2D6O X;  3K4D A;  4XBN A;  3MIB A;  5FZC A;  4ET7 A;  5L9V A;  3PU3 A;  3R6S A;  4IEO A;  4PQQ A;  4D3W A;  1VLN A;  4DXR A;  3PME A;  1WBL A;  4XDQ A;  4Z82 A;  5EP9 A;  3FBM A;  3OGR A;  4UW6 A;  1Y9G A;  4B7K A;  4CXY A;  1ENQ A;  1UL9 A;  1G9B A;  3KV6 A;  4JGY B;  3FHI B;  4EV0 A;  1QMJ A;  2GAU A;  2A3X A;  2D93 A;  3HN3 A;  1PO2 3;  4E2Q A;  3I3E A;  3I49 A;  2RDN A;  3DPR A;  2BER A;  3KS7 A;  4DEQ A;  2R07 3;  2QQW A;  5I0R A;  5CZK A;  5HCF A;  2QQK A;  5FDB A;  1TME 2;  3TB0 A;  1RUG 3;  3RSJ A;  1OSG A;  4LLF A;  3D82 A;  4JGZ B;  3AXE A;  3RWN A;  1QJU 1;  2ZGT A;  4AHY A;  1QQP 3;  3UGF A;  4AQS A;  5BNP B;  1XYP A;  4XIO A;  2WRA A;  4CCK A;  1SQ4 A;  4FPL A;  5I93 A;  1A3K A;  5FYI A;  1HRV 2;  1CAV A;  2WQ8 A;  2OYZ A;  4YFZ A;  1NG0 A;  3Q9O A;  2CGO A;  5BXX A;  1RMU 2;  3HR9 A;  1KS4 A;  4QPG B;  4UT5 A;  3M3Q A;  1GWK A;  2E9Q A;  3RMX A;  3VKF C;  1VE0 A;  1MS0 A;  3FC0 A;  1DGW A;  2Q8D A;  1JZ8 A;  2J1A A;  5CFD A;  2WFF 3;  3RZJ A;  5FO7 B;  4NIA A;  5LA9 A;  1QOT A;  4I02 A;  4B4R A;  2ZGR A;  4WVM A;  2YPJ A;  2AYH A;  1LOB A;  4QWN A;  5CVR A;  1GZT A;  2MEV 3;  5EYY A;  2B9V A;  1OQ1 A;  3OSD A;  3JBG 1;  4NOT A;  3A22 A;  1RUD 1;  4LOR A;  4OUM A;  4XBL A;  1LOA A;  2R04 2;  1WLW A;  2RG4 A;  2P6H A;  2Y6K A;  1DQ2 A;  1ZZB A;  3N36 A;  5A3W A;  2Y6J A;  1RJ8 A;  4FPH A;  3WOG A;  3WG2 A;  4C0H A;  2B4K A;  1I3H A;  4Y4Y A;  1BVP 1;  2IWG B;  2UWA A;  1O8P A;  3O0V A;  4A6S A;  3OUI A;  1LRH A;  5LBE A;  3LEG A;  3Q8B A;  3BIE A;  2PHW A;  4MSV A;  1JOD A;  4HKO A;  5JOY A;  5FP8 A;  4I0W B;  1A34 A;  3TNQ A;  2D6M A;  1H0B A;  3JB8 A;  4W6Y A;  4ZPI A;  2W39 A;  5T5L A;  2XQR A;  3OEA A;  5J09 A;  4QX1 A;  2EXI A;  4XIL A;  3AYD A;  5FPB A;  2QQP A;  3B01 A;  4ATE A;  2FDJ A;  2ZGM A;  4QMA A;  2W46 A;  4S2F A;  5BNN C;  1W28 A;  3T1L A;  1BBT 3;  1YIP A;  3K51 A;  5JXH A;  1BMV 2;  5CEH A;  4KU8 A;  2UWC A;  2VNR A;  1PO2 1;  2VZO A;  4IER A;  2FDG A;  4CP9 A;  2XHN A;  2DCZ A;  3EXU A;  2R07 1;  4IEV A;  4YZ1 A;  1WW5 A;  4XF1 A;  2QQM A;  1X7N A;  4YVS B;  2VMG A;  1RUG 1;  3O1R A;  3NV3 A;  1LGC A;  1YLL A;  3CQO A;  5AFE A;  1PGW 2;  2VD7 A;  4C1X A;  1W6Q B;  4RQP B;  1QQP 1;  2W87 A;  2RR1 3;  3OPW A;  3OD0 A;  3GHN A;  4F83 A;  2KM2 A;  2MHF A;  3PVE A;  5F7U A;  5DDJ 3;  4AQ6 A;  3AZX A;  3J7M A;  1MS9 A;  4QD2 A;  4FPY A;  5IFT A;  1WCD J;  3U10 A;  3FX3 A;  3LOB A;  4LLO A;  4GIQ A;  1UAI A;  5F5A A;  2ZXQ A;  3NAP A;  5JIU A;  4OFG A;  2TUN A;  2KD7 A;  1A6C A;  2ZGO A;  3U4S A;  3ZSM A;  4BU2 A;  3SH5 A;  1XNB A;  4C0B A;  4KQ7 A;  5FYV A;  5FK7 A;  1W05 A;  3WDT A;  4BA6 A;  4DRV A;  3BTZ A;  3DXT A;  2WFF 1;  4ATF A;  2WWU A;  2C9A A;  1IS4 A;  1W9Y A;  2JG9 B;  4GB3 3;  4XEZ A;  1K5J A;  2MEV 1;  4RR3 A;  3WSO A;  1ZVF A;  1C8N A;  2QKD A;  2X29 A;  4FVV A;  1PX3 A;  1UZY A;  4LBO A;  3ZSJ A;  4DB5 A;  5F2W A;  3ZVX A;  1WMF A;  4IE7 A;  5JOZ A;  4FOV A;  4E4H A;  3ES4 A;  3GJA A;  5JMC A;  1QNW A;  1YUD A;  1JN2 P;  3AVS A;  4ARY A;  5FP7 A;  4XQD A;  3IB3 A;  4AVS A;  2A1X A;  5FP3 A;  3PJQ A;  3W9A A;  5JI7 A;  5CNA A;  3V56 A;  1NYW A;  5M0T A;  1STM A;  5D8A B;  4LK6 A;  2QQO A;  4A6O A;  3VZO A;  2VNG A;  1EAH 3;  4BIS A;  1UY4 A;  4COV A;  2GN3 A;  1BBT 1;  4QKD A;  3AK0 A;  3O14 A;  4MGQ A;  4Q4W 2;  3LB9 A;  2VZ3 A;  5LWB A;  2E6V A;  1JZ3 A;  1FPN 2;  1HJF A;  3N9O A;  4IET A;  2H0V A;  1BYH A;  2VOW A;  3WF1 A;  1DGW X;  4GQ7 A;  2ARA A;  1LTE A;  1RL3 A;  3PU8 A;  4IEQ A;  1U5I A;  1CAU B;  2IVI B;  1CJD A;  2XB6 C;  3DYM A;  1D4M 1;  1PNF A;  2VMI A;  3VBO C;  3MLJ A;  3DUI A;  4H14 A;  3LIG A;  4I0B A;  3WDX A;  1QY4 A;  1S0F A;  1UMH A;  5GZG A;  1H1I A;  4I3G A;  2GH8 A;  4IW3 A;  2FDK A;  3I3D A;  4LO6 B;  1PGL 1;  4Q0P A;  5DDJ 1;  2JIJ A;  3NRU A;  4BWO A;  3UK9 A;  4Q5O A;  3IAP A;  4QGL A;  5K0U C;  1FOD 2;  4KNC A;  2V72 A;  3JB4 C;  1AYN 1;  1CPM A;  5JWP A;  4UF0 A;  2ENR A;  1SAC A;  3LSD A;  3ZXE A;  4PLN A;  4UW5 A;  4COW A;  4Q1P A;  2W1S A;  4QX7 A;  5IHR A;  1IS5 A;  1C8M 3;  4CCC A;  3BPZ A;  4GB3 1;  1RUI 2;  3UKT A;  5FOB B;  1N1S A;  4Y1X A;  2R1D A;  1VAL A;  1X36 A;  1SZB A;  2DVD A;  2KXL A;  2Y60 A;  2NQY A;  2ZGL A;  1NZC A;  5L36 A;  5FY4 A;  5LAT A;  1RXF A;  2DTY A;  3M7A A;  1UNB A;  1Y9M A;  1NY7 1;  1HDK A;  4P9L A;  4JGY A;  1RUE 1;  5C5U A;  3SH3 A;  1YFU A;  4L2N A;  3IDA A;  1VBE 3;  4QHZ A;  1VB2 A;  3AM2 A;  1W99 A;  3NMB A;  1NA1 B;  1J1L A;  3ITQ A;  5EXO A;  4V2V A;  5HPO A;  2LRO A;  1JXN A;  1TMF 1;  4JGZ A;  2YXS A;  4QX2 A;  2RVA A;  3ZIX A;  3AMN A;  5FKC A;  2DCK A;  4EWD A;  3P5B A;  5BNP A;  5FKB A;  2ZEZ A;  4C91 A;  5HXM A;  3DPR C;  5A33 A;  2ZEY A;  4Q4Y 2;  3WNK A;  4AQT A;  3FN9 A;  1GZC A;  5EWS A;  3WHU A;  5JVV A;  5FAX A;  5FMB A;  2ARX A;  1PVC 1;  2ZEX A;  2CHH A;  5T54 A;  4O7X A;  1L3J A;  1FAT A;  1H6Y A;  5FJH A;  1W2T A;  4HVR A;  4K1Z A;  3NST A;  3WDW A;  2ZHL A;  3DKW A;  4HAN A;  4QPG A;  1AR8 3;  4LA3 A;  4OHV A;  5E1R A;  3LA2 A;  1WA6 X;  3MPB A;  4H3W A;  5FPV A;  3SH4 A;  2HYX A;  4M3C E;  2JKX A;  2ZGQ A;  3HVD A;  1UD1 A;  2DUP A;  5KHJ A;  1EV1 2;  1RB8 G;  2WR9 A;  4LBQ B;  1S0J A;  2XVK A;  3C3V A;  3NJY A;  1OD5 A;  2K46 A;  3D0S A;  3DCQ A;  3H1M A;  4B3N A;  5FCC A;  5LBF A;  1OQE A;  5K9Y A;  2BJS A;  2FCU A;  5J48 A;  5LAS A;  5A6Q A;  3DL3 A;  5A7N A;  3VD9 A;  3RVH A;  1OVP A;  1VAK A;  1CX4 A;  3ATG A;  1ZBE 2;  2XDV A;  5CFD C;  4Y33 A;  4J6G A;  2BQP A;  4LIV A;  4XQW A;  1CZV A;  2QBX A;  4LKE A;  5C4W B;  2YC2 A;  2X8K A;  3LCP A;  1KFU L;  5JZG B;  4CU7 A;  4LUL A;  1QHD A;  2B39 A;  1H8V A;  3I4I A;  4BQ5 A;  4AVV A;  3HNY M;  2QZ2 A;  2WDB A;  4DFS A;  1C8M 1;  3KWV A;  1F31 A;  4Q0U A;  5AC9 3;  3TBD A;  1PMI A;  5G05 L;  5HXV A;  2W1W A;  3VV1 A;  2G19 A;  5F5Q A;  4GJZ A;  4AQ2 A;  1VBD 2;  2RJL A;  3SCF A;  4A7K A;  3WG3 A;  1W39 A;  2VOX A;  2ZAH A;  1H2K A;  1W03 A;  2K0G A;  1U5Y A;  2SLI A;  3B5L B;  5AVA A;  1TNF A;  3ZYG A;  4AFA A;  2QUO A;  1VBE 1;  3KB5 A;  4KBB A;  3AL5 A;  3APB A;  3TNP B;  1RUO A;  2ZX4 A;  3O12 A;  4YVS A;  2Z42 A;  1AL0 G;  1U5X A;  1YQ5 A;  2P4E A;  4Y20 B;  2R06 3;  1R1A 2;  2K9Z A;  3J7L A;  2EAA A;  1W6Q A;  3M8L A;  1QJX 2;  4YGC A;  5K4L A;  4XMA A;  2A5Z A;  3GBG A;  3GZU C;  2Q1F A;  2F4L A;  5JI9 A;  3EB7 A;  1L7R A;  3POE A;  3KVB A;  4YW1 A;  1V6J A;  1PMJ X;  3PLQ A;  3QH7 A;  4RGA A;  4YYO A;  2HWC 1;  2VG9 A;  1C5H A;  3SNM A;  4HFS A;  2DUQ A;  1AYM 2;  1T6B X;  2UU8 A;  4BM8 A;  1DYP A;  3NJV A;  3POJ A;  4QGM A;  2RE9 A;  1WME A;  3J8F 2;  3VL8 A;  1AR8 1;  1B09 A;  1T6G C;  3TYJ A;  3WX5 A;  1BK0 A;  1ULC A;  3SXW A;  2R7E B;  3C7F A;  1AL2 2;  4AED B;  2YYO A;  4Q0S A;  2RS5 3;  3VB9 A;  4XHB A;  2LTN A;  1OKQ A;  2Q5T A;  3EQE A;  4ZKT B;  4ASK A;  2J1S A;  2JG9 A;  3NAP C;  1D4V B;  4L9B A;  1RUH 3;  2FCV A;  4AFC A;  1PIV 1;  5A3L A;  4LPL A;  4NPM A;  3CHX A;  1XNK A;  5JAX A;  4ES9 A;  1GUI A;  1OUX A;  4BQ2 A;  2CGN A;  5FXX A;  4YLZ A;  3GXU A;  4XHX A;  3UT0 A;  2TNF A;  4FAG A;  1QF3 A;  5IVJ A;  1O3R A;  1I6X A;  4XTP A;  1TG7 A;  2Q0A A;  1WWY A;  3DV8 A;  1O4Z A;  2AUY A;  4HZF A;  4RR3 C;  4DEV A;  1A78 A;  4W6X A;  5A1L A;  2JE8 A;  4JDO A;  4LUK A;  2Z79 A;  1OFS A;  4O65 A;  4X8P A;  5JOX A;  1DU3 D;  4HKW A;  4QPY A;  3C7E A;  3JCI A;  2Y6L A;  5AC9 1;  3GYD A;  5JSP A;  4LKF A;  1IS3 A;  3RMY A;  5IK5 A;  3I2G A;  1DQ5 A;  1DGR A;  2TBV A;  4AE2 A;  4IL7 A;  1ZZ8 A;  2VUC A;  4Q4V 3;  3EJK A;  4OHZ A;  3WNO A;  2JWP A;  3ZXK A;  1LHV A;  1H8T B;  1XXN A;  1W9T A;  1WLD A;  4MET A;  3WF2 A;  4CUG A;  4Q29 A;  1SCS A;  2HWB 1;  2AC1 A;  2DDU A;  4ASM B;  3POB A;  4R9B A;  1HN0 A;  3UJO A;  3IM0 A;  3AYC A;  1LEN A;  1RXG A;  2B45 X;  5CKM A;  4GA9 A;  4FQ4 A;  4P9X A;  1QJZ A;  2DU1 A;  1UU4 A;  1W8U A;  2OA2 A;  5F6L B;  1VBB 2;  2WZR 2;  4DUX A;  1SLB A;  3MV1 1;  2HWD 2;  1SLC A;  5D21 A;  1SBD A;  1W2N A;  3GNE A;  4M00 A;  1GZ9 A;  2XBO 2;  4ONU A;  4Q4X 1;  3VL9 A;  2CV6 A;  4BK5 A;  2CGP A;  3H50 A;  1XNA A;  1WKY A;  1VMF A;  2W52 A;  1UZ0 A;  1O3T A;  1QGL A;  3ENR A;  4EZ4 A;  4LBK A;  1WZX A;  2ZAB A;  4QX3 A;  3VKN A;  4JDM A;  2TEP A;  2RS5 1;  1HB2 A;  1UY0 A;  1XSQ A;  2VAU A;  3D0J A;  4LK7 A;  4YG3 A;  5IJR A;  2V5D A;  5ACA 2;  4OUE A;  1F35 A;  4YSF A;  1QDO A;  2HWE 3;  5BNO B;  1SLI A;  2C24 A;  4YPJ A;  4BK4 A;  3IMM A;  3R4S A;  5FZ0 A;  1AR9 2;  4QQO A;  4CDX A;  3VZL A;  1LAJ A;  5CG9 A;  1VPH A;  2NP0 A;  1OFN A;  3IDB B;  3USS A;  4Q1R A;  4ERO A;  1QJY 3;  4XUQ A;  3VUO A;  1SCR A;  1KFX L;  3FLP A;  3OY8 B;  5FBZ A;  2R6Q A;  1W2O A;  2XLF A;  3QBQ A;  5C8C B;  5FPL A;  1KXG A;  2Q8O A;  2HJI A;  4MGK E;  1KJR A;  2OX0 A;  1NA1 A;  4M0H A;  1O8S A;  3D4K A;  3O0W A;  3OUH A;  4UFH A;  3I3M A;  1Z7S 3;  2GND A;  2LW8 A;  4K7J A;  4NRM A;  4AF9 A;  4B8E A;  4JGY C;  2MNG A;  3JU9 A;  3AKS A;  2WA3 A;  4O61 A;  3ZPO A;  2WC2 A;  1WMD A;  1GWM A;  1VBA 3;  4Q4V 1;  2VBP A;  2JDK A;  4RL7 A;  5FOJ B;  5IVF A;  3BPS A;  1YWK A;  4UAP A;  1SLA A;  4NHK A;  1MS1 A;  2I45 A;  3E6B A;  4CRQ A;  3SCG A;  4TWT A;  1UWW A;  4FPE A;  3WV6 A;  4BQY A;  4CCN A;  2RJK A;  5BNP C;  4OYU A;  1ST8 A;  1Z78 A;  4EJR A;  5CKQ A;  2AEZ A;  5FYM A;  4AGV A;  1SLL A;  4GUL A;  3VDA A;  5J7M A;  5JSO A;  3GZT B;  4JVA A;  2C26 A;  4FFI A;  5KHH A;  2GN7 A;  4BQW A;  4LBQ A;  3W59 A;  2C6S A;  4PIY A;  4O9G A;  3F95 A;  4QPG C;  5FMO L;  5I8Y A;  4OZX A;  5E6H A;  2QDR A;  5GJ6 A;  4NIG A;  1KRI A;  3T2P A;  3CKH A;  3MIE A;  4DZG A;  4BCU A;  3VKO A;  1BBT 2;  2EID A;  5IK7 A;  4XIK A;  4HXC A;  3N9N A;  1ZRF A;  1PZ9 A;  4E4S A;  4XF9 A;  5F1R A;  2DUO A;  5C4W A;  3MW3 A;  4U2A A;  2JEN A;  2ZGU A;  1MEC 3;  2BNM A;  2VXR A;  5JZG A;  3UKV A;  1LGB A;  4R4Z A;  4GH4 B;  3Q8F A;  1RVF 3;  4Q8K A;  3ILR A;  4GD4 A;  4LHL A;  4XDP A;  4XJ9 A;  2CY6 A;  1LHO A;  1ULD A;  2A73 B;  4FOY A;  2RR1 2;  2WNO A;  3SCH A;  3T08 A;  1YFW A;  5T52 A;  2B8M A;  1UN1 A;  4XJU A;  5DG2 A;  3VBR C;  2OPW A;  5A32 B;  4HK8 A;  4AGG A;  1F8V A;  2BNO A;  2VQA A;  1MS3 A;  3TOJ A;  5DDJ 2;  2H6B A;  3SC7 X;  1CAX B;  3WW3 A;  3QD6 A;  5FTT C;  4IE6 A;  3KF3 A;  3MF6 A;  4CTE A;  5H9S A;  3K3N A;  4PLO A;  3VZN A;  3RJR A;  2VZV A;  3A0N A;  3GJB A;  4I2O A;  5A7W B;  5A70 A;  3VD5 A;  4GXL A;  2NPI A;  2ZMN A;  1VMJ A;  4Y20 A;  3SEP A;  4JV4 A;  1U5Z A;  1YNA A;  3WVJ A;  1J3Q A;  1CN1 A;  2J7M A;  1O4T A;  5HCB A;  1AR7 2;  3ZXG A;  3BKZ A;  4CCJ A;  3LSE A;  4M0N A;  5C71 A;  3GBF A;  5HCA A;  2FDI A;  1O59 A;  1XB9 A;  4MAD A;  3QAC A;  4YVS C;  4YRD A;  3ZYF A;  4H55 A;  3KT4 A;  1YJK A;  4RS5 B;  2JB4 A;  4C90 A;  3ZXJ A;  2WLQ A;  1NY7 2;  3I97 A;  5FZO A;  3OJB A;  2PMW B;  3MUZ 1;  4P14 A;  5KXD A;  3FLT A;  1J84 A;  4HPK B;  1NLQ A;  4J25 A;  3ZSE A;  3O1S A;  1G9F A;  1ZM1 A;  4Z07 A;  3NV4 A;  4AED A;  4FOQ A;  1CGP A;  4MGT A;  4XXP A;  2X10 A;  3J9S A;  1K42 A;  1ULE A;  4OI4 A;  4P9I A;  3UET A;  3QCW A;  5BY5 A;  4D6Q A;  3KV9 A;  2IVJ A;  4FQZ A;  1OVS A;  1QKQ A;  1S0G A;  2A6W A;  5KXE A;  1RUJ 3;  1MZ6 A;  4TLF A;  4L11 A;  4XAB A;  3W5M A;  4DY5 A;  1W8O A;  2K2S A;  3WP4 A;  4EYU A;  1YC6 1;  5GM0 A;  1UU5 A;  1EAH 2;  2G9G A;  2QQN A;  4I30 A;  4M3C B;  5A3P A;  1WW4 A;  1QXP A;  1IZ3 A;  1NZI A;  4PIX A;  5BV6 A;  3MIH A;  1PZ7 A;  3OYW A;  3POF A;  3MUY 1;  3VD7 A;  2WO7 A;  2JG9 C;  3AMQ A;  4B7E A;  5HV0 A;  3HEI A;  4GWM A;  1AX1 A;  2DBI A;  4Q0Q A;  2E7A A;  4BXS V;  2VZT A;  5HV4 A;  2E53 A;  1MEC 1;  3OPZ A;  3IBM A;  1CR7 A;  4P5H A;  4BH9 A;  4UXA A;  4DQA A;  1JOJ A;  3CZU A;  2VGD A;  1RVF 1;  3UGG A;  4LT5 A;  2D44 A;  4LQR A;  4JKL A;  3B94 A;  2OII A;  3AL6 A;  3GBW A;  4IE4 A;  2CDP A;  1OKO A;  2XHK A;  1NE4 A;  5FUI A;  1V9U 2;  2GAL A;  2LAL A;  1AJK A;  2HLE A;  3WHT A;  1FV3 A;  5A7O A;  3WNM A;  4AXO A;  3WUD A;  2RS3 3;  1BZW A;  1H8T A;  1WW7 A;  4BQ1 A;  2E26 A;  2XJV A;  2YZ4 A;  4ASL A;  4XZP A;  4UYB A;  3S0M A;  1DZR A;  3FHA A;  1DQ1 A;  4CEY B;  1MVQ A;  4ZZ8 A;  4UOJ A;  4NRQ A;  3F2Z A;  2WL1 A;  4BIF A;  2FDF A;  3AX4 A;  1UIK A;  1V6N A;  4NAM A;  1HX6 A;  3LGR A;  2Y6G A;  3BTX A;  1HRI 1;  1GNY A;  1F2N A;  1UY3 A;  1FMD 3;  3TEW A;  3JBG 3;  1SLT A;  5IK4 A;  2QCS B;  1RUD 3;  3LE0 A;  4UWD A;  1GP6 A;  2D40 A;  5LRS A;  3H8O A;  1LGN A;  3RYR A;  2D5F A;  1V00 A;  5L7O C;  1LHW A;  5F3G A;  5JOW A;  5KC6 A;  2VCB A;  3OGG A;  3OB8 A;  5C5T A;  3J7H A;  2BOJ A;  1YQ8 A;  1YQ6 A;  3LFI A;  3ACL A;  2QTW B;  5DZE A;  4AHZ A;  4CDQ C;  1W8Z A;  2WYF A;  3DXU A;  4YM0 A;  1W6P A;  2CTV A;  3NO8 A;  1VBE 2;  3ZMN A;  3AZZ A;  2IZW A;  1DBN A;  4QKB A;  4CCM A;  3W21 A;  4QAW A;  3VZM A;  3CL1 A;  4LIU A;  5BNO A;  5JCT A;  3A4U A;  4NIH A;  5FLJ A;  4YW3 A;  2W08 A;  4Y3O A;  1RUJ 1;  2PQS A;  4XET A;  3RGB A;  3WP6 A;  1COV 2;  1GP5 A;  2ET7 A;  2WWJ A;  3ACH A;  1US3 A;  1KDK A;  2CU5 A;  3LOI A;  3MDP A;  1UOG A;  5FZD A;  1YIF A;  5C9A B;  1FV2 A;  4P9G A;  4PHZ A;  1OPO A;  2V73 A;  5C3R A;  3OY8 A;  4HT1 T;  1OLM A;  4IV1 B;  2QDN A;  1GOF A;  4PLM A;  4Q0V A;  1W9S A;  3BU0 A;  3RZZ A;  4RGK A;  4COU A;  4CDX C;  3IMN A;  1AF9 A;  4OQ9 A;  3ZR6 A;  1QOO A;  4WVV A;  2YU1 A;  4ZU5 A;  2WWS A;  3LEM A;  2V4V A;  1DP0 A;  3J7N A;  2EXJ A;  4TN7 A;  2YB7 A;  1WCK A;  2YBK A;  3B93 A;  4HLT A;  1JZ2 A;  1W06 A;  2I07 B;  1AR6 1;  3OCP A;  5EFU A;  4Z8B A;  4RN5 A;  5ISL A;  4XJA A;  3PVO A;  2WSV A;  4XF3 A;  3VHR A;  2RS3 1;  3L2H A;  1YI7 A;  3WW1 A;  3J26 N;  1NA1 C;  3BGA A;  3I2O A;  4A45 A;  2XOM A;  3UKN A;  4XAE A;  4YGE A;  5GZC A;  3VBU B;  1GOG A;  3E5U A;  4OQ8 A;  3DYO A;  4QXH A;  3HOB A;  4ORF A;  4PCR A;  5FZH A;  3RFR A;  1UYY A;  2BDR A;  2D3R A;  4IXL A;  1AJO A;  1MAC A;  2PXJ A;  4MXV A;  3ZYP A;  3IWZ A;  4LHN A;  4LBQ D;  2DFC A;  4SLI A;  1FMD 1;  3JQX A;  4HL0 A;  1SPP B;  2GC3 A;  4PI0 A;  4BLI A;  5DMY A;  2ZGN A;  2PHD A;  4HG6 B;  5JLV A;  1XYO A;  2V09 A;  3K3O A;  1N3P A;  2R32 A;  2Y26 A;  1RIN A;  5ERL A;  3CO2 A;  4XDO A;  1QOS A;  5FK8 A;  2RDQ A;  2BPA 2;  4CU8 A;  4FTE A;  1DGL A;  1HIX A;  1PZ8 A;  2R30 A;  4R9A A;  2RM2 3;  1H2L A;  2W91 A;  3INA A;  3W58 A;  3O1P A;  5IUQ A;  1FT9 A;  3PDQ A;  1CZS A;  3HN1 A;  1HN1 A;  4OLL A;  4DIN B;  1XND A;  1Y7B A;  4P9Y A;  4A41 A;  2A6X A;  3L2Y A;  1V6M A;  2R06 2;  2GU9 A;  2B46 X;  5FZK A;  1JZ7 A;  1RUC 1;  4GKX A;  2JIG A;  4QB1 A;  2YPD A;  1UYP A;  2IXL A;  4FFH A;  5A32 A;  4K6B A;  5C4W C;  1F4A A;  1JS9 A;  3KQR A;  3WP5 A;  5JZG C;  4LIT A;  1XJA A;  4YGD A;  4LBN A;  1CAX A;  2BTV C;  4R9C A;  3E6C C;  1UZV A;  2VL4 A;  3BTY A;  4GWN A;  1D4M 3;  3I54 A;  2Y8K A;  3ACF A;  4IUG A;  2JG8 A;  3HPN A;  5A7W A;  5F5I A;  1XE8 A;  3URF A;  1VBC 2;  2VOV A;  1A8M A;  5C3S A;  4FPJ A;  4BLJ A;  3KSC A;  2ORX A;  3E5X A;  1RUN A;  4XAA A;  1QDC A;  4Y22 B;  2VUL A;  2VQT A;  2Z4F A;  5IVY A;  3C2U A;  1BXH A;  5E89 A;  3N7M A;  4IND A;  3I2I A;  3PJY A;  4XCB A;  1RUH 2;  2A3W A;  3NL1 A;  1ALY A;  1NCR A;  1R1Z A;  1AYN 3;  2PHU A;  2VUJ A;  4OVE A;  5DAP A;  3OBZ A;  1ZA7 A;  2GME A;  4RS5 A;  2VZP A;  3I7D A;  3SEE A;  2R49 A;  1DG6 A;  1J3R A;  3VD4 A;  3HD8 B;  5FZ4 A;  1OHF A;  4BPZ A;  3ZO0 B;  4HPK A;  2JD4 A;  1JU3 A;  3BUC A;  2XL9 A;  4JTN A;  2E33 A;  1PK6 B;  3O1M A;  1QH6 A;  1JYC A;  3UES A;  4N90 A;  1VJ2 A;  5KHK A;  1LOE A;  3A23 A;  5JXG A;  3MFC A;  4NUB A;  3KGL A;  3MO4 A;  1NLS A;  4Y5T A;  4YZ4 A;  3LKJ A;  4N9H A;  1OT5 A;  2VW0 A;  3VBS B;  2PLV 2;  2WNU B;  1RUE 3;  2BU9 A;  5FPA A;  4XFB A;  4DS0 A;  1NKG A;  4AED C;  4RHV 1;  1IPS A;  2Q1M A;  2YDE A;  2WAA A;  4M3C A;  2XJU A;  5DPN A;  1GNZ A;  3BI3 A;  1GU3 A;  4PQ9 A;  1S0D A;  4N9I A;  1AX0 A;  2RM2 1;  3H7J A;  4UW4 A;  5J3U A;  1TMF 3;  2IXH A;  3ORJ A;  4CP1 A;  2FMY A;  5JIA A;  2HEV F;  5CFC B;  3I2F A;  1ASJ 3;  2C5D A;  4GWI A;  4UFJ A;  3MLK A;  3LEI A;  4IV3 B;  1JYV A;  3WF3 A;  2BFU S;  3B3Q E;  3UNP A;  4N53 A;  1X33 A;  4H7L A;  2BOI A;  1UCX A;  4XF4 A;  2VW1 A;  1QNY A;  3JD7 2;  4QB6 A;  1OOP B;  1PVC 3;  1UZW A;  2VZQ A;  3MI8 A;  1W0N A;  2HBU A;  2UYB A;  4K20 A;  4K3U A;  4BE3 A;  1ZRC A;  2D6P A;  3PUH A;  1R08 2;  1BQP A;  2XJQ A;  4Q27 A;  4CEY A;  2W1Q A;  2D6K A;  1EP0 A;  1WGP A;  2XML A;  5FXZ A;  3BTA A;  3U4X A;  4XE9 A;  2VW2 A;  4BQX A;  5FWE A;  5F5C A;  1KJL A;  2J1T A;  3I59 B;  1H8T C;  2QQJ A;  3CIH A;  3NWK A;  4AZZ A;  2HWE 2;  2UY9 A;  4RA0 A;  4QKF A;  5FMC A;  1MS8 A;  5FY5 A;  3K2O A;  5EIY B;  3AP4 A;  5F8P A;  2VTX A;  1Q5O A;  1HXS 3;  1R09 2;  1WMX A;  5DUX A;  2BBA A;  5ABJ B;  5J96 B;  3T4V A;  2CDO A;  1ULP A;  2ARC A;  2E31 A;  2UUR A;  1JU4 A;  1GMM A;  1DZT A;  2OQ6 A;  1QJY 2;  3P3N A;  1IPK A;  2R16 A;  3NNM A;  4ITC A;  4P02 B;  3TEZ A;  3Q8E A;  5A6Z A;  1XOY A;  1JTZ X;  3M4F A;  2ZZQ A;  4ES8 A;  5T5P A;  2J22 A;  2JDN A;  1JMU B;  4CCO A;  3RJ2 X;  3T1M A;  1UW8 A;  1SDW A;  2BP6 A;  4XFF A;  2CWS A;  3ALQ A;  4L99 A;  4CXW A;  4H2A A;  2QVS B;  4A2U A;  3HQX A;  1Z7S 2;  1X9T A;  3GAL A;  4P08 A;  2GMM A;  2WA4 A;  1ZZ6 A;  2HKX A;  4MG2 A;  3CNA A;  1XSR A;  4QPI B;  5A6Y A;  3THD A;  1HKD A;  2EF6 A;  3ZXF A;  3OGS A;  1G86 A;  4EN6 B;  1VBA 2;  2P2K A;  4D69 A;  5C9A A;  3M3O A;  4LKS A;  2G9F A;  3MPP G;  1UQX A;  5CYY A;  3TRS B;  1DLL A;  2IXI A;  5J98 B;  2CNA A;  1OA3 A;  2C0Z A;  4YM1 A;  5BNO C;  1GSL A;  3IN9 A;  3OEB A;  3BOW A;  4ISQ A;  4ZY9 A;  1E5H A;  2ILM A;  1GV9 A;  2P17 A;  4XMI A;  1WCQ A;  1ZBA 3;  2RJ2 A;  3RI9 A;  1TQ5 A;  1X8E A;  4LO8 A;  1JYX A;  4IES A;  4A7Z A;  1ASJ 1;  2DV9 A;  1F5J A;  1HB3 A;  2DCY A;  2PFW A;  5EJ3 A;  1W8N A;  1C1F A;  2JDY A;  3B9I A;  5DAQ A;  4YZ5 A;  2AEY A;  3G6J B;  4LHS A;  2HWC 3;  5FZ1 A;  1PX4 A;  2NN8 A;  4AR2 A;  1YCI A;  5GZE A;  3AXD A;  4AEM A;  2EA7 A;  4W6W A;  1OLR A;  4Y1V A;  4C8D A;  1FAY A;  4XUT A;  1V70 A;  5FY0 A;  5L9B A;  3ACG A;  4MO3 M;  3VBH B;  1WD3 A;  4JDN A;  3NV2 A;  4FP3 A;  3FHQ A;  3H1W A;  4LR4 A;  1OBN A;  3JZV A;  1RIT A;  2XLG A;  2B5H A;  3WF4 A;  4LKD A;  1LNS A;  5FJK A;  3HWJ A;  4FI9 A;  1NXD 1;  4HSL A;  3ZLI A;  4D8M A;  3AJY A;  1Q8V A;  5A3N A;  5JPM B;  5HCH A;  3BYW A;  3UV9 A;  1URX A;  4QXB A;  4XW3 A;  3I2D A;  3WD5 A;  4IEY A;  1SPP A;  2YY1 A;  1PIV 3;  1ZRR A;  4J1X A;  3T4H B;  4G9S B;  4XTM A;  4Y26 A;  1HQW A;  1TME 3;  4Y5S A;  1HXS 1;  1AZD A;  2ZX3 A;  1W6M B;  1D0H A;  1UX7 A;  1FX5 A;  2W94 A;  3IAQ A;  3PUQ A;  3QLQ A;  2Y0O A;  1ND3 B;  2DYC A;  3E97 A;  3MBW A;  4KGQ A;  4Y1Y A;  2WN3 A;  5FMD A;  4B1M A;  1A8D A;  4D94 A;  3QOP A;  1S0E A;  1HRV 3;  1OF4 A;  1G7Y A;  1YYN A;  1YQ2 A;  4CSW A;  3KCY A;  2GZW A;  1I5P A;  3AP6 A;  2WS9 2;  1C1L A;  2Q8E A;  1ZRD A;  2ZML A;  2FMD A;  2JX9 A;  1RMU 3;  2X09 A;  1PO1 1;  4Q8L A;  4U36 A;  1V0A A;  4RFR B;  5FR3 A;  1JZ4 A;  2Y38 A;  1OA2 A;  2O0O A;  3T0D A;  4BMB A;  3U1X A;  2AAC A;  2KR2 A;  2HWB 3;  5F3I A;  2PYT A;  5IVC A;  4QT6 A;  3ACI A;  1YI9 A;  1RHI 2;  5B2G B;  4ZHN A;  3SHR A;  1WLT A;  1Y4W A;  1H9P A;  1LOD A;  4NVP A;  4NWV A;  2RS1 1;  4YW2 A;  4GAL A;  1ZBA 1;  1QU0 A;  2ARE A;  2XR4 A;  4GMP 0;  5H9P A;  3CMG A;  4RQP A;  1BEV 3;  4CPB A;  4E8C A;  3C7O A;  3KT7 A;  3LZZ A;  4XCA A;  1LKN A;  2R0H A;  3ME2 A;  4CDW B;  1J59 A;  3RI8 A;  1W0O A;  3SLI A;  2RMU 3;  4Y22 A;  2ZMK A;  3ZFE B;  5LRR A;  2WAB A;  3ZSL A;  1W8H A;  4LBL A;  5FLH A;  3GZA A;  3N3H A;  4Q4X 3;  5FYU A;  3WZ1 A;  1UY2 A;  2NMO A;  1UKR A;  3FBY A;  1RUJ 2;  4PJY A;  1DCS A;  2JG8 C;  1F15 A;  1NCQ B;  2EXK A;  4M01 A;  3PTR B;  4MV2 A;  4RD7 A;  3O1T A;  2NMN A;  1CWP A;  1F4H A;  1GR3 A;  1OF3 A;  1VRH 3;  2WJS A;  1C3H A;  3LWC A;  4DY3 A;  5IFP A;  1XU1 A;  4NPL A;  2ZGK A;  4W8J A;  1GQP A;  4MX3 A;  3WY6 A;  5FZ8 A;  1V6K A;  3ES1 A;  1JZ5 A;  1PK6 A;  1UXX X;  4QM8 A;  1JYN A;  3P6B A;  4A44 A;  2W9X A;  3B02 A;  1QJU 2;  1CON A;  1NCR C;  1U0A A;  1OH3 A;  1CJP A;  3H9A A;  3LEK A;  4RS5 C;  3H7Y A;  4X6Q B;  2VOT A;  3PIG A;  3E6D A;  4H7M A;  1Q8P A;  5J1X A;  2ZTN A;  4Y4R A;  4W50 A;  2PN5 A;  1WA4 A;  2D6L X;  3EBR A;  1TME 1;  3VBS A;  3OBA A;  2WNU A;  3IZO A;  2BZD A;  1UZZ A;  3D8C A;  2EAL A;  5I91 A;  5I8T A;  4UFK A;  3V0A B;  1JOP A;  1W2U A;  3K46 A;  1EY2 A;  2LS6 A;  3VKM A;  4CEW C;  2W5F A;  3NNJ A;  2PAE A;  3WDU A;  1HRV 1;  3LF7 A;  4QQ2 A;  1GIC A;  5FYC A;  5A3T A;  3VDC A;  5B4N A;  5IAX A;  2WO3 A;  3R05 A;  4MVT A;  3MV0 1;  1RMU 1;  1WD4 A;  4XF0 A;  5D8A A;  1HV1 A;  3ZFF B;  3FZ3 A;  4WM8 B;  3N9P A;  3PUA A;  4IV3 A;  3U37 A;  3SKV A;  5FYB A;  2GNT A;  3JBG 2;  4A4A A;  3S57 A;  2VH9 A;  4A42 A;  5IVE A;  2YG0 A;  4CZS A;  4A7Y A;  1RUD 2;  2XJS A;  5CIS A;  4FO9 A;  3D5O A;  4RFT 0;  2OUH A;  3T09 A;  5DAX A;  3T3Y A;  5I0T A;  3R4U A;  1ZRE A;  3PVB B;  4QQL A;  4W4Z A;  2JIC A;  1CAU A;  4OHY A;  4S2G A;  1HV0 A;  5F3C A;  1LES A;  1X9P A;  3KQ4 B;  2OXB A;  4XXA A;  1BEV 1;  3O7O A;  4N53 C;  5DUW A;  5FQ0 B;  2R04 1;  3ZYI B;  3VBO B;  5FYT A;  5C6C A;  4BME A;  5FZL A;  4CUB A;  4CYD A;  3H3L A;  4CU9 A;  1EPW A;  1ODN A;  2RMU 1;  3I59 A;  1FNZ A;  3LIH A;  4AI8 A;  1GOH A;  4CP2 A;  1F9K A;  2ATF A;  1BK1 A;  4OI2 A;  2PHX A;  3K48 A;  3KGZ A;  4HK9 A;  2JDA A;  3PUI A;  4CEY C;  1E5R A;  4JQR A;  5FZG A;  1P8J A;  4D7T A;  2CYF A;  5DXD A;  3VZK A;  5ABJ A;  4YG0 A;  1IQD C;  3WP3 A;  2D7F A;  4QXC A;  1PO2 2;  1VRH 1;  5C8W A;  1DQ4 A;  3AKQ A;  2R07 2;  5TSW A;  1LED A;  4V2W A;  4M4R A;  4DMI A;  3AB0 A;  1RUG 2;  1I9R A;  3T0B A;  1LHN A;  2A71 A;  2QFE A;  2VBB A;  3SIS A;  3UGH A;  1GYK A;  4Q4W 3;  3U0Z A;  3LDR A;  1BMV 1;  2ZX2 A;  3H3U A;  2W92 A;  1QQP 2;  1FPN 3;  4KWK A;  3HAG A;  3MLL A;  2PAM A;  2X05 A;  2E32 A;  3IPV B;  1POQ A;  4QPI A;  2VMH A;  4MLO A;  1UPI A;  3H42 B;  1PGW 1;  4K1Y A;  3WW2 A;  1GNH A;  2P1B A;  4YZ3 A;  1O3S A;  3N35 A;  1AXK A;  4IEW A;  4AVB A;  3DN7 A;  1D2S A;  4EWE A;  5JUV A;  4E4D X;  1G8W A;  5FZ6 A;  4NPR A;  3WDY A;  2BYV E;  1VAV A;  2O8Q A;  2UYA A;  3ZFG B;  5D2A A;  2HWF 3;  2ZZJ A;  1MVE A;  1W8W A;  2QQU A;  1NX9 A;  2WFF 2;  1FOD 3;  1S1A A;  3RNS A;  4JKM A;  3DYP A;  5F32 A;  4JC1 A;  4EZH A;  5T50 A;  5C9A C;  1XYN A;  2VMF A;  4OZO A;  2MEV 2;  1ULG A;  5IAV A;  3DPR B;  4XUR A;  1NQD A;  4UFL A;  2JEC A;  3ZDS A;  4FTB A;  5FZ7 A;  1SBF A;  4JGZ C;  1VIW B;  4FXG B;  1OH4 A;  2P34 A;  1M4W A;  2C9K A;  3VBH A;  1J58 A;  1RUI 3;  1YEW A;  2A75 A;  3FJS A;  5FXV A;  4AOC A;  3MFA A;  2OQ7 A;  3MZH A;  3ZXD A;  4DUV A;  2VVF A;  3OBT A;  4CA9 A;  4LNV A;  4PF1 A;  1QH7 A;  1VR3 A;  1JBC A;  1HLC A;  1LR5 A;  1U12 A;  3D3A A;  4Q26 A;  4URT A;  3RYK A;  1CAV B;  1X50 A;  4AL9 A;  4TZD A;  2ZKN A;  4CCE A;  4MGZ E;  3U07 A;  1JHN A;  2R0F A;  4K9S A;  3SMH A;  3OBR A;  1NUK A;  5A3O A;  2P3J A;  3U14 A;  3LD8 A;  1Q8O A;  3LPG A;  1EUU A;  1NT0 A;  2Q4S A;  3N9M A;  1R64 A;  5A80 A;  4G3Y C;  3PUS A;  4E2S A;  1GZW B;  5SV8 A;  4CCL A;  3H8X A;  1YJL A;  2D5H A;  5LEK A;  4NO4 A;  1AHS A;  3LDB A;  5EHD A;  1ND3 A;  3OGJ A;  5APA A;  2FCT A;  3JXS A;  3POI A;  4JTO A;  2VZR A;  5LBB A;  1G9A A;  4Q4Y 3;  3AMP A;  3WQ0 A;  1D4M 2;  4Q4W 1;  2ZAA A;  3S7I A;  4ISR A;  4CDU B;  1W9F A;  4IEX A;  4L97 A;  1XE7 A;  1FPN 1;  3HBZ A;  3ZN4 A;  1POV 0;  1ENX A;  1PGL 2;  2ZHK A;  1UMI A;  5GLW A;  1DGR N;  3B7M A;  5KC5 A;  2BVV A;  3WNP A;  1OXC A;  5A7Q A;  3I3B A;  3KV5 A;  3A21 A;  2VCA A;  3WCS A;  3BOP A;  2VCC A;  3GM8 A;  1AYN 2;  5E16 A;  3N7L A;  1YFY A;  4CPB D;  3USU B;  4LE4 A;  2HWF 1;  1HRI 3;  4X8N A;  1FNY A;  1O91 A;  2DUR A;  2J1U A;  1QEX A;  4HOO A;  1FOD 1;  3ZDV A;  4CDW A;  1C28 A;  2VZU A;  1ZBE 3;  3KCC A;  3KHB A;  4GB3 2;  4QDR A;  3RG0 A;  2XPJ A;  1RUF 3;  4FCA A;  3ZFE A;  4Z2A A;  1UO9 A;  1Q8Q A;  3BU7 A;  4IDZ A;  2B9U A;  1Q56 A;  2BGO A;  1AVB A;  2XG3 A;  5FRA A;  5JR2 A;  1WBF A;  5FWJ A;  1US2 A;  1H1A A;  4RQP C;  1NCQ A;  1MPX A;  3WUC A;  2JB8 A;  1RUE 2;  1GKB A;  1RUI 1;  4PT6 A;  3DF0 A;  2Y6H A;  4S2H A;  4XUN A;  4J1W A;  1ULO A;  1YRZ A;  1VBD 3;  1N1Y A;  3OG2 A;  4QU1 A;  5CIR A;  3K75 B;  4MHU A;  1YHF A;  4LBM A;  4XOG A;  4JHZ A;  1TMF 2;  2Z2S B;  3AYA A;  2CL2 A;  5F39 A;  5J37 A;  3N7J A;  3RPQ A;  1YQC A;  5KHI A;  5FZF A;  4DO0 A;  3NAP B;  4CUA A;  3AKT A;  5EV7 A;  4C1W A;  2ORZ A;  4NID A;  2ES3 A;  4BDV B;  2DVG A;  2EAK A;  2B7Y A;  2YGM A;  1J3P A;  3RRD A;  1PK6 C;  2D6N A;  3RS6 A;  1PVC 2;  2CWM A;  1QJX 3;  4LO7 A;  5ANQ A;  5HBA A;  4M4P A;  3S5Q A;  3WXP A;  2VBD A;  4KWU A;  4EWA A;  1BVV A;  1ZZ9 A;  2NM1 A;  2JDP A;  4Q4Y 1;  1SHW B;  1MS4 A;  3N9L A;  5GKA C;  2IFW A;  1W6N B;  4URA A;  3VBS C;  1AYM 3;  2WNU C;  4N8M A;  4R8H A;  1N1V A;  4HET A;  3ZFF A;  2NZ9 A;  1AR6 3;  3ZN6 B;  4WM8 A;  3J8F 3;  3OTF A;  1NXM A;  2VTX J;  4YG6 A;  2VEC A;  3WG1 A;  3U78 A;  3ZIW A;  5L7O B;  3Q8A A;  2HYK A;  3NVC A;  2ETE A;  4ZON A;  2XLA A;  5C7G A;  2XH6 A;  1GQG A;  3VKL A;  2WNE A;  4E9K A;  1D2Q A;  1Z0H A;  4I01 A;  4YW5 A;  5DN2 A;  5D8A C;  3TN9 3;  4UFI A;  1GWL A;  4BB3 A;  2IUW A;  4IV3 C;  4JQT A;  5I0D A;  3K4A A;  5FRE A;  1OUR A;  2W1U A;  3S6P A;  2ZAC A;  5FQ0 A;  3OGV A;  4ZXK A;  3RZH A;  4FP2 A;  1D7P M;  1C8M 2;  1ZBE 1;  2Z69 A;  1ZRI A;  1RUF 1;  3M3C A;  5E88 A;  2WNV B;  4GJY A;  4N43 B;  4WVZ A;  3AP7 A;  3PTY A;  4WBB A;  3WNL A;  4Z1V A;  2FQP A;  4LE3 A;  2VXJ A;  3V64 A;  3GGL A;  3ILN A;  4IEZ A;  5FYZ A;  2X5I B;  3IDE A;  3KMH A;  3MGU A;  2CSG A;  4QQP A;  1PVX A;  4EN9 B;  4NE9 A;  4ZU4 A;  4TYS A;  4P9W A;  4AEK A;  1IHM A;  3CEW A;  1VBD 1;  4D7Y A;  3M3E A;  3IDC B;  3AKP A;  1MZE A;  3AYE A;  2Q1Z B;  2UY8 A;  4R9D A;  1W2A X;  3OUJ A;  3ZN5 A;  1RUC 3;  3BVC A;  2WUH A;  5ABJ C;  4EN7 B;  1OA4 A;  1UIJ A;  2VY0 A;  3IPV A;  2BFU L;  1BJQ A;  4PBO A;  4XC9 A;  5AFB A;  4LTA A;  3V65 A;  2HWC 2;  3A0K A;  1K12 A;  3C7H A;  2E7T A;  1QJX 1;  1G6N A;  5C8C A;  1LOF A;  1VBB 3;  1H2M A;  3P3P A;  3HNB M;  5I0U A;  5DAV A;  4AFB A;  4CEW B;  5KBF A;  1AR8 2;  3TEY A;  4MXW B;  3P1I A;  2HWD 3;  4QQH A;  5T5O A;  5FPX A;  3ZFG A;  2XBO 3;  4QPI C;  2GDF A;  5FMO S;  5C3Q A;  5CA6 A;  1AYM 1;  2BUK A;  2VQ0 A;  2WFP A;  5CBL A;  1BCX A;  1W0P A;  4UI9 L;  5FYY A;  1JYI A;  5IT6 A;  3CJI B;  3J8F 1;  4IEP A;  5K8S A;  2XWJ B;  1BLZ A;  2DVF A;  4MGS A;  5T55 A;  2VME A;  3NNG A;  1PIV 2;  1AL2 1;  3CDZ B;  3LDK A;  4SBV A;  3JUU A;  5JSR A;  3VGI A;  4DNY A;  5ACA 3;  2ZHN A;  1J1T A;  1RED A;  2LM3 A;  3FUO A;  4TTG A;  4LOS A;  5DZF A;  4AHX A;  3HNM A;  3TN9 1;  1H30 A;  1AR9 3;  1ND2 B;  3BAL A;  2JE9 A;  1DZQ A;  1ZZ7 A;  4IGP A;  2IXJ A;  3ZYJ B;  4FPF A;  2DF7 A;  4N7I A;  1IKP A;  3GCW A;  5A33 B;  4XBQ A;  3ZPY A;  3RZL A;  2ET1 A;  4Z92 B;  3B9C A;  4EN0 A;  2XON A;  2XUM A;  3VZJ A;  5BYN A;  2W47 A;  2BWA A;  5AC9 2;  3D6E A;  5GZF A;  2YUE A;  3MF9 A;  4AG4 A;  2V4A A;  3VBH C;  2FBE A;  2VCM A;  2QNK A;  4UFM A;  1LU2 A;  5FO8 B;  2OZ6 A;  4CCD A;  4RHV 3;  4F8A A;  4MZU A;  1GZW A;  1OQD A;  4MH0 E;  4YW6 A;  1RTV A;  4ZS2 A;  2HWB 2;  2YFU A;  1XC6 A;  4XJW A;  3PIJ A;  2RV9 A;  2IFR A;  4XJZ A;  4QDQ A;  2QQV A;  4GH4 A;  3KCX A;  1AUY A;  2ID4 A;  1XE0 A;  2ADE A;  3NW4 A;  2VM9 A;  2LRP A;  3AKR A;  1BEV 2;  1XRU A;  3I8T A;  4CDU A;  4QDS A;  2GC2 A;  1IG0 A;  4E27 A;  1O3Q A;  1N3O A;  1L7Q A;  1T2X A;  4PDW B;  4YW7 A;  1ND3 C;  2VZ1 A;  2HEY F;  1TVG A;  2AEN A;  2RMU 2;  2WO2 A;  3HT2 A;  3K77 A;  4L0P A;  4NRO A;  4QKN A;  5DAW A;  3VBR B;  3ZMO A;  3ZR5 A;  3IIA A;  1KD7 A;  4FPK A;  1ENR A;  2J42 A;  4FFF A;  4Q4X 2;  4WVW A;  5C70 A;  3V0B B;  4GMP 3;  4YVW B;  3VDD B;  5FP9 A;  2O8O A;  5DUV A;  4GWJ A;  2D3P A;  1VBB 1;  1Q8S A;  2WZR 1;  3KVA A;  4YWA A;  2D98 A;  4HSJ A;  4PI2 A;  2GNM A;  2VUA A;  2WII B;  2HWD 1;  5A7P A;  4IQP A;  1VRH 2;  4LUM A;  2DCT A;  4MGY E;  2BRT A;  1LUL A;  3USU A;  2XBO 1;  3CJX A;  2RS5 2;  5LCW L;  2WQZ C;  2SBA A;  4IE0 A;  2VNO A;  3DEC A;  5FYS A;  1QXR A;  4ZXE A;  5FP4 A;  4AYU A;  2ZX1 A;  4IEU A;  4XAC A;  1OC1 A;  4YM2 A;  5FZB A;  1OPM A;  3ON7 A;  5H9R A;  2XKP A;  2B42 B;  1E57 A;  3OD4 A;  4KG0 A;  3PNA A;  4BQ3 A;  5LK7 B;  2EIC A;  3E1F 1;  5ACA 1;  3AVR A;  5LZ6 A;  3H8R A;  4CDW C;  3EHK A;  2BGP A;  2WO1 A;  3ZKY A;  5LA1 A;  1AR9 1;  3ROU A;  3OOX A;  2VVE A;  2E51 A;  3ZFE C;  4AVA A;  2XJT A;  1W9W A;  1JHJ A;  5FIX A;  1W8F A;  4DXS A;  1GBG A;  5IVB A;  5DZG A;  4AFD A;  3I2H A;  2VPV A;  2GNB A;  2AH2 A;  3PMS A;  2A7A A;  4EN8 B;  2F17 A;  4JRA A;  3LQC A;  1NCQ C;  5FFO C;  1JH5 A;  1LU1 A;  4QGN A;  4WV8 A;  5L19 A;  3VBF B;  3VD3 A;  3WIN E;  1IKQ A;  1TNR A;  4KI5 M;  3AMM A;  3RZG A;  2YFZ A;  1W04 A;  1MZF A;  3G7D A;  5EPA A;  4Q4V 2;  4M3C F;  4YNI A;  1E5S A;  4CUC A;  2OVU A;  1EYB A;  1BKZ A;  3UJQ A;  4ARX A;  4RGG A;  1NLR A;  5CAZ A;  3U11 A;  3CF6 E;  3WQ7 A;  2BVB A;  4IGO A;  1OLM E;  2A70 A;  5D1I A;  1AR7 3;  1W6O B;  2J1R A;  1IGO A;  4KMQ A;  4XFI A;  1UOB A;  1RIR A;  2MPF A;  5F2S A;  3RYP A;  3TAY A;  3T2Q A;  2XKO A;  3PVN A;  1JZ6 A;  3M1H A;  4BHP A;  1W6N A;  3UL2 A;  1H2N A;  5A1F A;  3ETP A;  1QIQ A;  2VVD A;  4OHW A;  1K5M B;  3LFM A;  4QX0 A;  4YGB A;  1CVN A;  3I2K A;  4NHL A;  2I74 A;  4NRP A;  3WEZ A;  1S4C A;  1VRB A;  3KM5 A;  4QB2 A;  4XUO A;  1JOB A;  1MR5 A;  3ZN6 A;  5KXC A;  1YXW A;  1HJG A;  3MYX A;  5L7O A;  3I2J A;  2YMZ A;  3RQ0 A;  4BYY A;  5I0S A;  2FHR A;  4BIO A;  4GMP 1;  2Z5W A;  4I3P A;  4OCT A;  2NYY A;  4AGR A;  4KG8 A;  1HW5 A;  1DYO A;  1K3I A;  1UY1 A;  2R1B A;  3ZFF C;  5FY1 A;  5A3U A;  5FY8 A;  4WM8 C;  1DLC A;  4DRR A;  4FTS A;  3HQR A;  5A7S A;  5B4X A;  3O1V A;  3RWK X;  1CAW B;  5GZD A;  5IW0 A;  1TZO A;  2GMP A;  3ETQ A;  1MQT B;  1ZNP A;  1B35 B;  3AP5 A;  4JZR A;  2WN2 A;  2WNV A;  1O4Y A;  1XU2 A;  4AI1 A;  2WT1 A;  2QQL A;  4N43 A;  3THP A;  4OI1 A;  1C57 A;  4P9J A;  2JDZ A;  3ELN A;  4EE2 A;  3N4M A;  4XQ4 A;  1DQ0 A;  2I2S A;  3ECQ A;  3POY A;  3ZKU A;  5BUV A;  4P5Y A;  3MHZ A;  1PM4 A;  1Y3T A;  5FZ9 A;  1SFP A;  4G4F A;  3T2O A;  2X5I A;  4MYE A;  2RR1 1;  4WM7 B;  4CDQ B;  4E2G A;  2WBK A;  3AFK A;  4NMI A;  5LB6 A;  4OUS A;  2WYS A;  1V9U 3;  3ASI A;  3KF5 A;  1O5L A;  1UU6 A;  3IKW A;  1QWR A;  4D7S A;  5BNQ A;  5C3P A;  2E63 A;  3MID A;  3FFZ A;  4IGQ A;  2Q8C A;  1FXZ A;  4XZU G;  1CIW A;  1PO1 3;  2HWF 2;  2WAO A;  4KWL A;  2EIB A;  2QE3 A;  5FV3 A;  2A6V A;  2HEW F;  2W68 A;  1W3V A;  4JKK A;  5CB7 A;  2IXK A;  3MW2 A;  5JR7 B;  3H8U A;  4B1L A;  1UOJ A;  3NNF A;  3KT1 A;  1D0G A;  2VJX A;  4FBF A;  4BXF A;  3KV4 A;  5F6K A;  2D3S A;  5IAT A;  4UBG A;  1GLH A;  4IV1 A;  3ST7 A;  5JPN B;  2RS1 3;  4Q2F A;  1AR7 1;  4D0Q A;  3GF6 A;  1KEX A;  4CEW A;  4HBN A;  1EPZ A;  4DUW A;  5L9R A;  4MXW A;  1KIT A;  1N3Q A;  5LK5 A;  1SFN A;  5A6X A;  2FD8 A;  4CDX B;  1DFQ A;  2JD9 A;  2P5B A;  1ONA A;  4AEJ A;  5JMO A;  1K45 A;  2GC1 A;  2P37 A;  1SEF A;  2E7Q A;  3CJI A;  3POG A;  1LOF C;  5C8C C;  5F37 A;  1XBF A;  4JX0 A;  1OMI A;  1I1E A;  3CLP A;  1Q3E A;  2XJP A;  4AFM A;  2EIE A;  3ZFG C;  2OKX A;  3OF1 A;  4O9E A;  4AAP A;  3VBU A;  1LOG A;  3SIT A;  3VDB A;  1N1T A;  4HKL A;  4I0A A;  3ZOI A;  5LA0 A;  1C5I A;  5LBC A;  1ND2 A;  2WSU A;  1DQ6 A;  2HH9 A;  4FXK B;  4CXX A;  2BGC A;  1MEC 2;  1COV 3;  3ILF A;  4NR1 A;  4ZZ5 A;  1EAH 1;  3JQW A;  1FI2 A;  2XVL A;  4FT8 A;  4KBZ A;  1RVF 2;  2X53 S;  3DGT A;  2VOK A;  2L9L A;  2GH2 A;  2A3Y A;  1CD3 G;  3FUQ A;  1X82 A;  5I8S A;  4LEJ A;  1RYY A;  1CZT A;  1G9C A;  2JXA A;  1QXJ A;  5EJZ B;  5FBJ A;  1ZZC A;  3BB6 A;  4XYX A;  3I3Q A;  5KXB A;  4JHT A;  2VE1 A;  2VC9 A;  4B4P A;  1GAN A;  1UX6 A;  2YU2 A;  4LMF A;  5KR7 A;  2YV8 A;  3C8X A;  1V9U 1;  2PA7 A;  5IWF A;  1POV 3;  2OW4 A;  2DCJ A;  3RZM A;  4AI3 A;  3ZXL A;  5T5J A;  1UKG A;  2DU0 A;  4L8Q A;  4L92 A;  1HRI 2;  1TE1 B;  2YBS A;  4MHR A;  3GCX A;  4NHX A;  4V1P A;  5BNN B;  4PDW A;  4LHK A;  1V6I A;  1RUF 2;  3VHP A;  1PGS A;  3EO6 A;  2CAV A;  2XL7 A;  3MIF A;  2WZP P;  3VBR A;  2VUD A;  4Z2W A;  1DDL A;  3WW4 A;  4GH4 C;  4YW4 A;  3V0B A;  3FL7 A;  1YO8 A;  1O6U A;  2N7G A;  4YVW A;  3VDD A;  1LB2 A;  4CDU C;  1Y9Q A;  5GLU A;  5FZI A;  1AXY A;  1L7L A;  2O1Q A;  2R04 3;  3NV1 A;  5GLT A;  1IS6 A;  4QU2 A;  1WLC A;  1PHM A;  2Y64 A;  1V6O A;  3CZJ A;  4NN0 A;  2A6Y A;  5IK8 A;  2ADD A;  2Y6F A;  2DVA A;  1UMZ A;  3AP9 A;  2LUW A;  1JUH A;  1E5I A;  4JCK A;  1H4H A;  3CBN A;  3IT8 A;  3GZE A;  5AVP A;  3WR0 A;  3J4U H;  2PHL A;  2XVG A;  3NKG A;  4NII A;  4XPV A;  4AWD A;  4WZC A;  5G04 L;  1AX2 A;  5FO9 B;  3QH6 A;  1COV 1;  2VQU A;  3Q8C A;  2ZA9 A;  5F3E A;  3U75 A;  3WF0 A;  4Y1U A;  1DIW A;  1DHK B;  1HQL A;  3ZXA C;  1GP4 A;  4HVO A;  5FZ3 A;  4PIZ A;  3FE5 A;  4KGG A;  2HBT A;  4NJ4 A;  4WZF A;  4BZ4 A;  3VBF A;  5FZO B;  1AR6 2;  5A1A A;  3AC0 A;  2VR4 A;  1ENS A;  3N7K A;  1VBC 3;  2RS3 2;  3NJZ A;  4NHY A;  4QX8 A;  5DUU A;  4MGI E;  2G1M A;  2ZOE B;  4XJ8 A;  1WCS A;  1W6O A;  3VHO A;  2EVX A;  4QM9 A;  1LOC A;  1O7F A;  1POV 1;  2OZJ A;  2VMC A;  4LJH A;  5E8A A;  3TN9 2;  3AJZ A;  4YFW A;  5CFC A;  4DXZ A;  4OMC A;  1UYZ A;  4QX5 A;  1K5M A;  1FMD 2;  1REE A;  4FFG A;  5H9Q A;  5A3M A;  5T3N A;  1OD3 A;  5DAB A;  2WT0 A;  1UOF A;  3FLR A;  3OYW B;  1OOP A;  2XWB B;  1UYX A;  3A7Q A;  4COY A;  4ZU7 A;  2AGS A;  2BV4 A;  4TSV A;  5J36 A;  2C1F A;  3ZYB A;  3R4D B;  5FUN A;  2Y0I A;  3PUR A;  2DVB A;  2OUJ A;  1WCU A;  1H6X A;  1UXZ A;  4XFG A;  4AI9 A;  4D6R A;  2PQQ A;  2BNN A;  2PLV 3;  1Q43 A;  1O5U A;  3BOD A;  1PMH X;  2UWB A;  1S0B A;  1CAW A;  1IG3 A;  5GAL A;  1REF A;  1SBE A;  2ZCW A;  2YC0 A;  1MQT A;  2BEO A;  4HN1 A;  4RSU A;  3NNL A;  1PNG A;  4FOW A;  1ULF A;  4B4Q A;  5JDB A;  2YC4 A;  1B35 A;  1X8M A;  1ACC A;  1VMH A;  2RHP A;  5FUP A;  1RUC 2;  4PF5 A;  4LOT A;  3H1Y A;  1F5F A;  4AHW A;  3DEM A;  4COZ A;  5K0U B;  2PHF A;  1KGY A;  2VMD A;  3AZV A;  3O1O A;  4CE8 A;  1ODM A;  2R06 1;  2EXH A;  5GLZ A;  2Y33 A;  5KWR A;  4QXK A;  2ZJC A;  4AW7 A;  4K8F A;  4Y1Z A;  4WM7 A;  4CDQ A;  1WUV A;  2WNV C;  4AVC A;  4CVU A;  4AI0 A;  3AFG A;  4N43 C;  4N7U A;  3JD7 3;  2D97 A;  3ZYH A;  4UW3 A;  2ARB A;  2KA3 A;  1QJF A;  2ZEW A;  3LA7 A;  1EUT A;  5F9T A;  1R08 3;  3KD4 A;  2PHR A;  4QPW A;  4FAH A;  2BW8 A;  1HQN A;  2J1E A;  1RC6 A;  2X5I C;  4E8D A;  1V6L A;  2WKK A;  1XNT A;  4FPC A;  1W6P B;  5ANN A;  1VBC 1;  1N47 A;  2AZ5 A;  4OUL A;  3MEP A;  2FZ2 A;  3BN6 A;  3HT1 A;  2A6Z A;  3RZK A;  2WT2 A;  2PHT A;  1C4R A;  1CIY A;  5FY9 A;  1RUH 1;  5FZM A;  3X29 B;  3EYP A;  2WIN B;  4IE5 A;  4AI2 A;  1R09 3;  4A3X A;  1ZYB A;  4OI0 A;  1AXZ A;  1CPN A;  2H0B A;  4IV1 C;  4DIQ A;  2OPK A;  2ZPX A;  3AZW A;  1DF0 A;  1JUI A;  1PM7 A;  2P3K A;  3OPT A;  1IQA A;  4LXL A;  4XVH A;  3R0R A;  3WQ1 A;  1LHU A;  2VZS A;  3WT3 A;  5SV5 A;  1JW6 A;  4HVQ A;  4RHV 2;  5IVV A;  4YZ2 A;  1KQR A;  3NJX A;  1XPW A;  4YAR A;  1LJ7 A;  2RM2 2;  3CJI C;  2OS2 A;  2PLV 1;  5CAD A;  4EQV A;  5LY2 A;  2P3I A;  3MIC A;  3UYJ A;  4R4X A;  4I09 A;  4AVT A;  5FZA A;  4A3Z A;  4B29 A;  3W20 A;  3VBU C;  3TEX A;  2DBN A;  2PEL A;  1CQ9 A;  5EYX A;  4DOU A;  1ND2 C;  3ZX7 A;  1W6M A;  2PTM A;  1IOA A;  1DYK A;  5CFD B;  5FYH A;  5LEJ A;  4DXT A;  4WVM B;  1CX1 A;  4E4Z A;  1WW6 A;  3GDB A;  2VO5 A;  2Y34 A;  2F4P A;  3E5Q A;  3T2T A;  3M2M A;  3O5S A;  2WZ8 A;  2VNV A;  4FSJ A;  2J1V A;  3JD7 1;  3ZSK A;  1MS5 A;  1QJE A;  2VU9 A;  4BOW A;  3HQU A;  4K8R B;  2P6C A;  2JKB A;  3SQO A;  1R08 1;  4HMZ A;  4QHO A; 
#chains in the Genus database with same CATH homology
 1GWL A;  4BQ3 A;  1W8U A;  1WCU A;  2KR2 A;  1GWM A;  1W8T A;  3ORJ A;  3ZYH A;  4CP9 A;  4A6S A;  4LKF A;  4LK6 A;  4LKE A;  5D21 A;  1GWK A;  4YWA A;  4LJH A;  4YW6 A;  1OKO A;  4CPB D;  4BQ5 A;  4BQ4 A;  4CPB A;  1OH3 A;  1L7L A;  1UOJ A;  2JWP A;  1WMX A;  2Q1F A;  2VXJ A;  2LRO A;  4BQ2 A;  4LKD A;  1W90 A;  1W8Z A;  1WZX A;  2O14 A;  2WYF A;  2K46 A;  1W9F A;  4LK7 A;  1HN0 A;  2LRP A;  3UT0 A;  3ZYF A;  1V0A A;  4AL9 A;  4CP9 B;  1W8W A;  3ZYB A;  3F95 A;  4YW7 A;  2C24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...