2KR9A

Kalirin dh1 nmr structure
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
190
structure length
190
Chain Sequence
b'GPLGSPEFPGRKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEHAGTFFDEIQQRHGLANSISSYLIKPVQRVTKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKANDAMHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kalirin
publication title The solution NMR structure of the first Dbl domain of RhoGEF Kalirin.
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 58
structure length 190
sequence length 190
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 2kr9A00
1X86A 2VRWB 4MT7A 2DX1A 2PZ1A 4YONA 4D0NB 4GZUA 4D0OA 2DFKA 1RJ2A 5FI0A 3KZ1A 1KI1B 1BY1A 2Z0QA 3QBVB 3ODXA 2RGNB 2NZ8B 1FOEA 3JV3A 1TXDA 1DBHA 1LB1A 1KZGA 1XCGA 5FI1A 2KR9A 1XD4A 1NTYA 1KZ7A 4GYVA 3BJIA 3KSYA 5JHHA 5JHGA 3ODOA 3GF9A 1F5XA 3MPXA 3ODWA 3P6AA 3T06A 4GOUA 3KY9A 3EO2A
chains in the Genus database with same CATH superfamily
1X86A 2VRWB 4MT7A 2DX1A 2PZ1A 4YONA 4D0NB 4GZUA 4D0OA 2DFKA 1RJ2A 5FI0A 3KZ1A 1KI1B 1BY1A 2Z0QA 3QBVB 3ODXA 2RGNB 2NZ8B 1FOEA 3JV3A 1TXDA 1DBHA 1LB1A 1KZGA 1XCGA 5FI1A 2KR9A 1XD4A 1NTYA 1KZ7A 4GYVA 3BJIA 3KSYA 5JHHA 5JHGA 3ODOA 3GF9A 1F5XA 3MPXA 3ODWA 3P6AA 3T06A 4GOUA 3KY9A 3EO2A
chains in the Genus database with same CATH topology
1X86A 2VRWB 4MT7A 2DX1A 2PZ1A 4YONA 4D0NB 4GZUA 4D0OA 2DFKA 1RJ2A 5FI0A 3KZ1A 1KI1B 1BY1A 2Z0QA 3QBVB 3ODXA 2RGNB 2NZ8B 1FOEA 3JV3A 1TXDA 1DBHA 1LB1A 1KZGA 1XCGA 5FI1A 2KR9A 1XD4A 1NTYA 1KZ7A 4GYVA 3BJIA 3KSYA 5JHHA 5JHGA 3ODOA 3GF9A 1F5XA 3MPXA 3ODWA 3P6AA 3T06A 4GOUA 3KY9A 3EO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X86 A;  2VRW B;  4MT7 A;  2DX1 A;  2PZ1 A;  4YON A;  4D0N B;  4GZU A;  4D0O A;  2DFK A;  1RJ2 A;  5FI0 A;  3KZ1 A;  1KI1 B;  1BY1 A;  2Z0Q A;  3QBV B;  3ODX A;  2RGN B;  2NZ8 B;  1FOE A;  3JV3 A;  1TXD A;  1DBH A;  1LB1 A;  1KZG A;  1XCG A;  5FI1 A;  2KR9 A;  1XD4 A;  1NTY A;  1KZ7 A;  4GYV A;  3BJI A;  3KSY A;  5JHH A;  5JHG A;  3ODO A;  3GF9 A;  1F5X A;  3MPX A;  3ODW A;  3P6A A;  3T06 A;  4GOU A;  3KY9 A;  3EO2 A; 
#chains in the Genus database with same CATH topology
 1X86 A;  2VRW B;  4MT7 A;  2DX1 A;  2PZ1 A;  4YON A;  4D0N B;  4GZU A;  4D0O A;  2DFK A;  1RJ2 A;  5FI0 A;  3KZ1 A;  1KI1 B;  1BY1 A;  2Z0Q A;  3QBV B;  3ODX A;  2RGN B;  2NZ8 B;  1FOE A;  3JV3 A;  1TXD A;  1DBH A;  1LB1 A;  1KZG A;  1XCG A;  5FI1 A;  2KR9 A;  1XD4 A;  1NTY A;  1KZ7 A;  4GYV A;  3BJI A;  3KSY A;  5JHH A;  5JHG A;  3ODO A;  3GF9 A;  1F5X A;  3MPX A;  3ODW A;  3P6A A;  3T06 A;  4GOU A;  3KY9 A;  3EO2 A; 
#chains in the Genus database with same CATH homology
 1X86 A;  2VRW B;  4MT7 A;  2DX1 A;  2PZ1 A;  4YON A;  4D0N B;  4GZU A;  4D0O A;  2DFK A;  1RJ2 A;  5FI0 A;  3KZ1 A;  1KI1 B;  1BY1 A;  2Z0Q A;  3QBV B;  3ODX A;  2RGN B;  2NZ8 B;  1FOE A;  3JV3 A;  1TXD A;  1DBH A;  1LB1 A;  1KZG A;  1XCG A;  5FI1 A;  2KR9 A;  1XD4 A;  1NTY A;  1KZ7 A;  4GYV A;  3BJI A;  3KSY A;  5JHH A;  5JHG A;  3ODO A;  3GF9 A;  1F5X A;  3MPX A;  3ODW A;  3P6A A;  3T06 A;  4GOU A;  3KY9 A;  3EO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...