2KRBA

Solution structure of eif3b-rrm bound to eif3j peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
81
structure length
81
Chain Sequence
DSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The indispensable N-terminal half of eIF3j/HCR1 co-operates with its structurally conserved binding partner eIF3b/PRT1-RRM and eIF1A in stringent AUG selection
rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 3 subunit B
total genus 14
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2krbA00
3TO8A 1N54B 1WHXA 5DDRC 2CPYA 2E5IA 1SJ3P 2LXIA 1VQ8S 2F9DA 2JVRA 2MZJA 3BS9A 2M52A 3G9CA 1QVFR 3NNAA 2AD9A 2HYIB 2DGSA 5IQQA 3Q2SC 1DHMA 2MQQA 2KG0A 3D2WA 3BO2A 2X1GA 2DNGA 1WG4A 2LKZA 2HGNA 3B4DA 1OWXA 2CQ4A 5GAEU 5DDOC 2M9KA 2E44A 3VAIA 2HGMA 4WFAQ 3G6ES 3CCJS 4YUDA 1VQ9S 4WIIA 2VOPA 3MUMP 2DO4A 1P1TA 2DHSA 1NO8A 2MGZB 2KXFA 3VAMA 1ZZNA 1VQOS 2CPEA 3UCUP 2DGWA 1VQKS 3G4SS 1U1QA 4PR6A 1H2VZ 5H1SV 2UP1A 5JVGQ 2YH1A 1VC6A 1AUDA 4IUFA 1UP1A 3PIOQ 2M8DB 1WTBA 3LPYA 1KOOA 3CCQS 1SXLA 4QU6A 3MURP 4W92B 2V94A 1VBXA 1U6BA 2RS8A 4F25A 4W90B 2Q79A 2MKKA 1XN9A 2HVZA 3CPWR 2J0QD 2DNQA 2OSRA 2KXNB 5LSLA 1R8HA 3DLLQ 4ERDA 2FY1A 4P6QA 2XNQA 2AYMA 2N3LA 2DGUA 3MXHP 4A8XA 2RUGA 5HL7Q 2ADBA 1PGZA 3FEYB 3CCES 2KU7A 5GMKa 2L9WA 2E5JA 4EGLA 2AYBA 1X5TA 2MSSA 3MD3A 1OPIA 4YOEA 1W2BR 1K8AT 2A3JA 2DIVA 4PKDB 1G2EA 5LXRA 3MDFA 2G1DA 2N7CA 3CCSS 3ULHA 1VBYA 3S8SA 3TYTA 3MD1A 2CQDA 2MKSA 5DM6Q 3CF5Q 4U67Q 5D77A 2MY8A 1SJQA 2CPZA 2MB0B 3UWTA 2J76E 1N88A 1U2FA 3H2VE 4M5DB 1KOHA 3NMRA 2B0GA 3CD6S 1D9AA 1VQMS 2LMIA 2GHPA 2XSFA 2MQLA 5DDPC 1M5KC 3RW7A 2U2FA 2MKCA 2RRBA 2D3OR 4WFBQ 3PIPQ 3BO4A 3L3CA 4IOCQ 2LA4A 1M1KT 1SJRA 2GO9A 2KN4A 1SJ4P 3MUVP 2KI2A 1X4FA 1A7GE 2U1AA 3CCUS 3MUTP 1VQ5S 2ADCA 2JX2A 3J7YU 2WBRA 2JWNA 1DZ5A 2CPDA 3S01A 2J8AA 3V4MA 1WHVA 1WI6A 2CQHA 2QFJA 1WEZA 2MGZA 5GADU 5BJRA 1R8PA 3UCGA 2MQPA 3BO3A 2VODA 1U1RA 2F3JA 2MQNA 3JB9k 5DM7Q 1WG1A 5GVQA 2QEXS 3VALA 3P6YC 3DXBA 2CQ3A 3N9UC 1M5OC 2DNOA 4C4WA 3EGZA 4WCEQ 2EK1A 3SDEA 3CMES 3VAHA 2F9JA 3TP2A 2RT3A 2BOPA 1L3KA 2RNEA 1KD1T 2DHGA 2CPFA 1H6KX 1Q81T 2DB1A 2MZTA 3LQVA 1H2UX 4ZKAA 2D9OA 2EVZA 3U1LA 3NNHA 2QA4S 1U1KA 5CXTA 2XNRA 4OZ0A 2CQBA 1RKJA 3NS6A 1DBDA 2XS7A 2MHNA 2NZ4A 2KRBA 2MY7A 3S7RA 2N82B 2M70A 2M7SA 2X1AA 1DRZA 1WHYA 3R27A 3THPA 4TU7A 1HD0A 1VBZA 2M88A 5IM0A 3CXCR 3VAJA 1CVJA 1VQ7S 2MMYA 3I56S 2KYXA 3MOJB 2LEBA 1ZZFA 1YIJS 5EN1A 5LSOA 1M5PC 3VF0B 1QVGR 3Q2TC 2YH0A 1FXLA 4WF9Q 1NJIT 1URNA 2RQ4A 2KFYA 3SMZA 2DITA 2K3KA 4J5OA 3SDEB 2MYFA 2MZRA 1KC8T 5DETA 1VQNS 2DH8A 1OO0B 5ITHA 2CQCA 3VAKA 2FPHX 3S6EA 1YHQS 1X4GA 2KT5A 1YITS 2FC8A 3CCLS 1YJNS 2E5GA 3CUNA 3UCZP 3UE2A 1KQSR 2LXUA 4C7QA 2AYGA 2DGXA 4CH1A 2I38A 1JJ4A 2M4MA 5JVHQ 2CQ1A 2M2BA 3SXLA 4PRFA 1IQTA 4YB1P 1FJCA 2CPJA 1O0PA 2SXLA 3P5TL 3OW2R 1VQ6S 3IWNC 1HD1A 2DH7A 2XS2A 1A9NB 1BY9A 2KRRA 2KXHA 5IFMA 2OIHA 2FHOB 4QQBA 2VOOA 3CC7S 4Y0FA 1HL6A 2LCWA 1X5SA 1U1NA 1X4HA 3HHNB 4LMZA 2KHCA 1X4DA 2KH9A 4CIOA 2ZJQQ 2RRAA 3VAFA 1PO6A 3U1MA 2O3DA 3I55S 2XS5A 2MZSA 4BS2A 1M5VC 4FXWA 1WF2A 2AYEA 1YTYA 1B7FA 2ZJPQ 2MZ1A 2MKJA 3CC4S 2DO0A 2YTCA 1WHWA 1UFWA 5GAHU 2VONA 3CULA 1OIAA 3ZZYA 1X4AA 2RQCA 3UD3P 2CPIA 2XB2D 1YWXA 1D8ZA 2MKIA 1FO1A 2MPUA 1QM9A 2MQOA 1JJ2R 3IRWP 1N52B 1M90T 3FEXB 1X5OA 3CMAS 2DNRA 2OTLS 2D9PA 2CQPA 1WEYA 4TLQA 1S72S 2DIUA 1N8RT 2OSQA 2CJKA 5MLCV 1U1MA 5IM0B 5FJ4A 3NS5A 1U1LA 3J7ZT 1YI2S 2K8GA 1X5PA 2RS2A 3P49B 5CA5A 1WWHA 4F26A 3H2UB 1VQ4S 2MJNA 5D78A 5GAGU 3MI7X 3CC2S 1JMTA 2X1BA 1FT8A 5DDQC 1H2TZ 1Q86T 4OZ1A 3B4MA 2MJUA 2G4BA 2DGOA 3R1LA 2MQMA 1S79A 1U6FA 2DNHA 2DGTA 4IOAQ 4TU8A 1ZH5A 1F9FA 2CQ0A 4Z2XA 4UQTA 2G0CA 2ERRA 2MKHA 2M8HA 1SJFA 2KG1A 2LEAA 1K9MT 3P3DA 1Q82T 3VAGA 5CYJA 3G8TA 2RVJA 2MSTA 2DNKA 1K73T 1JJHA 3CCMS 2DHAA 1WF1A 2OTJS 2DNZA 2HZCA 3K0JA 4QU7A 1FJ7A 2DNLA 1X4CA 4CH0S 2L08A 4RU2A 4FXVA 2KVIA 4V19X 3THTA 2FC9A 2J0SD 1HA1A 2ZJRQ 4C0OC 4CQ1A 2M0GB 3CCVS 1X0FA 2CQ2A 2CPHA 3US5A 2LQ5A 1X4EA 3ZZZA 1FNXH 2DISA 2YWKA 1X4BA 2CQIA 3UD4P 2MXYA 2LECA 2MZQA 4TU9A 2DNMA 4IO9Q 3CCRS 3R1HA 2PEHA 2X1FA 2KM8C 1WF0A 2DGVA 1VQPS 5LJ5Y 3G8SA 2I2YA 2DH9A 2EK6A 2E5HA 3HI9A 1FJEB 1NU4A 2JRSA 1WELA 3EGNA 1VC0A 4Y00A 2CPXA 4QPTA 2LA6A 2NLWA 5HO4A 1VQLS 4F02A 2OJ3A 4UY8T 1UAWA 4WKRA 1WEXA 1U1OA 1P27B 4WFNQ 1UW4A 1U1PA 2BZ2A 1YJ9S 4LJMA 2DGQA 5LJ3Y 2KM8B 3EX7B 2N3OA 2L41A 2LYVA 4LIRA 4ED5A 1YJWS 5LXYA 2PE8A 2YKAA 1WI8A 2JVOA 2DHXA 3CTRA 2RU3A 3NNCA 3BEGB 3G96A 1RK8A 1VC5A 2DNNA 2DNPA 1Q7YT 3RW6A 1FHTA 3G71S 1WG5A 2CQGA 2DK2A 2DNYA 2HGLA
chains in the Genus database with same CATH superfamily
1CJKA 2AMCB 1RT1A 3MCSA 5FDLB 2R8IA 2Y8YA 4ZVRB 5FLXU 4N56A 2CPYA 2E9RX 2JVRA 3OQ2A 3BS9A 5T7LB 1E6YA 3LWLA 3KTQA 4FF4A 4O44B 2RB7A 3ENAA 2AD9A 4R0JA 2DGSA 3TJAA 3Q2SC 2FJAB 2VF3A 4MJKA 2B51A 3GE9A 5I3PA 3D2WA 2ZH7A 2KH9A 4CH7A 3DOKA 3BO2A 3R6GB 5KT3A 3A4TA 3MEKA 1WG4A 2LKZA 3DXSX 5F8GA 3PCOB 5LOQA 1N34J 3SSSA 2BBEA 4IRCA 1UWBA 1VRUA 3OVSA 3IGNA 3WQPA 4OIXA 2CUYA 1GXTA 1UWAA 1RHMB 4P7TA 4OLOA 3P45B 3HLUA 3G6ES 4YUDA 5ETMA 2V4RA 3GYXB 1Y5IB 2BUNA 4WP3A 2DO4A 3V6DB 1HNZF 3A13A 2MGZB 2GMJA 2LU2A 4X65J 1VQOS 1FRLA 2W2NP 2CPEA 2GAGC 2WZ1A 3GCWP 3NG8A 4NEZA 3V81B 2KZMA 2EFGA 1YG0A 4N7TA 4ZLJA 1S6QB 3K5OA 2R7TA 2GC8A 3AXMA 5ETTA 3MM8A 2BOAA 4USJC 4PR6A 5H1SV 5JVGQ 3P96A 1X9SA 1UVJA 1UP1A 3H7HB 1H73A 3M2UA 2WW4A 2M8DB 1H7WA 1ROFA 2G1HA 3LPYA 5J2QA 1I5OB 4NA2A 3NOGA 3T1HJ 1UVIA 1SXLA 1KRPA 2V94A 3TVKA 1VBXA 1S0MA 1NDLA 4KPCA 3TVZA 5F8JA 2C2EA 1RTDB 2RS8A 3QT5A 2IVMA 1NCLA 5E3RA 2R7XA 4N5SA 2Z0GA 3MCOA 2HS4A 1EQ0A 5AE1A 3RB3A 3O44A 1XN9A 3RB6A 1T8EA 1O8BA 2DNQA 4FS1A 3TWZA 2J0QD 2OSRA 2KXNB 1A6LA 4EI2A 2E7VA 1IR2A 2I1RA 2RHQB 3DLLQ 2HHQA 1V3SA 4ZP6A 4OI1A 3CT9A 1BWEA 2MKYA 4IG0B 3KJQB 2WTFA 4JI1J 4NEYA 3ENVA 4NXNJ 2BE9B 4CLLA 3EZUA 4OX9J 3GIRA 4LBIA 3RBDA 1ZAXA 3DOMA 4MYTA 5KFGA 5IQ6A 1HI0P 3MXHP 2FJBB 3R2CJ 2QLXA 2KKHA 1XTZA 4NXMJ 4DR3J 2VG6A 3FEZA 2OLWA 4DUYF 3C46A 2GQ2A 4HEA9 2XM3A 1PGZA 4CLTA 3AJ1A 1HWIA 3ETOA 5J2NB 2K1RA 1WSVA 1YGYA 2KU7A 4Q8FA 2AYBA 4WFZA 2DHHA 3KLEA 3DI6A 5L1KA 2AJ1A 3JTOA 3T6BA 3VZHA 1R8CA 5CD4A 4F4XA 2AJ2A 4O4GB 2G9OA 1HBUB 4ZVOB 5LXRA 4U7CA 1RAJA 2G1DA 3PRDA 4J9MA 3CC4S 5J1EB 3U1NA 3I0SB 4YDDB 4DV2J 5KFJA 2VFSA 3NGKA 4NI2A 2XHWA 1IKWB 1SUQA 3PJ9A 2OEKA 3IFEA 3MD1A 4NLWA 4TQRA 1C2PA 2CQDA 4DV1F 4MYUA 3RYLA 1FDNA 2IAJB 5DM6Q 1FWKA 4DX7A 2DR5A 2DXFA 5G4DA 2CPZA 2MB0B 4DS4A 4O3SA 4FF1A 1B7YB 1PKUA 2R2TA 1NSKL 1OSDA 1TKTB 1U2FA 2NXUA 3MTKA 3NGSA 3FZ2A 2Z8QA 3M2RA 1KOHA 4E8UA 3NMRA 3VQSA 3KLFB 1B0TA 5K5MA 3GJSB 1C0UA 3EDRB 3N4WA 4L74A 4JI2F 1VQMS 3G6VA 2LQ9A 3H40A 3K57A 5C2GA 3M8QA 1XMOJ 2EC0A 4EBDA 1YBAA 2XSFA 2MQLA 1UZDA 1VGYA 2YNIB 4DCOB 2B56A 4BCAA 4F8RA 3GIIA 2R7UA 4CT9A 5A2QU 1RKIA 2KT3A 2B4PA 2MKCA 2RRBA 5D4NA 3LGHA 1L3UA 1FDBA 2W8LA 3OSPA 4I64A 1RT5B 2FHMA 3PIPQ 1G4CA 1AUSL 2C1EB 3IR7B 5D4PA 4NRUA 4DUTA 3L3CA 4LF8F 5IT9Y 1VI7A 3DYAB 3SI8A 3FCHA 2OPPB 2GO9A 3O3LA 5KG7A 3I0SA 1N32J 2EG1A 1A7GE 2ACYA 2OELA 2JSXA 3CE8A 1RWVB 2XI2A 2NUHA 3C15A 4IO1A 3J7YU 2C2DA 2VHGA 1JJCB 3LP0B 2BX6A 5IT9U 1F5AA 1DQAA 5KFYA 2AJ4A 2CPDA 1RTZA 2J7KA 3D6TB 2J8AA 1RZMA 2E1CA 1WHVA 1WEZA 4D3HA 2CZ9A 2MGZA 4EZ6A 1TVRB 3DMJB 4XIUA 1D3WA 2RKIA 2AX0A 2GW8A 2IM3A 2WVFA 2Z2ZA 3PEJA 2MQPA 4DR5J 5DS7A 5KT4A 3BO3A 2VPYB 2J8SA 4DL3A 2UUBJ 4Q0BA 3QNWB 3BBFA 4ID5B 4RBTA 5K8MA 3Q8PB 2BE7D 4PQUA 4OHVA 2GHVC 2MQNA 3HT0A 2ZH2A 3ZZOA 1FNOA 2YKOA 1HNXF 1S9GB 1UVNA 1MNEA 4FXDA 4LF6J 4BDPA 2IMWP 3VALA 2BV3A 3BN4A 1V3ZA 3LAMA 4IDKA 4WP9A 1WKJA 1ZM2A 3EJMA 4NMXA 2DNOA 3PR4A 4A8YA 2Y0SD 3TA0A 5FDLA 1V3RA 1TK8A 5KT7A 4WFXA 1RLCL 2RT3A 4PG4A 2LEPA 5D0EA 5KAKA 1S76D 1WNEA 2RNEA 1VHFA 1DJ0A 1KD1T 2DHGA 2CPFA 2HNZA 1S9FA 3T5HA 1JLAB 3LQVA 4PXBA 3BSNA 1H2UX 1Y0HA 3D0GE 4IG3B 1AB8A 2D9OA 1HNWJ 1FRJA 4NLQA 4R0EA 2FZCB 4C98A 3DRRB 3K58A 2QA4S 3GCXP 4F0HA 1ZA1B 1Y5LB 1E6VA 4TQSA 1NKBA 5CXTA 4DWIA 3AH6A 1NH7A 1LWFA 2RJZA 3M30B 5IZHA 5BR8J 4RX6A 3O6QA 4X4QA 2ZHAA 2D3UA 3QGPA 4DSFA 2G0JA 1NJWA 2HVHA 3UVJB 1KVIA 2MY7A 2N82B 1S4EA 2M70A 3AFGA 2M7SA 4FF3A 1FRHA 2NXNA 1QTMA 4URGA 2BRLA 2ATCB 4KAIA 4AXIA 1N5SA 3R27A 4OJGA 4XPEA 1P1LA 2BW2A 4MKAA 8RUCA 3MECA 2BKOA 3IGVA 2QYGA 3BZQA 2HK3A 4NI2B 3OLAA 1JXLA 2YKMA 1TQLA 4LF9F 3CXCR 1NUEA 2B9WA 1RT7B 2ZH8A 1AFJA 4A8MP 1KDNA 3LAKA 2DRBA 2W9BB 1TZ0A 2R42A 4DI6A 4F7VA 2OAUA 3HSJA 5HQMA 4X62J 3PW2A 3CO0P 3DRPB 3IN5A 5EN1A 2UVUA 1NK4A 5HMXA 4NLDA 3M32B 2UVWA 4YS2A 1SIWB 3EGVA 4KPYA 2B6AB 1JLBA 3ICLA 1IM4A 2OKQA 5KFXA 5LT5A 1AZSB 1QVGR 3KK3B 3Q2TC 2BW7A 4P2FA 3M8QB 3IO1A 4LREA 4MFBA 2H3EB 4CO4A 1EX8A 1JLBB 3QATA 2PFFB 3X1LB 4WZMA 4IQXA 1PYSB 1C0UB 2AHOB 4ES1A 1M1HA 4F50A 3KLIA 1MW7A 1YSJA 2GNKA 2PD1A 4JP8A 2BRKA 5DG7A 5DETA 1XMOF 2ZC4A 2JEJA 5A8WB 2DH8A 2Y0BB 2HAIA 1WC6A 3S6EA 3HF5A 4HTIA 5AJ3F 4ZVTB 4OX7A 5J1PA 4QR1A 3UPFA 4ZVGA 1VRTA 3MECB 4KHMA 5KFWA 2FGCA 1F2HA 4M5HA 2I6WA 1RAGB 1N56A 4A8OA 3CUNA 3PEHA 1RAHB 2UU9F 4KH1B 2ZE2B 2GIFA 4M5JA 2LXUA 1SV5A 3PV8A 4CLUA 4I67A 1Y9OA 4U6PA 1DTQA 3OXFA 1HBMA 2BJEA 5D4LA 3C6TA 3JTNA 4NLSA 3DOMB 2FHJA 3C19A 2NSBA 2I38A 3NBPB 2KZZA 4LSLA 3CDBA 4DSJA 3GWCA 1QD1A 2QL7B 2EC2A 3JYTA 3Q24A 2IJRA 4AL6A 1N5YB 1FE4A 2JLFA 2CRLA 3IM8A 1FJCA 2V9WA 3W2WA 3HKWA 1ZBTA 3EPGA 3OD2A 5D3GB 1JKHB 1HQ2A 1HQEB 2VG7B 1RT6A 2AP6A 1VLYA 3KDOA 4K2XA 3GV7B 1VIXA 1DQ8A 2GVDA 3EYZA 1A9NB 1IKXB 4ETZA 2KO1A 2R8JA 3QGHA 5IFMA 1QAIA 3BV8A 1NH8A 2DEJA 5I42B 4JI0J 1UEKA 2HVDA 3LW5C 4Y28C 2YNIA 1PAUB 4KSEB 2GVDB 1H98A 1JLCA 2UVRA 1SC1B 4DPYA 4EK2A 4Y0FA 1X8DA 4FPRA 3H2LA 4M5IA 1UETA 4A8FA 4LMZA 2ZJQQ 4JI3J 5I42A 3F0NA 1RAIB 4I6WA 4RZRA 5CAAA 4YQWA 3KLGB 1FJGJ 3SCLE 3U1MA 5JUMA 2R7OA 2O3DA 1PIEA 4P75A 1CJKB 1S1VB 4I7FB 2IYGA 1F1BB 2A10A 2CJXB 3W7BA 4LF4F 3PHTA 3FRZA 1WF2A 3QSIA 4FBTA 2IBKA 3OTDA 5AXLA 3RGIA 1O6XA 5GAHU 3Q8RB 3L4BC 3H90A 3HMJG 2XQCA 3C15B 2WVCA 1LW2B 2BEFA 2CPIA 4R25A 4DUYJ 1HMVA 4ZJQA 1JJ2R 5F8HA 4RW8A 2W7AA 1LV5A 3QFHA 4M8LA 1TL3B 3FMWA 3FDSA 3G2XA 3IXQA 1IBMJ 3WIVA 3D0IE 3ISZA 4RBUA 3N0VA 3OTCA 2CQPA 2EFVA 3SV3A 2C3OA 2KB2A 2OSQA 5THWA 1K44A 2FJEB 1FFGB 2F1FA 3B8HA 4ZPBA 3DLEA 1RTIB 3KHRA 1IN0A 4A8SA 4IFYB 1SJ3P 4ZN3A 2IPOB 3SBMA 4K59A 5A6PA 4ER8A 2ASDA 3M05A 2CADA 2JEGA 3VVTA 4HHUA 4YHHF 1OY6A 1EZZB 2P9GA 2K8GA 4DV1J 1YI2S 5DO2A 1EIYB 5CA5A 1S99A 1RA7A 4J9SA 3P49B 4F26A 2R7SA 2VL1A 3QQCD 3R7BB 4KFBA 4P74A 4MFBB 3UR0A 4A8WA 4DSLA 3PR5B 1RTHA 1EETB 1U0SA 4B3SJ 1FJGF 1AA1B 3CC2S 3KK3A 2BJ3A 1FVQA 4LF2A 1C4AA 4FYVB 2QC3A 3PYGA 1S12A 2HNYB 2C2ZB 2MJUA 3B4MA 4J9VA 3W63A 1HNIA 3KG1A 1S79A 1LXNA 2DXDA 1AZSA 2DGTA 2K7JA 3AB2B 1WDTA 2CIMA 5FLXY 1SKSA 4IOAQ 1FEEA 3I0RA 4B3RF 2DBBA 1XBWA 4J9QA 1R6YA 3BQ1A 3NGTA 3RR7A 4DR4J 3KLHB 4F2RA 2UXCJ 4NLPA 1M5OC 1RAEB 1TMJA 4OX8A 1K9MT 4PZVA 2XMMA 5J2PA 2IM2A 1S9EA 4X4PA 2VG5B 4K4WA 1RAFB 3MM6A 1LNQA 5CYJA 4CP5A 3VAGA 1S77D 1QDUB 3CCTA 5HK4A 4FDFA 2MSTA 2QJ3A 4RWWA 5D3GA 4RLEA 1JJHA 4A8QA 1K73T 4JOUA 2LU1A 2DHAA 2ZHOA 5CD4H 4QR2A 2AX1A 2VJUA 1RHQB 1KLNA 4DZDA 3C6TB 1X9WA 3CDAA 1SCJB 3UDVA 1FJ7A 3ZZRA 4CH0S 3I96A 1RHRB 3J7AN 2D1CA 4HKQA 2V5HG 4H4MA 3ILOA 4KV8A 5D15A 3UNGC 3K5NA 1T94A 2CJYB 5F9LA 2DPJA 2YKQA 3IC1A 3THTA 3VGSA 4TYBA 2NS1B 2J0SD 3LO3A 1HA1A 2MDAA 1N5QA 1UWBB 1VRUB 2M0GB 5KFPA 3OL8A 3DLKB 4AQYJ 1TTHB 3V4IB 4C8LA 2VFVA 1IKVA 2ZC3A 1EP4B 3T1AA 3QYYA 1U4BA 3MF5A 2VC0A 1GNKA 3ZZZA 4X4VA 1X4BA 4U95A 2BE2A 1FD8A 1RCXB 1XR5A 5KT6A 1OY8A 1RUSA 2R8HA 4OHXA 2AGPA 5HVGA 1RU2A 2E9ZA 3VV2B 2VU5A 4IDKB 1TAQA 3OVBA 1CPZA 4RW9A 1HYSA 2DGVA 1RE1B 3EGWB 4UQGA 2HHUA 2RAQA 3A12A 2W4DA 5F3TA 1HNIB 1N6QA 3VR1A 3G8SA 3SZ2A 1KHVA 5F8IA 1DAXA 1Z1ZA 1DLOB 2W4CA 2EK6A 3R6LB 4CCHA 4LSNA 3BYPA 3GJQB 1LOUA 4KRWA 3GIJA 2JRSA 2BVZA 1ZETA 2B8QA 3IP0A 1B64A 1WELA 2VQFJ 4LFBF 2ZKTA 2LA6A 2NLWA 3CDUA 4TXSA 4DU8A 2O1PA 5HO4A 1J2VA 1UAWA 2J9CA 1T9VA 1NM2A 3M6UA 1P27B 1P8GA 2V2QA 4ENOA 2AQ4A 4RW7B 2D69A 2V8PA 4AT1B 3RBEA 3RAQA 3TQEA 4YB6A 4DPXA 2W7PA 4FKYA 3NY0A 2C22A 3SCIE 2CVIA 2F4VF 2CKWA 4H4KC 4O0IA 1FXDA 1R27B 3TUIC 2GIQA 3QO9B 1Q0NA 3ZZ0A 2JVOA 3A1YG 2IA6A 1KTQA 2Q6CA 1LWCA 1Q53A 3DI6B 1J27A 4DFMA 1DTTA 4X66F 5LMNJ 2JLEA 4X65F 1BGXT 2K1RB 1HBNB 3C8YA 2YPZA 3M2VA 3MTJA 3NNCA 4JV5J 2ZBIA 2GQQA 3G96A 2YX7A 4U7UK 1RYRA 4MKYA 4JI5F 1I1GA 1K1SA 3C3LA 4AYBD 1Q7YT 5KFDA 1REGX 1NK9A 4ECYA 3R5AA 1FERA 1XMQJ 2C2KB 1WG5A 3C14B 4YN3B 4K4YA 2CQGA 4WBFA 4ZITA 2YWGA 2WSCC 1T9WA 2DNYA 4USTA 5KG2A 3T1HF 4LFAF 1FKOB 3F41A 3TAPA 2GJIA 3SSQA 1MMNA 4OHWA 3TO8A 3O8WA 3TZYA 1N54B 1WHXA 3HCXA 2HNZB 2E5IA 2RQKA 2WAQD 3BB5A 3E51A 4L72B 5DDRC 4K4XA 5KFIA 2M52A 3MMAA 5DGBA 3P4UB 3BGFA 2E5LF 1XNRF 1DARA 3ENWA 2EW9A 2QMUB 3D68A 1FWPA 4Y65A 2FIUA 1TK0A 1UFLA 2MLXA 2MQQA 1EAYC 3GSDA 3CD7A 4JI8F 5B7WA 3GJRB 4C97A 1ICEB 3K5LA 5DJBA 4F2SA 2DNGA 4FYWB 3FGVA 1UJ4A 2B5JA 5A8KA 2HGNA 3B4DA 3Q23A 1L3VA 2EKNA 4DV6F 2VPWB 2I8EA 3R8YA 1OWXA 2CQ4A 3A8EA 4HT7A 5GAEU 5DDOC 2C28A 2E44A 2V4QA 2RH3A 2HGMA 4DL2A 3CCJS 1VQ9S 4PG8A 1TL1B 1T9YA 1NHUA 2Y1LB 3BBBA 4KV8B 4N8NA 4QW8A 4QIGA 2RSQA 1AROP 3VAMA 2FVCA 4B3MJ 2N4DA 2MHEA 4DQIA 4OLPA 2C3YA 4DU7A 2IY5B 2PFDA 4OZLA 1G6BA 5C2CA 4OV6A 3OW2R 1NK0A 3WDOA 3U27A 2FZGB 1QY7A 5G0RB 1RHJB 1HW9A 3QIPA 4DPWA 3LP0A 3G4SS 1W2IA 2JLGA 4JUZA 1L3TA 1QAJA 1TKXA 1G1XA 2ZH6A 3CJRA 1VC6A 4IUFA 3A3NB 2ZVSA 4DCJB 3OPKA 5H9FJ 4IH6A 2YQ3A 1JLEB 3BGOP 1KOOA 2OO4A 3PDNA 1KHWA 2EKYA 4ECSA 4FVCA 1WUUA 4AL7A 3L09A 2J5AA 3VTIA 1H74A 4Z37A 2MKKA 2RHSB 3CIMA 5HROA 2HVZA 3NS7B 1RB0A 4A48A 4ZHRB 4ZP9A 1GXUA 1KEKA 4C3LA 4ERDA 1KS2A 1S0VA 4O3RA 2V9KA 2NUUG 4IYQA 4NLOA 4NZ6A 4ATNA 1SL0A 3CVKA 3UN2A 3R97A 5D6GA 5KFMA 2C2NA 2N3LA 2OGUA 2CXEA 3W5XA 4RUBA 2RU9A 4GO5X 4Q5VA 4MAKA 1NKEA 2ZZNA 4PPDA 2XSJB 4KC5A 4H4OB 4J9KA 1ZTWA 5HL7Q 2XY7A 3TUPA 5F8NA 3D28A 2VA2A 3T5LA 4LFCF 4M5GA 4WU3A 1SIZA 5GMKa 1HR0J 1Z4UA 1X5TA 1KTVA 3J80Y 2MSSA 4ES3A 2ZWPA 3M8PA 1W2BR 4JI1F 2ZDPA 3MMCB 5KFLA 4PKDB 3QO9A 3RG6A 2UUWA 1XIQA 1RBAA 2VG5A 4N77A 5DQGA 2VD3A 2N7CA 3PX6A 4CDIA 4KIAA 1Y10A 3MMCA 2V0NA 2VFTA 1HQUB 4ILRA 4PXCA 4J9NA 1TV6B 3C66A 1UJ5A 2HW3A 3NGUA 5I3QA 1IKYA 1SB6A 2DXEA 1C1CA 2IC3B 1T02A 1Y4ZB 2E1MC 2XZDB 3LP2A 4DJBA 1J5OA 2HFSA 4ZCLA 3POTB 2J76E 4OJ3A 2LQJA 3M7VA 3DRSB 5F8MA 5BYQA 4HH1A 3DM2A 4UT4A 1Q16B 3KUGA 2ZOGA 3H2VE 4I0WA 2UUBF 3G82B 4RWXA 2ZOFA 1DQ9A 4NYOA 3CD6S 1T7PA 4LBHA 3D6FB 3Q83A 3W2VA 2AU0A 1X9MA 3M32A 1BWVA 4ED4A 2DEIA 4RL1A 1HW8A 2GHPA 3Q8VA 4OZJA 1RWPB 4Q43A 3KLFA 1N6QB 4X4TA 4LF6F 3AD8C 3KFWX 4OV1A 2FB0A 2JZ5A 2BKNA 2OPQA 2IA0A 2U2FA 2ZITA 2R3VA 4UOCA 3KLGA 3GILA 2D3OR 1TUVA 5KT5A 5KT2A 1SVDA 2BM0A 4DG1B 1SH2A 1CSJA 2L48A 3ET6A 3T41A 1FTRA 4QWCA 1YRXA 2IRXA 2HHHJ 4JI3F 2O5DA 3M8PB 1WOSA 4QIWD 1F6TA 4IOCQ 2QA2A 2UVVA 2FJXA 2EFNA 1M1KT 1SJRA 3KHLA 5ETSA 1NBEB 1RT2B 3GB0A 4P52A 4USKA 5K8OA 2KI2A 5DQIA 2OD4A 2U1AA 2QSFA 3RUBL 3W9HA 4EBEA 1UPMB 4DV6J 3WHIA 1D0EA 1OPZA 2V68A 4EO6A 2A2CA 1NJXA 4RPFA 4ZPWR 2WBRA 2ZH4A 2JWNA 3CJ5A 3EE3A 4NX9A 3PYDA 5C42B 4QPXA 4UUXA 4ECUA 4LF8J 5IT0A 2CQHA 2PA8D 2QFJA 1FRKA 2G2YA 2YNGA 1GEHA 1S1WB 4PUOA 5GADU 2XZTB 4DR5F 3MEGB 2PA3A 3GP9A 5ETRA 5L9XA 4LF9J 4MMOA 2NPFA 3R3TA 2QTWA 3JB9k 2NYHA 2WHOA 3PO5A 3QT6A 2ALZA 1WG1A 2GFFA 5GVQA 4AQYF 2ZH9A 1MN7A 3QMQA 4LSZB 3I6PA 3DXBA 4Q2MA 5HQLA 3LP1B 1JLEA 3FVYA 2M5YA 3EZ5A 5K14A 2COLA 2BKPA 2XMTA 4C3MA 1PBUA 5IOLA 5E33A 3GONA 4LF7F 4L76A 2Z4PA 4P2SA 2AZ1A 3D54A 1Q4RA 3TP2A 3W1YC 3VAHA 3HD1A 4AE5A 4ELTA 1ZAVA 3W5ZA 3MM8B 3LP1A 4ZLPA 3W2VB 2I0XA 2CFXA 3TZWA 1KLMA 2PMHA 5B0AA 3HP6A 3HHKA 3GIKA 1Q81T 1XNQF 4B9TA 3J81j 3W61A 1PJ5A 3OXLA 5L9NA 1NAQA 3QFWA 1J5EJ 1U1KA 1RAOA 4CLKA 1TFYA 3MR3A 2PC6A 2PDAA 3MEEA 4DFKA 1U2CA 3CJ4A 4OZ0A 5DRKA 3J80U 1IR1A 3BF4A 2YNFB 5M2PA 2QG9B 2GS8A 1VS3A 5IC4B 1DBDA 3KYLA 5I3UA 3C6UA 3I4HX 2J9DA 1IUJA 3T6JA 3V6KA 1OS5A 2XY5A 4GRSA 4HLBA 1HHQA 4YEAA 3K8VA 5E5NA 3R7NB 5M2RA 2NXJA 2YKNB 3PNIA 4DV7J 5D0GA 1S9EB 3GV5B 2W1BA 3KWMA 1DRZA 1LW0B 4DR4F 1YQHA 3CJSA 1FNMA 4ID8A 3KKFA 3I32A 5LL6d 1VBZA 1I51B 3EICA 3ENQA 2L9DA 3R5BA 3JQMA 2B5JB 3F44A 2E1RA 4PABA 5E2QA 4DR6J 1HMVB 3K7RA 1VQ7S 4EFAC 3MR2A 3TEHB 3I56S 4WK1A 1U25A 1BE4A 1LK5A 1U8SA 2HMIA 3GTYX 1Y11A 1ZZFA 2LEBA 4LR8A 1QE1B 4MT1A 5D0HA 5E3CA 4NCGA 5EHHA 2AV5A 1GT8A 4TVAB 3SV4A 5AT1B 4NWBA 3IG1B 4V1Ak 4ZN1A 3EWGA 4P71A 5E7OB 3SSRA 4F02A 2OUGA 2VV5A 3MM9A 4U7UD 2VBWA 1TUWA 3NLCA 2RQ4A 3W60A 2AGOA 3LPEA 2FY8A 3I5CA 3A3OB 2GJFA 2MYFA 4NOHA 4YR3A 4F4ZA 1KC8T 1RTDA 3N6MA 1YRTA 1EETA 3MMBA 3NRBA 3OR2B 2IJFA 3MEDA 4P73A 5T14A 2FVQA 1R0AB 3LF0A 1R8AA 4AFFA 1BC6A 3H98A 1S9GA 3DKDA 3IR6B 3WC2A 3HSZA 3TOQA 4CLZA 3MAQA 2JH3A 1ZM3A 3E01A 3UFCX 3ITHB 3MPWA 2K06A 1S6QA 5CZXA 1CULA 3FKBA 3UCZP 1KNZA 3CDEA 3UE2A 3OFHA 2PI5A 4B3OA 2H51B 3TI0A 4C7QA 5I4MA 2AYGA 3F56A 1F5BA 4UZCA 1RWXB 2EFOA 1S6PA 3WC0A 4Y34A 3DOLA 3GJTB 2HHPA 3AJ2A 3ILLA 5C42A 3CD5A 3DLGA 5KFRA 2XMAA 4RW7A 3HHLB 4GKJJ 1CJVB 2VBZA 2YPYA 1LW0A 5ETKA 4B02A 5AJ3J 2J0XA 1CC8A 2CQ1A 4C8MA 4I68A 1KWMA 2HG4A 5IS2A 1RWNB 2ZNYA 1NRKA 4YB1P 5CYQA 3KMSA 3HD2A 3BGUA 4UUWA 2CPJA 1YRUA 3ISND 4A8KA 2J6SA 1KP6A 2EPIA 1Q8LA 3WX8A 2FYXA 4CM2A 2BANA 1UMJA 2BMBA 1IBCB 3AD9C 3GPAA 5KG1A 3UO0A 5RUBA 3C2PA 3IWNC 1HD1A 1R0BG 2BYCA 4ZVHA 3G87A 4JB8B 2BACA 3JQJA 2B7CB 1H38A 1HLWA 2DR9A 5KFNA 1C4CA 1S1UB 3DRYA 4J9OA 2ABYA 1SH3A 3RRGA 1FA0A 4DFJA 3HZEA 2V67A 2VOOA 1ZS6A 5SZTA 2XMVA 4QIFA 2G13A 2A2DA 3HVAA 4JV5F 1U1NA 2G2OA 1VYAA 4ZPAA 1Z2LA 1SC3B 1DY3A 2RD5C 3C14A 3DLJA 3EXCX 2HBYB 4RJVA 4Y2CA 4ZVEA 3VAFA 2RRAA 4JI7F 1IKVB 2Z30B 2ZFHA 3C16A 4DMZA 5KFOA 4DF4A 2HQCA 4DSIA 1GX5A 3T9ZA 1VQSA 1CG2A 1OYEA 4Y2AA 1M5VC 2F63A 4FXWA 4PYDA 2FTRA 4YDXA 2AYEA 2VDIA 2VG7A 2MZ1A 1RT3A 2ZKUA 2ACMA 5AE2A 2UUAF 1R6VA 2V4JA 2GGPA 1HFEL 1Q79A 1FXRA 2MQ8A 3AXKA 5J1NA 3ZZYA 3NL0A 6FD1A 1D9DA 2YNHB 1D8ZA 4DZ6A 1FO1A 3I9V9 2MPUA 4YY3F 1QM9A 4IH5A 3QWPA 4G6VB 3PYEA 2MQOA 3GQCA 3HXMA 4JI0F 1B7FA 3QT7A 3OFFA 2WONB 2B4VA 2OPPA 1N52B 1M90T 1FX4A 4ICLA 3CMAS 2DNRA 4B9VA 2IRUA 4UF4A 3R5DA 1S72S 2POKA 4ANDA 1TL3A 1RLDA 3LANA 3HK2A 2K7KA 2QZ8A 5KFZA 4EWTA 1JB0C 4K2JA 2FGOA 5KFFA 1U1MA 1MWYA 4HH0A 3L7PA 2CAJA 4DR6F 2HNDA 3B6BA 4NYZA 3BGRB 1TU0B 2F40A 3NGRA 3NS5A 1U1LA 4WJBA 1EJ7L 1X5PA 2ALYB 2HURA 1U0HA 2HQDA 4IR9A 4ZPTR 2QO3A 4B3MF 1MN9A 1YJRA 4PG6A 3TW0A 4C0HA 5FIIA 3PFEA 5HAOA 3FMBA 2P5VA 3JAMY 1GX6A 5BYSA 1P9QC 4KHPF 3MI7X 5B0FA 4D3GA 2UXDJ 2B3TB 2NPIA 4CLPA 2HVIA 1KLMB 1H2TZ 4F3QA 3RJMB 1UVKA 1RT3B 4OQJA 3THVA 2C2MB 1RWMB 4OZ1A 4P9SA 4ED7A 3CJKB 1NK6A 2VPZB 4KQZA 3QWUA 2XY6A 2HIQA 2MQMA 1TKTA 1U6FA 2DNHA 1D8YA 1NK8A 2EBGA 1UL3A 2YQ0A 1F9FA 5C24A 5KFVA 4C2MA 3JSMA 1ZH5A 1HBNA 3M2VB 1HR0F 4WK3A 2ZUAA 4Q44A 1JIHA 1OQ6A 4GVLA 4HTJA 2HWTA 2P9EA 4HDGA 2M8HA 4KE5A 4PCQA 1S7HA 3HSGA 3B82A 4FVMA 3HFVA 2KG1A 1SJFA 3D6MB 2ASLA 1G7CB 1TL7B 4DV5J 4OZ3A 4WIQA 3J7Z5 1RTJA 2UXBJ 2PI4A 4IRDA 5ETPA 3W62A 2GVZB 3MPYA 5T41A 1HBOA 2CJQA 1T3NA 2RVJA 2L3MA 5HP1B 4V19J 1Q5VA 3HHLD 1WF1A 4PXEA 2ZBPA 2DNZA 2YNFA 1XC9A 3SYZA 4QU7A 4LFBJ 1FRXA 1TL4A 2DNLA 1X4CA 2W2OP 2VBXA 4DLGA 2YWEA 3M9OB 3UVJA 4RU2A 2XGPA 2WRMA 2ZE2A 2PGCA 2EFPA 5ETLA 3MM7B 4F4AA 4YP3A 2IHR1 3KJFB 4WTYA 1FDAA 1DFDA 3CEDA 4NLTA 1N34F 5HVFA 4M5LA 4PWDB 4O44A 3RZAA 1Q1KA 1RWWB 1MG7A 2QE5A 5KFEA 3JSMB 2LQ5A 4FNIA 5C25A 1DURA 2DISA 4X66J 2XWYA 4PG7A 4GO7X 5D0RA 1PBAA 1MLAA 3UNYA 2CQIA 3HX9A 5F41A 3JXOA 2LECA 3UD4P 3IWLA 3T5KA 3BDPA 2EI5A 2MZQA 3UI3A 5LMUJ 5EWFA 2DNMA 1RACB 2QGFB 4Z7YA 4HYKA 1JKHA 1HQEA 5ETQA 4ECWA 4ED8A 2FLNA 2JHEA 3QIPB 1NHKL 4LQ3A 2X1FA 3OFGA 1N5TA 1EKSA 2RKIB 5J2QB 3PW5A 4H4MB 2KHDA 4QWBA 3Q8YA 1U2RA 1WOPA 3BSCA 3OTBA 1GQEA 2RIJA 4KFBB 1X0PA 5HI7A 4DPUA 4ECXA 1J5EF 1JLQB 4ELUA 4NZ0A 4BBYA 2QL5B 2YY3A 4R5PA 3HI9A 1VR6A 4ZVSB 5LSRA 4JI4F 4N76A 5E3QA 3DCAA 3EGNA 1VC0A 1WC0A 5GMDA 2RF2A 1EARA 2VKZG 4WKRA 2OJ3A 4DV7F 1RT2A 1WEXA 1MMDA 4ZJOA 1M0SA 4ES2A 1SQFA 2KT2A 2QV6A 1JNZB 4WFNQ 4E0DA 1UW4A 1U1PA 4WYWA 1S10A 2BZ2A 1YJ9S 4LJMA 2GCFA 3FJ2A 2ZNZA 4FYYB 4U96A 1VRTB 5LJ3Y 1SV5B 1S1TB 2BQ3A 2RDDA 2HLTA 2LYVA 1XJWB 2CNLB 3EMTA 2UV8G 4LIRA 3SFUA 4ED5A 3OVAA 3ZTQA 2IJNA 3OL6A 2W9CB 4O3PA 3O2IA 4NZ7A 1PG5B 1WI8A 2YKAA 3GSIA 2HQ3A 4MKBA 1RT1B 3HT3A 2FVRA 2XSJA 2DHXA 4CT8A 3CTRA 2WVDA 3KHHA 1C1BB 2J9EA 4DLEA 1NPPA 2QLFB 5A0YA 2FVSA 4C11B 4I2QB 3OL9A 4GKKF 2H5EA 1JX4A 3IR5B 2ATLA 2ZH3A 3VGVA 3H4DA 4DV0J 4DQRA 2DNNA 4GC7A 2DNPA 1TKZA 2V63A 4F36A 3QIDA 4NPOA 1AW0A 5D4OA 4CO3A 3ZFVA 3T1YF 2ZDOA 2H65B 3BR9A 2BXJA 2CA9A 4DV3J 1QAXA 2HBQB 2QLWA 1FRMA 2VC1A 4NLRA 4P2MA 2L9NA 4WE1B 1NDCA 1S7IA 3G86A 3HHDA 3PW0A 3C16B 4Y6IA 1UVLA 2HVEA 2OIHA 1FWLA 2IBOA 2F9DA 2HFUA 2MZJA 3CJ0A 3V6JA 1HNZJ 2WOMA 3UN3A 4A4JA 1QVFR 5HMZA 4QYZJ 5EWGA 1HBUA 4OYBA 1KFDA 5IQQA 1JLCB 3D3CJ 1DHMA 2F7VA 1BXNA 2OHDA 3RBZA 4RU9A 2KG0A 2X1GA 1XMQF 4YR0A 2FJDB 5IWAF 2W9CA 2IDEA 2WB4A 1M5HA 4LR7A 4DV5F 2UXBF 1Q8KA 2P9CA 3M2UB 1ZYQA 5DLGA 1VOMA 2EG2A 1LW2A 4XDCA 4P72A 4O3OA 4ZCIA 2FHJD 2R4FA 3N5BA 4ICLB 4ZVPB 4CLWA 1V6HA 4K5SA 4NA3A 5ETVA 1UZHA 4WFAQ 2UUCJ 2XEXA 4N47A 4RW8B 3HFZB 3M8YA 1P1TA 2HIYA 3ISNC 3NCRA 3Q89A 1NO8A 5KFTA 2AZ3A 2KXFA 2QMXA 2VA3A 4QCLA 3NXZA 3QBCA 3UCUP 1N0UA 5E3PA 2DGWA 1VQKS 1TL1A 5J2PB 3D0HE 2Z2YB 4B9SA 1CJVA 3DHXA 3PRVA 3NAIA 3DOKB 3CJTA 5JXSA 2IDLA 3DU6A 4F4WA 1H2VZ 1U24A 3PHEA 4K7QA 1V5VA 5K8PA 3HJVA 2YH1A 1U02A 1AUDA 3PIOQ 4O4RA 1O5JA 1WTBA 2HQFA 4GVBA 3ZNUA 3CCQS 3AOBA 4QU6A 3MURP 4W92B 3RTVA 4R8UB 2XLJA 2E1AA 4OJ1A 3RRHA 3SFGA 1U6BA 5IC6B 3PRBA 4DUZJ 3DU5A 4NASA 4YHHJ 1LFWA 4NCAA 4ID5A 3FCVA 4PQAA 4U8VA 3MR5A 2YQ1A 1CC7A 1R8HA 3QGIA 1LQ9A 4MIWA 3M2RB 4I4BA 5LSLA 3OV7A 2FY1A 1RAAB 2FLPA 1RWOB 2HWIA 3OSNA 2E1PA 3DRSA 4RNHA 4URSA 5KFSA 9RUBA 4P6QA 1Z2ZA 1U26A 4DX5A 4G1IA 4OX6A 4A8XA 3GFZA 3ZTRA 4DV4F 2RUGA 4K0KF 1GMWD 1FDDA 1XWLA 4LRDA 4KGMA 1WC1A 2IYIA 3HHLC 3K8WA 3DNCA 3LA0A 2ADBA 3FEYB 1MU2B 4MKVA 1YJUA 4YY3J 5D8HB 2Y9HA 2CDRB 1VJQA 1S1TA 4G1QB 1KQGB 1FF2A 1ZM4A 2OP5A 3HDSA 2Q66A 3MD3A 4KT0C 1N48A 1OPIA 1S6PB 3GR0A 4RNFA 2HHWA 4B9LA 2B9YA 4ED0A 2A3JA 2DIVA 4LUBA 4NMLA 1L5UA 4EZ9A 1G2EA 3MDFA 4ZP7A 4DOZA 4C8OA 2Q1LA 3CCSS 3ULHA 4CRJA 3TYTA 3C6UB 1XMBA 5KG4A 1NDPA 4ANEA 2FLLA 3EVOA 2BJ7A 2MY8A 1HPZA 1SJQA 1RT5A 2A0FB 2X7IA 3GLJA 4Q7AA 1REVB 4M1KA 3UWTA 5EDWA 1T05A 2CJAA 2FVPA 3TAMB 3KJVA 1XR6A 5BXIA 2X3GA 4I1TA 2B0GA 4DV0F 2B43A 4O23A 1B4SA 1D9AA 1Y3JA 3IWXA 3EPIA 3J7YI 2R7WA 3VHQA 3FBFA 2LMIA 3O5TB 4B9NA 4CNZA 4W98A 1YX2A 3RRKA 4J9LA 1RTHB 4L3KA 2VASA 3RW7A 1H72C 5HANA 4CO0A 1NJYA 2LDYA 2HFVA 4WFBQ 3BO4A 3DN9A 4HI2A 3AQOA 4PQUB 2BE2B 4KB7A 3R5CA 2ZHBA 1XNQJ 2XB2D 3FFIB 5FD1A 4DL5A 2Q6BA 1FEHA 3OUYA 2XYPB 1SJ4P 4ECTA 4P10A 4OHYA 3RBXA 1X4FA 1HNVB 2H9ZA 2UV8A 2ADCA 4RUCA 2JX2A 3IMQJ 1AXQA 1BQNB 4R5PB 3LOUA 2AEFA 3HHLA 5AXNA 1RHKB 1S49A 4LSNB 1DZ5A 3DRXA 3J81Y 3S01A 2UUCF 4FN5A 2UZAA 5JJBA 5JMNA 3V4MA 1WI6A 3M8RA 5DZ6A 3A8JA 3ZTSA 4X64F 2VH7A 4UOHA 1HARA 1R8PA 2NQPA 4I6AA 1T0TV 1TR0A 2ZUGA 3DLGB 2VODA 1DTQB 4LR9A 1OQ3A 2UU9J 1M5SA 5HJXA 3DRRA 1S48A 2W4PA 1D1UA 3MM6B 3DFEA 4OZ5A 4KR0B 4NCBA 2F65A 3EUNA 4E2FB 1F60B 2QEXS 2J0WA 2KYZA 3E8OA 4NXMF 2CQ3A 3K17A 4C4WA 3HVTB 1APSA 2RUSA 4WE1A 1JLGB 4WCEQ 1UVMA 4PWUA 3SDEA 1YDLA 1T9TA 1T3OA 5GADI 4WTOB 1U47A 2WOMB 3JTPA 2HHTA 1T11A 5C25B 4PXDA 3TZXA 1H6KX 1GXLA 4QR0A 2MZTA 4BC9A 3QZ8A 2KTQA 2Q43A 4ZKAA 2W7OA 3UR3C 2RDJA 1YLXA 3ZZPA 3IG1A 4PEOA 3NWGA 3W9IA 2XLKA 2AGQA 3TJ8A 1AFIA 4K5RA 4HHHA 4LSLB 2XO6A 4RR5A 3PX4A 1RKJA 1IJFB 3NS6A 3WX4A 2ZBCA 1X31C 5KG0A 5HBMB 4QWEA 2XCPA 5ETNA 4IR1A 4F04B 2NZ4A 3KHGA 5IXUA 4I56A 3H5YA 1RWUA 3M8ZA 2X1AA 3M1VA 2B6AA 3W66A 2JEFA 1F3FA 2D3ZA 4OHZA 2LVWA 1NLKL 1UTAA 2YWHA 3DGPA 3THPA 4B08A 1XNRJ 4M63A 4U8YA 1FTCA 2I5JB 4NRTA 2YBVA 2NYIA 2CWKA 3AAWB 3P8BB 1K47A 4LF5J 2F8EX 1HD0A 5ETOA 4RUHA 2OD6A 2QT7A 2H1YA 3ET6B 3MMJA 4LRCA 4W4MA 5IM0A 2V2KA 3GIMA 4JI8J 3VAJA 5AXKA 4NA1A 4F4KA 3CWJA 2VKRA 2MMYA 4WP8A 2FJWA 2KYXA 3KUEA 3J81U 3QZ7A 3BKTA 1N33J 1FKOA 3JSYA 7FD1A 5LSOA 2VICA 1VCTA 1KBRA 3TAQA 3GG1A 3VF0B 4F3OA 1ZA2B 2WVEA 5CYMA 2FLOA 2UUTA 5A6WA 3M6VA 2YH0A 3JS9A 3UDCA 3TAMA 3GFHA 3KJVB 1FXLA 4WF9Q 1NJIT 2O01C 4ECZA 1T03B 3A8KA 2F4FA 1URNA 3MOZA 2KFYA 4I2QA 2R2RA 2ASJA 2VDHA 2YX1A 3HKZD 3PJWA 4HHJA 5HN0A 1F2GA 2R8KA 4OI0A 5K20B 3MM9B 4Y3CA 4RW4B 1PSDA 3SDEB 2MZRA 3AT1B 3BGRA 3SIPB 3BJYA 5J2MA 1U09A 4X62F 5BYRA 1OO0B 2HFZA 2CQCA 4R8UA 5ITHA 5A2QY 4USIA 3VGTA 2W2PP 3POTA 2FPHX 3Q8QB 1YITS 1X4GA 2XG8A 3AA8A 2IM1A 3LH2S 5HROB 3HPOA 3FK4A 2PEBA 1NK7A 3MM5B 4EYHB 3DRPA 4EO8A 2V8HA 2ERRA 1YJNS 1WACA 1NKCA 3R7SB 4C8KA 5G0RA 4AL5A 1IVZA 5IWAJ 1RT7A 3PW4A 1RDRA 4DR7J 4JV1A 4RBVA 3PZPA 1AT1B 2WCXA 3CMQA 2ROGA 1RYSA 3FNNA 3AOAA 4MTPA 4JI4J 2LXFA 2IVFB 5HQ8A 4CH1A 2XMWA 3OR1A 2PIIA 1JJ4A 2XI3A 4QIEA 1E6VB 2M2BA 3MAHA 3SXLA 4ZA1A 4PRFA 2DPIA 4J37A 4KGKA 1HI8A 3FBBA 4AD6A 2BQRA 3OR1B 4UW2A 1O0PA 3P5TL 3H5UA 2H4WB 1ITPA 2HK2A 3IRXA 4LF4J 2HBRB 4WU2A 1ZPWX 2HS3A 3MFHA 3HSDA 2R7VA 2C42A 5DZ7A 3BGLA 5KFCA 2BJ1A 2XS2A 2NREA 4O0NA 3I0RB 5BR8F 1IWGA 1BY9A 1P9YA 2LQ8A 2X3DA 3PM9A 3QPIA 4B3OB 2KFZA 5HLFB 2DT9A 1B0VA 4QQBA 2ZOMA 3Q8SB 1RXOB 4JBCA 4ED1A 3MM5A 3CC7S 2RQMA 1K0TA 1HL6A 1FKPA 5CCMA 1UJ6A 3KUHA 2ZM6F 3HHNB 2KHCA 1NJZA 1E6YB 4CIOA 4DS5A 5KFUA 1QTNB 1VLOA 4OYMA 3OT9A 3MM7A 4CZCA 3OXGA 1TK5A 4AXJA 4CTAA 3V4IA 2XS5A 4FBUA 2MZSA 3ONQA 3DM2B 1QUPA 4RW4A 2R2SA 2GIRA 2HQIA 4XO0A 4ELVA 3MCMA 3CJKA 4DV3F 3AJDA 4DQQA 1OYDA 1RCOB 2APOA 5KFHA 2ZJPQ 2BANB 1YTYA 2MKJA 3TUZC 4KGZB 1UA0A 2WSEC 2DO0A 1URRA 2LLZA 2YTCA 1J5OB 1UFWA 4RNNA 1OMSA 3RR8A 2VONA 3CB4A 3EVMA 1KKHA 4DV4J 3UD3P 5B0BA 1FD2A 1HQUA 3NCQA 4HL9A 5KTQA 4K0KJ 3ZTPA 3N28A 3M9MB 2W9BA 1TL5A 4CM0A 4J9RA 4FP9A 1ZAWA 4U9RA 2I9SA 4X4NA 1Y5NB 4IFVA 5CZVA 1VK3A 3SQGA 3VCDA 4ZLNA 4K4VA 1PJ6A 3JSRA 1PC4A 4FPIA 4LIWA 2HHHF 1HI1A 2IAJA 4J91A 1UA1A 3OBIA 7FDRA 5B0GA 2A6OA 1JNRB 1WEYA 4OFZA 4TLQA 2DIUA 2JNJA 2WW8A 1N8RT 2MLYA 5MLCV 3KG0A 2QA1A 4Q45A 1RP5A 2GX8A 5L39A 2PT0A 5IM0B 3AD7C 5FJ4A 3SQOP 3VWSA 4C8NA 4ZIVA 4JV0A 2VG6B 1OY9A 3KLHA 3J7ZT 2OMLA 2RS2A 1NSPA 3I82A 3DGPB 2H4YB 2J9DE 1WWHA 3KLIB 3SCJE 3TR5A 3ZZTA 4XPCA 4J9PA 2V2ZA 2X51A 3H2UB 4M5NA 1T9XA 1IXKA 2MJNA 4K4ZA 2F8MA 2GJ2A 5L1JA 1FFSB 2VQEF 1IBKF 1LFPA 2CDQA 4WKYA 1ELOA 4OJHA 1JMTA 4X4RA 2MLZA 5DDQC 1RHUB 3GMGA 4OX9F 4ALZA 1REVA 2WSFC 5A0YB 2IC3A 1ZM9A 2XULA 2F4VJ 1DTTB 1SH0A 2G4BA 2Z56B 2AEMA 1VK8A 3HFKA 3I31A 4DR3F 2DGOA 3R1LA 1CJTB 2HEKA 3CJ2A 2E66A 3E3XA 1ZOTA 3ELHA 3H8YA 3GFYA 2H54B 1U48A 2CQ0A 2OPSB 3K89A 4C11A 2BM1A 4LQ9A 3IM9A 1IKXA 5LMUF 2ILZA 1IKYB 3AOCA 2G0CA 3LP2B 2MKHA 1CQNA 2K3IA 5MAOA 2J7WA 5DQHA 1YKWA 1XR7A 2LEAA 3KG4A 2DR7A 1EP4A 3MEGA 4LRBA 3LWMA 2N7YA 3P3DA 4MIBA 3RAMA 3AQPA 1PCAA 2HS0A 4G1PA 3O1LA 3PO4A 2J7UA 1VIOA 3CO9A 3KJNB 4F0MA 4TY8B 5L46A 1K0VA 3CCMS 4USWA 1RT6B 1Q5YA 2QFIA 3PFOA 4ZP8A 3CCZA 2HZCA 3HZGA 2OTJS 1LK7A 4G1QA 4USVA 2QSWA 5KG5A 1BD6A 3RB4A 1CEZA 5M2UA 4B3RJ 2JC1A 3H0PA 3V2UC 4NLXA 4XTTA 4PG5A 4CLSA 3GR1A 2QIFA 1NDKA 1JLAA 2Z2MA 1ACMB 2RRNA 3M4XA 4DQPA 1FX2A 4RW9B 3QSYB 1HYSB 4DN9A 4BHQA 4KBIA 4USUA 3MEEB 2FC9A 3EVWA 3MPVA 2QLJB 4NLUA 2H48B 3LALA 4C0OC 4CQ1A 2R7QA 2HZAA 3UN5A 4ZIWA 3MR6A 2KDOA 1N4LA 3H5SA 4DXLA 2CQ2A 1RWKB 3GV8B 3US5A 2K2PA 2OPSA 2E7XA 2Z57B 3D9BA 2W01A 3T5JA 1EKRA 1YZ6A 3JAMU 1FVSA 2BDPA 4WWSA 4WFYA 4OYIA 2MXYA 3PYFA 1NXIA 3LTOA 2Q3PA 1TP7A 1N5VA 4TU9A 1TKXB 3IS9B 4ZMMA 4CO2A 4IO9Q 1CJUA 3NGDA 2A1BA 2ZM6J 3R1HA 2PEHA 2C2RA 2Y3YA 1WF0A 2W2MP 3GYNA 2XMKA 2XMJA 5GAHI 1VQPS 3H20A 5LJ5Y 3TQ1A 3ETMA 4HDHA 1XERA 2DJWA 2YKPA 4FZVA 4XDDA 4DSKA 5L38A 5U47A 2CNKB 1SI9A 2DH9A 3MAAB 1T95A 2E5HA 2D41A 3JSBA 1Q8IA 1S1XB 5CH7B 3W2WB 3K59A 1Y00A 1RA6A 2EXUA 3G82A 3NWRA 3M9NB 1ULRA 3RU0A 4Y00A 1SUQB 3R2DJ 4NLYA 4QPTA 2DCLA 2HZVA 5H9EJ 1VQLS 4UY8T 1IJEB 4K4SA 5LM7E 3DLBA 1GFWB 5ADZA 5E41A 5C5JA 2PMWA 3H42A 1WJ9A 5HVHA 2DGQA 4TY8A 1Q95G 4IH7A 4C6AA 3EX7B 4XAKA 2N3OA 4LF5F 2PSZA 3UDLA 2GMHA 5A8KB 4LRAA 2RILA 4DR2J 1CULB 4QYRA 2YKNA 5LXYA 1YJWS 2PE8A 5B0EA 4LFAJ 1FI4A 1MROA 3NCPA 5E3AA 1YZ7A 4EU0A 2YNHA 4JI6F 3TJ9A 1SKUB 2KVQE 4E98A 2CG8A 2VQFF 2Z58B 1W26A 2WONA 2DYAA 1IM6A 2FJVA 4YFUA 2CVEA 4HT5A 3Q0AA 3IBCB 1UEUA 1TAUA 3BEGB 2UXCF 1RK8A 2P6TA 2ZZMA 5A8WA 4MH8A 1VC5A 3N5FA 1FHTA 2VQEJ 1IBKJ 4ZVQB 2O66A 1B70B 2YWFA 4TY9A 1LWFB 3FBCA 3M30A 3MAAA 4XK8C 3CNQP 4NCGB 1IBLJ 4NLVA 2Z2LA 2DK2A 2WK4A 4UTGA 4N41A 2IM0A 4LVOP 3W9JA 2NCKL 2HGLA 2QL9B 3AY0A 4Q8EA 1VHIA 4IRKA 1JQGA 2V2VA 2OH2A 5HLFA 2NSCA 2Y1RI 1VQ8S 4DUZF 3R5GA 2LXIA 2HHSA 1CJUB 2ZVIA 2RE1A 3G9CA 4GVBB 1YJ7A 4K50A 4PWDA 1QE1A 3NNAA 1FKPB 2HYIB 4H54A 1LWCB 2BR0A 5CQGA 4I6YA 1N36F 4DQSA 5A8RA 4JI7J 1RT4B 2PMZD 1WTFA 2RMLA 2H5JB 2HQGA 3PACA 1GTEA 4QWDA 3JYTB 1N5YA 3BDEA 3F73A 4YR2A 4UY85 4DHVA 4ZPCA 3BBCA 4DL7A 4DR7F 3ZNJ1 1IR0A 2M9KA 3UDEA 3KDNA 6FDRA 1H3DA 4RW6B 1FK9A 4G65A 2RDIA 3VAIA 4FS2A 4WIIA 4ZCMA 2VOPA 3IBWA 3DDIA 3N6NA 4KGVB 3MUMP 3KK1B 5L1LA 2DHSA 3OJUA 4EYIB 4K8RA 1ZZNA 2NXEA 4PYAA 3KK2B 3CGIA 4ILMA 1B99A 2ZH1A 5GAGI 3NNHA 3JQKA 2DTJA 3E2EA 1WC5A 5HMYA 5EX3A 1NB2A 3BQ2A 1U1QA 2UP1A 3TEGA 5HP1A 2D74B 4X2BA 2QMWA 3QLHB 4IG3A 1V5IB 3W64A 2Y8WA 2M3DA 2QX0A 4DG1A 4DBQA 4WXWA 4ED3A 2P6SA 1SC6A 1N33F 1NB7A 3ZO7A 3DYAA 1KN6A 3IS9A 3GG0A 4X4SA 1YK9A 4DN0A 5H9EK 3QLHA 2NZCA 4F25A 1X7VA 4W90B 4WYLA 3ZXWA 3D3BJ 1C0TA 1JK9B 1F9EB 2Q79A 1FE0A 1NEEA 3BN7A 3D66A 4MK8A 3RAXA 3CPWR 1QUVA 1B3TA 3J7A1 3AA9A 1HHTP 2CZVC 5HSPA 2ZEJA 3DDNA 2HHXA 1FESA 4RKUC 5CYQB 1QSSA 2V69A 4NYPA 1RU1A 2XWXA 3Q22A 4ECRA 3QRQA 4X4UA 1MMLA 2XNQA 1VRQC 2AYMA 2DGUA 3K5PA 4G3IA 1WKKA 2JEIA 1SC4B 3PW7A 2WVBA 3L9ZA 3H4BA 3V81A 4OYWA 1VDHA 3KK2A 4YB7A 4M94A 4Q0BB 3UD5A 1RTIA 1BLUA 3L7UA 4J9UE 1VMBA 2AKWB 2ZBQA 3NBPA 1BHNA 2L9WA 1RT4A 3CCES 1VJWA 3QRPA 1TL7A 2E5JA 4EGLA 3CJ8A 3D4JA 1GK8A 4BC7A 5KFKA 1LWEB 4YOEA 2I5JA 1Q7LB 1K8AT 4TLRA 2MEWA 1IKWA 4FF2A 4PPZA 1MROB 4X84A 4IFVB 1RTJB 4YB5A 1A0OB 1M1GA 3KXDA 3FCWA 5C24B 3NP5A 2ROEA 3S8SA 5A76A 3V5RA 1VBYA 1L3SA 1SQEA 4NL5A 2OPQB 4OI2A 3HJFA 2MKSA 3W8PA 3CF5Q 5K8NA 1LWXA 4U67Q 4K4TA 5D77A 2B4UA 1YBUA 1RBLA 1N36J 4RUAA 4YMEA 1CQMA 3L95X 4M5KA 5T7LA 4ZJLA 1PAEX 3I5AA 4LT6A 3FSYA 4NE9C 3GFXA 1SL2A 1N88A 4IG0A 1UEVA 1VQYA 5F0UA 4OL8A 3G6XA 2D7SA 4M5DB 4PWWA 2KL8A 4ZPDA 4ED2A 3OTOJ 4HR2A 4DL6A 2WB1D 1U45A 3D1QA 3MFIA 4F4YA 3CD0A 4MIAA 2HFOA 3DDKA 3WZ0A 5DDPC 2XC9A 3PY8A 1MSWD 3NEKA 3CSKA 1M5KC 3QGGA 1TKDA 2W8KA 1RGVA 1PYTA 5EGYA 2Y1JA 1CS4A 1D09B 2YX4A 2DD8S 5EUHA 1LXJA 1U0HB 2OFGX 2VPXB 2YKMB 3P5BP 4QOTA 2H5IB 4MK7A 1TV6A 3ZZUA 1JLGA 4ZPVR 3NAHA 2LA4A 2BJ9A 4OYAA 3KLEB 4ECQA 3N6LA 3WBZA 2KN4A 3AHPA 2JFKA 3PJXA 3MUVP 1UFKA 3PKMA 3DLKA 2XCAA 2GQCA 3CCUS 1VQ5S 3MUTP 3G8QA 2AJQA 4CNYA 4KKOB 1NZAA 4TYAA 1I6JA 1S1XA 3TA2A 4DX6A 1PJ7A 4Y2IA 2XO7A 4RW6A 1QSLA 1TFWA 1SQGA 1NMEB 3M1VB 3QJJA 1R31A 2C3PA 4A47A 4C3KA 1I3OB 3GYGA 1SL1A 3SCKE 3NOCA 3FC9A 1PYOB 5BJRA 4ED6A 4HVZA 3BKFA 4DEZA 1XK8A 3UCGA 2GGPB 1YVFA 2C3MA 4CLFA 4M95A 2JL9A 2CNOB 3FQLA 1JLQA 4P2XA 1R0CB 5KG3A 3DOLB 3W8GA 1NHVA 5F8LA 1U1RA 4QIVA 2F3JA 4KO0B 4JI2J 2F8HA 5DM7Q 1BMQB 4KJIA 1VISA 3DC2A 3P6YC 4DL0C 2DVIA 3N9UC 3PG9A 2JC0A 5B0DA 3W5YA 3HULA 1LEOA 3ITHA 2GA7A 2J6UA 2EK1A 3UQSA 3X3UA 1RBOB 2HRTA 4X64J 3CMES 1NSAA 3B54A 4LFCJ 2F9JA 4C48A 3I87A 2AT1B 2BOPA 3PKYA 1L3KA 3D67A 3R5JB 4CYUB 3U7JA 5DG9A 3RB0A 4KHRA 2F5GA 5L8RC 3CW2C 1KSPA 4GKKJ 2DB1A 4K4UA 3Q86A 4ZCKA 1CJTA 3IBFB 2LQBA 3BH6B 1IWAA 2EVZA 3MPDA 4L3NA 2JOQA 1HWLA 1YJTA 3U1LA 1V9OA 4OYPA 1T05B 3NMAA 2XNRA 4OI3A 1H7XA 5H9FK 2CQBA 1T03A 1WC3A 3FRYA 2B4OA 2GO8A 2GZOA 2XS7A 1TVRA 3DMJA 4ILLA 2MHNA 3FSIA 1PILA 2KRBA 3S7RA 3T9NA 2IMOA 1UW9A 1O51A 3BSOA 1ZTTA 2HRYA 2QRRA 4CI0B 4J90A 3KK1A 3QJPA 3MZIA 5KG6A 2AIRB 1WHYA 3MPUB 2BJDA 4DPTA 1GMVA 4I2PA 4HI1A 3S1TA 1KVKA 4DL4A 3E01B 1SBRA 4UOFA 4DDFA 4TU7A 1B0PA 4M5MA 1F0XA 2B7BB 2M88A 2VB6A 4LRFA 2VJVA 4GC6A 1I94J 5J1EA 1CVJA 1CLFA 1OSCA 4S0MA 3WIUA 4O3QA 2V8VA 5HJYA 1GTHA 4QYZK 3OR2A 4KGXB 3G6YA 4ZDNA 3MOJB 2BA9A 1YIJS 4TNOA 4FKXA 3TA1A 1JXVA 4EEYA 3EXYA 3SQGB 3BSAA 1M5PC 2MTLA 1S0NA 1Q78A 1FCAA 2RF2B 2ZH5A 2GMLA 3CDWA 3I5BA 5CCLA 1D9FA 4PUOB 1SKRA 3ZC4A 4C0BA 1S6OA 4AUKA 1RABB 4DPOA 2BQUA 4A46A 1JLFB 8ATCB 2ROPA 3FUYA 3SMZA 4LBPA 5F0WA 2ZD1A 2ASYA 2DITA 4NLGA 1C0TB 2W9AA 2K3KA 1F5CA 1EHWA 4J5OA 2CJ9A 3TRGA 1HKAA 3EDQB 3N79A 4DR1F 1HHSA 4ZVFA 1VQNS 1OJ4A 3EM1A 4UZBA 1WDDA 1S1UA 1YJVA 2VFUA 3W65A 3VAKA 3L7OA 2VZ9A 4CYUA 3LGNA 2KT5A 5CABA 1YHQS 3BQ0A 2YWWA 2XHCA 2FC8A 2VBYA 3T19A 5AE3A 5IT4A 3CCLS 1VFJA 4H4KA 2HMIB 2ZWOA 4C8ZA 1TMMA 2A6MA 5K14B 2CJBA 3HVTA 4DSEA 2E5GA 2FZKB 4TKTA 3IA0A 3LGMA 3VQTA 8AT1B 1S0OA 2JJ4D 5J2NA 1KQSR 1FRIA 2V34A 1W7WA 2E29A 2FHKA 3K2YA 3UW1A 1WC4A 2DGXA 2QN6B 2QLBB 2V4JB 3OLBA 4X4OA 1BQXA 2OPRB 2FD2A 2M4MA 7AT1B 5JVHQ 1YBTA 3HHEA 4DCPB 2NR0A 2E7WA 4IOBA 4J7CA 5KFBA 3TANA 1S1VA 3BPSP 4I7FA 2GVZA 3TX8A 1Y3KA 3OHAA 5HBMA 1IQTA 2ILYA 2HBZB 5EX0A 2SXLA 2B9EA 3CJ3A 4C8YA 5F9NA 1HWKA 1VQ6S 3W3SA 4LF1A 1RISA 1R89A 3BR8A 1G3OA 2JDJA 2V8GA 1UKUA 2DH7A 4CO1A 1QSYA 3GZ7A 5IV4A 4WXOA 2R2UA 1SPBP 2KRRA 2KXHA 2IIHA 2NXCA 3D6HB 5B0CA 3DHWC 2AW0A 4QZVB 5GAEI 2FHOB 1RJJA 3D1OA 2KJVA 2IRYA 3BYRA 4BLGA 2DCUB 2O67A 4DFPA 2E5LJ 4JYAF 1GH8A 4CLYA 4QBUA 3KLVA 2J6TA 2LCWA 1X5SA 1S59A 3DLHA 1X4HA 2KFNA 5CHCB 1CS4B 1X4DA 3MMAB 1GMUA 4HACA 1JLFA 1PO6A 2FUG9 1R0AA 2LP4A 4M5DA 2FQQB 4F0KA 3I55S 1IBMF 4LVNP 4BS2A 4OI6A 5B08A 2ZBRA 3VVUA 1S57A 2R8GA 4NXNF 5E0OA 3M8SA 1IBLF 2YXLA 4ZLLA 3CIZA 2PN6A 2N4CA 2OPRA 2R9LA 1HWJA 1WHWA 1N0VC 1RI7A 2HPUA 5DGAA 3CULA 1OIAA 1HBMB 1X4AA 3EZOA 1KQKA 2BABA 4KKOA 2RQCA 3PTWA 1KVJA 1S6UA 2AJFE 2HAFA 1WKLA 1YWXA 4IQMA 1NSQA 2AEJA 1MWQA 4Q2LA 5SUHA 1QJHA 5HMWA 2MKIA 4B3TF 3BM7A 2LFVA 2G2ZA 1H0HB 2A18A 4GMKA 3IRWP 1FFWB 4KHPJ 1LKZA 3FFIA 3QAEA 3FEXB 1X5OA 2OTLS 2UXDF 2D9PA 3M6WA 4EBCA 1SKWA 1WOOA 1HNVA 2C2OB 3QAUA 4L6V3 2IVYA 2CJKA 3PXGa 1UCNA 1KFSA 2DKOB 1HNXJ 3MHYA 3OUYB 3D1HA 1MU2A 2R7RA 3TARA 2DR8A 4KY3A 1JWWA 2GV1A 4URQU 4FYDA 2DY9A 2HWHA 4H4OA 2CYYA 5F3ZA 3HM9A 3NKYA 2D3O1 1GAOA 3OFEA 4L75A 3PX0A 4I2PB 3AB4B 2OFHX 3D5MA 1PC5A 1VQ4S 3HO1A 1F3VA 3FQKA 3M6XA 5D78A 1WSRA 2XYGB 3BPDA 4KH0B 3TVYA 5GAGU 4OZ2A 3VZIA 1XQIA 4OYZA 5I3UB 3H5XA 2X1BA 1FT8A 1RQ0A 3DGVA 3FBEA 1RADB 3OTOF 1N32F 1NK5A 3HVRA 1NZ8A 3IAM9 1Q86T 1HPZB 1HWUA 4BWMA 4CTAB 2E9TA 1C1BA 4ZS6A 3K5MA 3ADAC 3MGJA 4ANCA 5KFAA 2HNDB 4GKJF 2CNNB 5IV3A 3QT8A 4DR1J 4IKAA 4TU8A 2VFRA 4Z2XA 5C7PA 5L1IA 4HACB 9ATCB 2B9XA 4UOGA 4UQTA 2OI2A 1NPKA 4B17A 2CWXA 3MWBA 1QAYA 2GHWA 2P2CB 2EBEA 2WBMA 1NPRA 3QRRA 4JV2A 4IFYA 4CO5A 1R8BA 2HHVA 5DLFA 5KOXA 1Q82T 2C3UA 4DF8A 2PO4A 3A8IA 1U6ZA 2W25A 3T1YJ 1EB0A 3G8TA 2HKEA 2DNKA 3KOAA 2XYHB 3LUYA 1QLNA 3H25A 3Q8UA 2BJ8A 1TELA 3K0JA 2XLIA 2AJ0A 1S4FA 4ZVUB 4P7VA 3QJLA 4EUVA 4PAAA 1Y7PA 2L08A 5GMEA 5K9FA 1SJ1A 4FXVA 4ETXA 1P6TA 4QW9A 3N01A 1MWZA 2KVIA 3CCWA 3I4PA 3VGUA 3V6DA 2V8DA 2GAHC 4V19X 5A8RB 3BKUA 4ZOSA 4WZQA 4B3SF 1FK9B 1BQNA 4ZHRA 1DLOA 3FZBA 3R9LA 4Y2KA 2ZJRQ 3B78A 1GMWA 3OJSA 4DR2F 2V50A 2QYCA 1CBKA 3CCVS 1HBOB 1X0FA 2UUAJ 2OEMA 3BREA 2CPHA 2OEJA 1AYEA 1KQFB 3MR7A 4I69A 1VBKA 2OMOA 1X4EA 1FNXH 3TZZA 5EWEA 1TUGB 2YWKA 2HRUA 2G0IA 1UPPA 2CZ4A 4QWAA 4JYAJ 2HLUA 2DR6A 4KO0A 2VUGA 3ILJA 3ZTOA 4F3MA 1R3NA 2DRDA 2FDNA 4EMDA 3FSXA 4F67A 4USMA 5B09A 3IRXB 1IQZA 3CCRS 2EFQA 4OYXA 6AT1B 4OI4A 2KM8C 2XZWA 1HIYA 2HFNA 2VIHA 1TKZB 1HNWF 4C9DA 1S1WA 4DX8H 1F9HA 5CYMB 3KNGA 5HATA 4MK9A 4CWBA 1Q8BA 2I2YA 4B9UA 1U49A 2ZD1B 3T3FA 3SEOA 5DG8A 2JFDA 3TUJC 2Y1IA 4ZK7M 4Z7CA 3OHBA 1NU4A 4QJVA 4Y2MA 1WORA 2EEYA 4OZNA 4O3NA 1FJEB 1U8WA 4B9MA 3M8WA 2CPXA 2YNGB 4FYXB 4RNMA 1K1QA 1FKAF 1KR4A 3DLEB 1JXEA 4B3TJ 5LMNF 1U1OA 1T9UA 3TNVA 1C1CB 2P8IA 3H59A 2DRAA 1NNDA 3I9ZA 4RNOA 4WPAA 4JI5J 5KOWA 2KM8B 3MCNA 2L41A 4DV2F 1W25A 2XBPA 2XMUA 1KONA 1R43A 2XTJP 3OTEA 3HVWA 1I94F 2W2QP 2V6AA 4TN2A 2QA4G 4USHA 3TX0A 4O4GA 1BUXA 3MEDB 3OL7A 4L73A 2KJWA 4LF7J 1ZPVA 4OYOA 3ILIA 3EGZA 3A3PB 3U02A 1X60A 5J2MB 1LWEA 4ECVA 1S5ZA 4KTQA 3IAS9 3V6HA 2HNYA 2RU3A 1XEZA 3CJQA 3GU0A 2YVSA 5AXMA 1EQMA 4OMFG 3PVXA 4BWJA 3MMBB 1RSCA 3KMQA 2LDIA 1R7IA 2ZZTA 1WD6A 1BQMA 3D7SB 3RW6A 4RO0A 2EWHA 3BH7B 4FNHA 4KYZA 2HSEB 4N8OA 3KNAA 1U7LA 3G71S 1S97A 2CG4A 2W24A 2B8PA 3AODA 2AF6A 2IFXA 2XGQA 5KFQA 4JI6J 2DY1A 1BQMB 2AWZA 4ITSA
chains in the Genus database with same CATH topology
3MCSA 1RT1A 5FDLB 2R8IA 4N56A 2CPYA 2E9RX 2JVRA 3OQ2A 3BS9A 5T7LB 1E6YA 3LWLA 3KTQA 4FF4A 4O44B 2RB7A 2AD9A 4R0JA 2DGSA 3Q2SC 2FJAB 4MJKA 2B51A 3GE9A 3D2WA 2ZH7A 3BO2A 4CH7A 3DOKA 5KT3A 3MEKA 1WG4A 2LKZA 3DXSX 5F8GA 3SSSA 2BBEA 4IRCA 1UWBA 1VRUA 3OVSA 3IGNA 4OIXA 1GXTA 4P7TA 4OLOA 3HLUA 3G6ES 4YUDA 2V4RA 3GYXB 1Y5IB 2BUNA 1HNZF 2DO4A 3V6DB 2MGZB 2GMJA 2LU2A 1VQOS 1FRLA 2CPEA 3V81B 3NG8A 2KZMA 2EFGA 1YG0A 1S6QB 3K5OA 2GC8A 3MM8A 4USJC 4PR6A 5H1SV 5JVGQ 3P96A 1X9SA 1UVJA 1UP1A 3M2UA 2M8DB 1H7WA 1ROFA 5J2QA 3LPYA 4NA2A 1UVIA 1SXLA 1KRPA 2V94A 3TVKA 1VBXA 1S0MA 3TVZA 5F8JA 2C2EA 1RTDB 2RS8A 2IVMA 5E3RA 2R7XA 4N5SA 2Z0GA 2HS4A 5AE1A 3RB3A 3O44A 1XN9A 3RB6A 1T8EA 1O8BA 2DNQA 4FS1A 2J0QD 2OSRA 2KXNB 1A6LA 2HHQA 2I1RA 3DLLQ 1V3SA 4ZP6A 4OI1A 3CT9A 1BWEA 4IG0B 2WTFA 3ENVA 3EZUA 3RBDA 1ZAXA 3DOMA 4MYTA 5KFGA 5IQ6A 1HI0P 3MXHP 2FJBB 2QLXA 2KKHA 1XTZA 3C46A 2VG6A 3FEZA 2OLWA 4DUYF 2GQ2A 4HEA9 1PGZA 3AJ1A 1HWIA 3ETOA 5J2NB 2K1RA 1YGYA 2KU7A 4Q8FA 2AYBA 4WFZA 3KLEA 3DI6A 5L1KA 2AJ1A 3JTOA 3T6BA 3VZHA 1R8CA 4F4XA 4O4GB 2G9OA 1HBUB 5LXRA 4U7CA 1RAJA 2G1DA 3PRDA 4J9MA 5J1EB 3U1NA 3I0SB 4YDDB 5KFJA 2VFSA 3NGKA 2XHWA 1IKWB 1SUQA 4DV1F 3IFEA 3MD1A 4NLWA 4TQRA 1C2PA 2CQDA 4MYUA 3RYLA 1FDNA 2IAJB 5DM6Q 2DR5A 5G4DA 2CPZA 2MB0B 4DS4A 4O3SA 4FF1A 2R2TA 1OSDA 1TKTB 1U2FA 2NXUA 3MTKA 3FZ2A 2Z8QA 3M2RA 1KOHA 4E8UA 3NMRA 3VQSA 3KLFB 1B0TA 5K5MA 1C0UA 3N4WA 1VQMS 4JI2F 3G6VA 2LQ9A 3H40A 3K57A 3M8QA 2EC0A 4EBDA 1YBAA 2XSFA 2MQLA 1VGYA 2YNIB 2B56A 4BCAA 4F8RA 3GIIA 2R7UA 4CT9A 1RKIA 2KT3A 2B4PA 2MKCA 2RRBA 5D4NA 1L3UA 1FDBA 2W8LA 3OSPA 4I64A 1RT5B 2FHMA 3PIPQ 3IR7B 4LF8F 5D4PA 4NRUA 5IT9Y 3L3CA 1VI7A 3DYAB 3SI8A 3FCHA 2OPPB 2GO9A 3O3LA 5KG7A 3I0SA 2EG1A 1A7GE 2ACYA 2JSXA 3CE8A 2XI2A 2C2DA 2NUHA 4IO1A 3J7YU 3LP0B 1F5AA 1DQAA 5KFYA 2AJ4A 2CPDA 2J7KA 2J8AA 2E1CA 1WHVA 1WEZA 4D3HA 4EZ6A 2MGZA 1TVRB 3DMJB 4XIUA 1D3WA 2RKIA 2AX0A 2GW8A 2IM3A 3PEJA 2MQPA 4CCHA 5DS7A 5KT4A 3BO3A 2VPYB 4DL3A 4Q0BA 4RBTA 4ID5B 5K8MA 3Q8PB 4PQUA 4OHVA 2GHVC 2MQNA 2ZH2A 1HNXF 3ZZOA 1FNOA 2YKOA 3C2PA 1S9GB 1UVNA 1MNEA 4FXDA 4BDPA 2IMWP 3VALA 2BV3A 3BN4A 1V3ZA 3LAMA 4IDKA 1M5OC 1ZM2A 3PR4A 2DNOA 2Y0SD 3TA0A 5FDLA 1V3RA 1TK8A 5KT7A 4WFXA 2RT3A 4PG4A 2LEPA 5KAKA 1S76D 1WNEA 2RNEA 1VHFA 1DJ0A 1KD1T 2DHGA 2CPFA 2HNZA 1S9FA 3T5HA 1JLAB 3LQVA 4PXBA 3BSNA 1H2UX 1Y0HA 3D0GE 4IG3B 2D9OA 1FRJA 4NLQA 4R0EA 4C98A 3K58A 3DRRB 2QA4S 3NNHA 4TQSA 5CXTA 1Y5LB 1E6VA 1NKBA 4DWIA 3AH6A 1NH7A 1LWFA 2RJZA 3M30B 5IZHA 4RX6A 3O6QA 4X4QA 2ZHAA 2D3UA 3QGPA 4DSFA 1NJWA 2HVHA 1KVIA 2MY7A 2N82B 2M70A 2M7SA 4FF3A 1FRHA 1QTMA 4URGA 2BRLA 4KAIA 4AXIA 4XPEA 1N5SA 3R27A 4OJGA 1P1LA 2BW2A 4MKAA 3MECA 3IGVA 3BZQA 3OLAA 4LF9F 4FF2A 1JXLA 2YKMA 1TQLA 3CXCR 2B9WA 1RT7B 2ZH8A 1AFJA 4A8MP 3LAKA 2DRBA 2W9BB 1TZ0A 2OAUA 3PW2A 3DRPB 3IN5A 5EN1A 2UVUA 1NK4A 5HMXA 4NLDA 3M32B 2UVWA 1SIWB 4KPYA 2B6AB 1JLBA 3ICLA 1IM4A 2OKQA 5KFXA 5LT5A 1QVGR 3KK3B 3Q2TC 3M8QB 3IO1A 4MFBA 4CO4A 2PFFB 1JLBB 3X1LB 4WZMA 4IQXA 4ES1A 1C0UB 4A8YA 4F50A 3KLIA 1MW7A 1YSJA 2GNKA 2PD1A 2BRKA 5DG7A 5DETA 1XMOF 2ZC4A 2JEJA 5A8WB 2DH8A 2HAIA 3S6EA 3HF5A 4HTIA 5AJ3F 4OX7A 5J1PA 4QR1A 3UPFA 4ZVGA 1VRTA 3MECB 4KHMA 5KFWA 2FGCA 1N56A 4A8OA 3CUNA 3PEHA 2UU9F 2ZE2B 2LXUA 1SV5A 3PV8A 4I67A 1Y9OA 4U6PA 1DTQA 3OXFA 1HBMA 2BJEA 5D4LA 3C6TA 3JTNA 4NLSA 2FHJA 2NSBA 2I38A 3NBPB 2KZZA 4LSLA 3CDBA 4DSJA 3GWCA 3JYTA 3Q24A 4AL6A 1N5YB 1FE4A 2JLFA 2CRLA 1FJCA 2V9WA 3W2WA 3HKWA 1ZBTA 3EPGA 5D3GB 1JKHB 1HQEB 2VG7B 1RT6A 2AP6A 1VLYA 4K2XA 3GV7B 1VIXA 1DQ8A 3EYZA 1A9NB 1IKXB 4ETZA 2KO1A 3QGHA 5IFMA 1QAIA 1NH8A 5I42B 4Y28C 3LW5C 2YNIA 4KSEB 1H98A 1JLCA 2UVRA 4Y0FA 1X8DA 4FPRA 3H2LA 4LMZA 1UETA 2ZJQQ 5I42A 4RZRA 4I6WA 4YQWA 3KLGB 3SCLE 3U1MA 5JUMA 2R7OA 2O3DA 3W7BA 1S1VB 4I7FB 2IYGA 2A10A 4LF4F 3FRZA 1WF2A 4FBTA 2IBKA 3OTDA 5AXLA 3Q8RB 5GAHU 3HMJG 1LW2B 2CPIA 4R25A 1HMVA 1JJ2R 5F8HA 4RW8A 2W7AA 1LV5A 4M8LA 1TL3B 3FMWA 3FDSA 3IXQA 3D0IE 3ISZA 4RBUA 3N0VA 3OTCA 2CQPA 2EFVA 3SV3A 2C3OA 2KB2A 2OSQA 5THWA 2FJEB 2F1FA 4ZPBA 3B8HA 3DLEA 1RTIB 3KHRA 1IN0A 4A8SA 4IFYB 1SJ3P 5A6PA 4K59A 2ASDA 2JEGA 3M05A 4YHHF 2P9GA 1YI2S 2K8GA 3P49B 2R7TA 5DO2A 5CA5A 1S99A 1RA7A 4J9SA 4F26A 2R7SA 2VL1A 4KFBA 4MFBB 3UR0A 4A8WA 4DSLA 3PR5B 1RTHA 1EETB 3CC2S 3KK3A 1FVQA 1C4AA 2HNYB 3B4MA 2MJUA 1HNIA 3KG1A 1S79A 1LXNA 3AB2B 2DGTA 1SKSA 2K7JA 4IOAQ 2CIMA 5FLXY 1FEEA 3I0RA 4B3RF 2DBBA 1XBWA 4J9QA 1R6YA 3BQ1A 3RR7A 3KLHB 4F2RA 4NLPA 4OX8A 1K9MT 2XMMA 5J2PA 2IM2A 1S9EA 4X4PA 2VG5B 4K4WA 3MM6A 3VAGA 5CYJA 1S77D 3CCTA 1N32F 2MSTA 4RWWA 4RLEA 1JJHA 4A8QA 1K73T 4JOUA 2LU1A 2DHAA 2ZHOA 5CD4H 4QR2A 2AX1A 1KLNA 3C6TB 1X9WA 3CDAA 1FJ7A 3ZZRA 4CH0S 3I96A 2D1CA 4HKQA 2V5HG 4H4MA 4KV8A 3UNGC