2KRBA

Solution structure of eif3b-rrm bound to eif3j peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
81
structure length
81
Chain Sequence
b'DSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 3 subunit B
publication title The indispensable N-terminal half of eIF3j/HCR1 co-operates with its structurally conserved binding partner eIF3b/PRT1-RRM and eIF1A in stringent AUG selection
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 14
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2krbA00
1AUDA 1NO8A 1YITS 1VQ8S 2KVIA 2RQCA 2N7CA 2MGZA 4ERDA 5D78A 2NLWA 4Y0FA 4C4WA 2J76E 4YOEA 2DH9A 3RW6A 2CPYA 3VAKA 1X4DA 2DNGA 3CMAS 3L3CA 1YJ9S 3K0JA 2JVRA 2YKAA 3CC7S 3US5A 4Z2XA 4A8XA 1N8RT 3MI7X 1UW4A 1SJ4P 2DO0A 4UY8T 2DNRA 2FC8A 3U1MA 1L3KA 4P6QA 4M5DB 1WHYA 2I38A 1N52B 3S7RA 3I56S 4UQTA 2XS7A 2CPEA 3OW2R 1H2UX 3I55S 2DH7A 3TO8A 2DNQA 2AYMA 2MPUA 4IUFA 4LMZA 1JJ2R 3CUNA 1W2BR 3HHNB 2M2BA 3IRWP 1VQOS 2OTJS 1DHMA 2HGMA 2MQMA 1WEXA 1WELA 2ZJQQ 2DIVA 2O3DA 5DDPC 3THPA 3RW7A 2CQBA 3BS9A 3VAGA 3VALA 2AD9A 4RU2A 2CQ2A 1DBDA 1VQ9S 2E5GA 3B4MA 2K3KA 1FJEB 3CXCR 2M8HA 1WI8A 2KG0A 3CCSS 4C7QA 1KC8T 1M5KC 4W90B 4TU7A 5LSLA 2LQ5A 1A9NB 2E5JA 2EK6A 2LKZA 2Q79A 5IFMA 5HL7Q 3ULHA 2VOOA 4QPTA 2KG1A 1VQKS 2DHAA 4FXWA 2DH8A 5H1SV 2LYVA 5JVGQ 1QVFR 1X4GA 2XNQA 3MUMP 3CPWR 2HGLA 2CQHA 1N54B 3CCUS 2L08A 1SJQA 1F9FA 2CPHA 5LSOA 2DNZA 3G96A 2QFJA 2XB2D 4ZKAA 3JB9k 2F9DA 2ADCA 2RVJA 2DGTA 3VAJA 5DM6Q 1XN9A 2M7SA 1KQSR 2ZJPQ 1P1TA 1ZH5A 2KM8C 1VC6A 4YUDA 3B4DA 5GAEU 2MQQA 4WIIA 1Q82T 2KRBA 1WI6A 1K8AT 1K73T 2F9JA 2KYXA 2LA6A 1FXLA 2CQGA 2VONA 2MY8A 2GHPA 1DRZA 1G2EA 1FNXH 1N88A 2MQNA 1M1KT 1OWXA 2L41A 1VQ6S 2CQ0A 2XS2A 3VAHA 1Q81T 4WCEQ 2MZ1A 1X4CA 1CVJA 3NNHA 5MLCV 1X5SA 3CCJS 5LXRA 1WEYA 5HO4A 2VOPA 1A7GE 2JRSA 3P5TL 4F26A 3TYTA 1VC5A 3H2VE 2MKKA 1H6KX 3G71S 1D9AA 2F3JA 1YHQS 3NS5A 5DDQC 2MZRA 3BEGB 2HVZA 4PRFA 2A3JA 2OIHA 2V94A 2X1BA 4PR6A 2G4BA 1KOHA 3V4MA 3ZZYA 3UD4P 1VQ7S 3J7ZT 1JMTA 3SDEB 2JX2A 2VODA 2CPIA 1U1RA 2L9WA 3UCGA 3UCUP 2MJNA 4WKRA 3BO2A 4EGLA 1R8HA 2KXFA 2KI2A 4OZ0A 3EGZA 2FPHX 1UFWA 2CQCA 2DO4A 1WG1A 2DHGA 4QU7A 1SJ3P 4QU6A 3FEYB 3EX7B 1X5PA 5DETA 2KT5A 3UWTA 3MD3A 1S79A 1U1MA 2G1DA 3LPYA 1HL6A 2DNMA 2MQPA 3BO3A 2RU3A 3PIPQ 2CQIA 1RK8A 1U1QA 3U1LA 2M0GB 3CCMS 2D3OR 1U1NA 3NNCA 2MKCA 1ZZNA 1FJCA 1M5VC 2MYFA 3CC2S 2MGZB 2LEBA 3DLLQ 3S01A 3NMRA 4F25A 2DGUA 2AYBA 4LJMA 2MZTA 3THTA 2MSTA 2FY1A 3G8SA 1X4BA 2PEHA 2J0QD 2MKIA 2FC9A 1YIJS 3NS6A 1H2VZ 1B7FA 2MSSA 2DGOA 3ZZZA 1JJ4A 1U6FA 3G6ES 2E44A 3S6EA 1WHXA 3CCRS 5IQQA 2B0GA 2CPDA 2DGVA 1U1LA 1U1PA 3CCQS 2D9OA 2LCWA 2J8AA 2MKHA 2J0SD 1X4HA 2LXIA 3D2WA 2QEXS 1UP1A 1OO0B 4FXVA 5IM0B 2MZJA 3G4SS 2JWNA 2DNHA 2XS5A 1U6BA 2RRBA 3UCZP 1VQLS 2RT3A 2DK2A 3CTRA 2AYEA 2E5IA 1YWXA 4Y00A 2MQOA 1YI2S 2XNRA 4CH1A 3FEXB 2FHOB 2HZCA 1VQPS 1OPIA 1NJIT 2DGXA 2KM8B 3VAMA 5LJ3Y 1M5OC 3PIOQ 4WFBQ 5JVHQ 3CULA 4WFNQ 4LIRA 2U2FA 4CIOA 2QA4S 3P49B 2U1AA 2MZSA 2M88A 2DNLA 4QQBA 2CPZA 4U67Q 3TP2A 1QVGR 3NNAA 1NU4A 2XSFA 1JJHA 2I2YA 3VAIA 4BS2A 1K9MT 2UP1A 4IOAQ 1U1KA 2RS2A 4V19X 2OSRA 1SXLA 2LMIA 2M4MA 3MOJB 1PO6A 3P6YC 2DNYA 1VC0A 5LXYA 1FO1A 1X5OA 1HA1A 1SJFA 2DNKA 2RRAA 2MXYA 1U1OA 1FHTA 5GAGU 2GO9A 1PGZA 3S8SA 2DHXA 2CQ1A 2K8GA 1VQNS 2N3LA 2KHCA 2RNEA 2SXLA 1M90T 2LEAA 1X5TA 3CD6S 3HI9A 2MHNA 3CC4S 3G8TA 2M52A 5CYJA 3DXBA 2CQ4A 1X4FA 2WBRA 2M70A 1YTYA 2KN4A 3CCLS 5D77A 2YH0A 5DDRC 3CCES 2RQ4A 5DDOC 2CPJA 5CXTA 2N3OA 3P3DA 5GAHU 1X0FA 1VQ5S 3N9UC 2DIUA 4IOCQ 4TU9A 1SJRA 2OTLS 2LA4A 4F02A 1WEZA 2MY7A 2MJUA 3J7YU 2CQPA 1QM9A 2YTCA 1KOOA 2KXHA 3G9CA 3H2UB 1ZZFA 5GVQA 2MMYA 2KRRA 5EN1A 1HD0A 4CH0S 4WFAQ 1URNA 5IM0A 3MD1A 2DNNA 2G0CA 2ADBA 5FJ4A 2MKJA 1KD1T 2E5HA 1VQ4S 2LXUA 3Q2TC 4PKDB 4W92B 3MDFA 1BY9A 1X4EA 1RKJA 1WHWA 1FT8A 3CMES 2KFYA 2DISA 2D9PA 2MQLA 3VF0B 2MZQA 4CQ1A 1S72S 1HD1A 2DGSA 1IQTA 4IO9Q 2MKSA 1M5PC 1WF1A 4J5OA 3MURP 2HYIB 3EGNA 2ERRA 1DZ5A 5LJ5Y 2NZ4A 3CCVS 5ITHA 1WHVA 2EVZA 3R1HA 5BJRA 2N82B 1R8PA 1P27B 2ZJRQ 2DITA 1OIAA 1H2TZ 1O0PA 2KU7A 2M9KA 2RUGA 3UE2A 2PE8A 5CA5A 2DNPA 2OJ3A 4WF9Q 1VBXA 3MUVP 2CPFA 1VBYA 2BOPA 2JVOA 3VAFA 2HGNA 1Q86T 1WF2A 2LECA 1WTBA 1FJ7A 2RS8A 4ED5A 3SDEA 2CJKA 3MUTP 5GMKa 2YWKA 2CQDA 5GADU 1Q7YT 2M8DB 2DGQA 2CPXA 2AYGA 1VQMS 3Q2SC 1X4AA 4TU8A 1WG4A 3UD3P 3BO4A 2DHSA 2X1AA 1UAWA 1YJNS 1WF0A 2MB0B 2CQ3A 1VBZA 4C0OC 2KH9A 2BZ2A 2DB1A 3SXLA 1WWHA 3R1LA 5DM7Q 2KXNB 4OZ1A 3SMZA 4TLQA 2X1FA 3IWNC 1WG5A 1D8ZA 2DGWA 2X1GA 2OSQA 4YB1P 3R27A 3LQVA 3CF5Q 1YJWS 2EK1A 3MXHP 1U2FA 2DNOA 2YH1A
chains in the Genus database with same CATH superfamily
1RBOB 1R0AA 4NI2B 5HP1B 3D28A 2E5LF 2VASA 5B09A 3PYGA 4KYZA 2V2KA 1UW4A 2CXEA 4JV1A 1WHYA 2YX1A 1UVLA 5KFAA 2BJEA 4OL8A 2W9AA 1S0OA 2GQQA 4BWJA 1CJVB 3FGVA 2FTRA 3M6XA 4WP9A 4NYOA 2HAFA 4A8MP 2BQRA 2RIJA 3AOAA 2IYGA 4RU2A 4RBVA 1VQ9S 3NWGA 2V8VA 4YFUA 4WWSA 1WI8A 3OR2B 3IP0A 5K8MA 4K0KJ 3CCSS 2PI4A 4N41A 1XMQJ 4YS2A 2OEKA 4W90B 1RAGB 5LSLA 2FLOA 4M5HA 1E6VB 2XMMA 5AE1A 2YQ0A 2XNQA 4WBFA 3CJSA 5I4MA 2CPHA 1C4AA 2ADCA 3C2PA 1HWLA 3DKDA 2HNZB 2C42A 3A8EA 3E2EA 2KM8C 1VC6A 3B4DA 2BOAA 4DJBA 3PW5A 4HVZA 5CZVA 4OZ5A 2F9JA 2VG5A 4X65F 3IAS9 2VONA 1J2VA 3A1YG 3GG1A 4ZPDA 1QD1A 1WDTA 2HQFA 3EVMA 4Z7YA 3HMJG 5HQ8A 2FGOA 3K5OA 1TVRA 4P72A 3HJFA 2UXDJ 1VHIA 4DFMA 2EFQA 3GMGA 4M5LA 1PAUB 2KXFA 4RW4A 3CGIA 4KT0C 2HK3A 5K8PA 3OUYA 3EX7B 5DETA 4B3OA 1U2RA 3HD2A 4OHVA 2RU3A 3MOZA 2GJFA 2P5VA 1M1HA 3DGPB 5F8MA 2XHWA 5T41A 4UQGA 3I0RA 4LJMA 4LSNB 2AHOB 3N6MA 1QTMA 3K17A 2GGPA 1EARA 4TYAA 2ZOFA 3LOUA 5HVHA 2VFRA 1UP1A 1W26A 3GONA 2DK2A 4IG3A 2AYEA 1YWXA 3KHHA 3VAMA 3EPGA 4RLEA 2QMUB 5ETQA 3KXDA 4LF4J 2IRXA 4LR9A 2E9RX 5CZXA 3NNAA 1RWNB 4OMFG 3QYYA 1NCLA 3CEDA 2IRYA 4YB5A 2HRYA 4IFVB 3FMWA 2A1BA 5BYRA 2W25A 3MPYA 1RDRA 3DXBA 3N4WA 2IJRA 2WBRA 3GCXP 2QC3A 4J91A 3LO3A 3VTIA 4ECYA 4KHPF 8AT1B 3NRBA 4M5KA 2AV5A 2ZH3A 4DR3F 3FZBA 2DRBA 4F3OA 3W2VB 1S49A 2BA9A 2JLFA 1BXNA 2DNNA 3QT8A 4OX7A 1VQ4S 3MPWA 2OAUA 2PFFB 2RDJA 4MKVA 3DMJA 1L3UA 3OL8A 3DI6B 2HHTA 2XMWA 4C48A 5LJ5Y 5EX3A 4WE1A 1PYTA 2RUGA 2C2ZB 4MYUA 5IT0A 1SQEA 2XTJP 1AXQA 1TQLA 4OHWA 4M5GA 4DUZJ 3D68A 4ED5A 1UVKA 3MUTP 2JH3A 2DPJA 3KDNA 3FZ2A 5L39A 1WNEA 2DHSA 2X1AA 1QSSA 2HIQA 1M5HA 4FF4A 3MZIA 1YK9A 1HPZA 3NGUA 4DX5A 4JI1F 2DGWA 5DRKA 2VB6A 3C6UB 5L46A 3EICA 4KFBA 4KKOA 2KVIA 4DR4J 2N7CA 2HSEB 3BN4A 3C19A 1FRHA 2DHHA 4ER8A 4YOEA 1B70B 2XY5A 4QIEA 3BKFA 1NSKL 4ZIVA 2XCAA 4ECTA 1U0HB 1RT3B 2R9LA 1S6PB 2HFVA 4FYYB 1O6XA 4LMZA 1XNRJ 4QIFA 3EXYA 4Z7CA 2VV5A 5DDPC 1R27B 4QOTA 2Y3YA 3OHBA 1GH8A 2BANB 3HCXA 3TARA 2PO4A 5KFSA 1E6YB 2GAHC 5KOXA 2ZUGA 4USUA 4L3NA 2OPQB 2VDHA 2ILZA 1RWUA 3QO9A 1WD6A 1VI7A 4I7FA 2C3YA 2EG1A 1Z2LA 5HN0A 4LF8J 2VBZA 2CQHA 1HQUB 5F8LA 3HHEA 2DNZA 1ZS6A 2E1CA 3M6WA 5AT1B 5KFJA 3TX8A 1DY3A 1ZH5A 4USJC 3OTOF 1NK7A 5GAEU 2GMLA 2J9DA 1VDHA 1UL3A 4ATNA 4PUOB 1TKXA 1RT7A 3DHWC 4UZBA 2JSXA 3E01B 4JI8J 1BUXA 4OHZA 3CD7A 4QW9A 3SV3A 5HO4A 4WJBA 2Z8QA 1A7GE 3QIPB 2DCLA 1S1XA 3AQPA 2MLXA 3CO0P 1IKYB 2IVFB 3VVUA 4PRFA 2HQGA 1J5EF 1S1VA 4X62J 4H4OB 2FHJA 4WKRA 2B4OA 3BQ0A 1FFWB 2YKQA 3UDLA 4K50A 2DHGA 4IG0A 1EJ7L 3KLIA 3MTKA 5CAAA 3DOLA 3T5HA 1C0TB 3CCMS 3VVTA 2J6UA 4PQUA 1RZMA 1KEKA 1RTJB 3L7UA 2MZTA 2Y1IA 3PX0A 2XMTA 3NGRA 4X66F 1IKWA 1X4HA 4F67A 5IM0B 2MZJA 2XS5A 3H4DA 7FD1A 1KTVA 3FBBA 5DQGA 4RNFA 4CH1A 3RBXA 2MHEA 3PNIA 5JVHQ 2D7SA 3K5NA 4CIOA 1JX4A 3RB4A 2RAQA 2GMJA 5D6GA 2WVBA 4GKKF 4CYUA 1KVIA 4N8OA 2UXDF 4IOAQ 5E3PA 2LMIA 4CTAA 2DD8S 1NHUA 1VJWA 3PJ9A 5K8OA 1F2GA 1LXJA 2G0JA 4ECQA 1FERA 2V69A 4DR5F 1FF2A 2PD1A 3KLFB 3W9IA 2B9YA 2H4YB 3UVJB 1CJUB 5F9NA 4URQU 1OS5A 4LF6J 2B4VA 2W2NP 2V8DA 2W4DA 3CC4S 5CYJA 3T5KA 4I4BA 2OPSB 7AT1B 4FYVB 3MEGB 2KN4A 4PG4A 1H74A 2OEJA 1SJRA 2YNFA 3UR0A 2CQPA 2L9DA 3C46A 1S9GA 3H2UB 2W24A 4PAAA 4DQIA 1BLUA 1JLFA 2VHGA 4B3MJ 2MKJA 1U24A 3PDNA 1KD1T 5HLFA 2FIUA 2QA1A 1ZYQA 2JEJA 1SL2A 4DU7A 3SSSA 5AJ3F 3IWLA 2ZHAA 3TVYA 4F8RA 1FT8A 3CMES 3P45B 1YDLA 2JOQA 1T94A 3MEDA 5JMNA 3RAMA 3V4IB 3PY8A 4A8WA 2EVZA 5IT9Y 3IA0A 4LF4F 1RU1A 4DPOA 3R9LA 2PSZA 3QATA 1T03A 4EO8A 1YJTA 3D54A 3TJ9A 3VAFA 4DV7J 3KG4A 3TVZA 2MQ8A 1WC0A 3LWMA 3SDEA 4LT6A 4R0JA 2YWKA 1JLAB 4LF9J 4O4RA 4ZK7M 3OL6A 1RISA 1IBKJ 4QIGA 4YR0A 4C0OC 3BGRA 2NUUG 5BYSA 4KGMA 4DFKA 1RWPB 1JLQA 2X1FA 4BC7A 2GQCA 4UY8T 3G6YA 4U96A 2B3TB 2GA7A 4IQMA 2YKAA 3H59A 1HNWF 3HHKA 5J2PA 2DR6A 4PZVA 3D9BA 3GE9A 4MFBB 1F3FA 4LF1A 2F5GA 2RJZA 1W2BR 3IRWP 4KC5A 1MWYA 1R0CB 5BR8J 3MPUB 1ZTWA 5ETNA 2GVDB 3O2IA 2IAJB 1UJ6A 1GTHA 1TR0A 4A47A 2IHR1 1K0VA 4K4ZA 5JUMA 1I94J 3TZWA 3CVKA 2IMOA 2VA2A 3L7PA 1EKSA 4QYZJ 4FPRA 2VOOA 4F04B 1VQKS 2DHAA 4AUKA 1EP4A 4KBIA 3GV8B 3HT0A 4B3RF 1HARA 5IZHA 3BF4A 3OXFA 1N5YB 2BKPA 2F7VA 4BLGA 1BWEA 4YUDA 5G0RA 4X4QA 4NMLA 2AF6A 5K5MA 4P2FA 1YJVA 5D8HB 3J7YI 3OV7A 2UVUA 2JL9A 1X5SA 5AXLA 4R25A 2CG4A 1DJ0A 2G2OA 4F2SA 2JRSA 5T7LA 2VBXA 1M5SA 3G8QA 1GMWA 5H9EJ 1H6KX 5A8KA 1HQEB 2WRMA 1D9AA 2UUBF 4PPDA 1RGVA 1LWEA 3Q8VA 4H4MA 4EI2A 3UFCX 4RU9A 2HVZA 3IG1B 2L9WA 3UCGA 3OVAA 3BO2A 4EGLA 2BM1A 3B82A 3IMQJ 3M2RA 4DR7J 2XMJA 2YKPA 2WHOA 5IC6B 2YNIB 4M5MA 2WONA 2UV8G 5CYQA 1IR0A 2CG8A 1DLOA 2MQPA 2R8JA 2GS8A 1RK8A 1MU2B 1X9WA 3Q8QB 3NBPB 4WK1A 4KE5A 1IKVB 1SUQB 1FJGF 2NS1B 3S01A 1SH3A 2W7AA 4PG7A 4J9OA 3LP0B 3HF5A 2J0QD 4DMZA 2E1AA 2LVWA 3RBZA 4ID5A 3OVBA 2VL1A 4ED6A 2NXNA 1BQNB 1VS3A 1U6FA 2ZD1B 3KG1A 1NKEA 4I68A 3H40A 2NPIA 2J0SD 1V3RA 3G82A 4I2PB 4J37A 2E5IA 1JXLA 4NLQA 1VQPS 1OPIA 1AZSB 2DVIA 2EKYA 5EHHA 1H73A 4NI2A 2XC9A 3MCNA 1CQMA 2U1AA 4DV4J 4Y34A 3BPDA 2ZM6F 3DDKA 1F6TA 2B4PA 1JJHA 4DQRA 2ZH2A 3GB0A 4O23A 5DO2A 1SC1B 3ZTOA 1LKZA 3QMQA 3VGTA 1SJFA 2AX0A 2DNKA 4K2XA 4OIXA 1XNQF 4C97A 1CJVA 1CEZA 3BZQA 2LU2A 3DNCA 2XLJA 1IQZA 3M9MB 2SXLA 2V4QA 3QIDA 3OR2A 3NGKA 4QWCA 3KJQB 2GIFA 3M9NB 3M8RA 1E6VA 2ZNYA 1VQ5S 1RAOA 2CUYA 2Q6BA 2LA4A 2AMCB 1FX4A 2KXHA 3TRGA 4WFAQ 3ITHB 3L7OA 2HFNA 2HNZA 5F8GA 3EZUA 5KOWA 4OHXA 3QT5A 1X4EA 1S1TB 1TELA 4KQZA 3F41A 5KFYA 5HMZA 3WX4A 2YKNB 1S12A 4PXBA 1AUSL 2W2QP 1S7HA 3CT9A 3R1HA 3A3NB 4RUAA 2DRDA 2DITA 2DNPA 3VCDA 3PX6A 3AXKA 2QFIA 4OYMA 1LWCB 1Y00A 4N8NA 3WDOA 2UUAJ 1FD2A 1WF2A 1RAJA 4FF3A 1UVNA 1JNZB 2NZCA 4OX8A 4AYBD 2CJKA 1J27A 3IM9A 5GADU 3RUBL 1A0OB 3UNYA 3ENVA 2UXBF 3HSZA 4ZN1A 4DX8H 2X1GA 2FJVA 2OSQA 4F3QA 2DBBA 4MJKA 4DEZA 4HI1A 2FVQA 1H38A 2HS3A 5D78A 2NUHA 3TQEA 3CDEA 4LSNA 3CMAS 4LQ9A 4EZ9A 1N0UA 4Z2XA 3GPAA 2Y1LB 1PJ5A 1Y3JA 4TVAB 2ZNZA 3VQSA 3LAMA 4UQTA 1RT6B 2DNQA 3KWMA 3CJ5A 2LP4A 2OTJS 5KT3A 2GIQA 4HH1A 3U7JA 2O3DA 4LF7J 4ZVEA 2J9EA 4NMXA 3GYNA 4RBUA 3EVWA 2E5GA 1C1CB 1FJEB 2MLYA 4O4GB 4CP5A 3RG6A 4KPYA 1UVJA 3PR4A 4TU7A 5B08A 4WTYA 2Y8WA 4ZP9A 1CQNA 3UO0A 5CHCB 4I69A 3N01A 4A8OA 5GAGI 1AA1B 2VC1A 3R2DJ 3GILA 4RUCA 4F3MA 1N6QB 3O1LA 1ZA1B 2VIHA 4Q5VA 2WOMA 4H54A 2QFJA 3DC2A 2KVQE 1TK8A 1TUVA 3FBFA 3SBMA 3T5JA 1LWFB 4CLYA 2IY5B 4IFVA 4DN0A 1IBKF 2XO6A 1K73T 4HL9A 3EM1A 3H5SA 2HHHF 2BV3A 1T9TA 1P8GA 3W64A 2R7QA 1N36J 1Q81T 2IM2A 4DR1F 2HWIA 3TA0A 4MH8A 3W2VA 3NS5A 1UPPA 3MEEB 2AJ0A 2NXEA 5KG2A 4ICLB 1LFWA 3V4MA 3H7HB 1AFIA 2ZVIA 2KTQA 2JX2A 4GKJF 2CPIA 2VU5A 3UCUP 1JLGB 2BQUA 1AW0A 5SZTA 1XWLA 1XR5A 1GT8A 4QU7A 4QU6A 3HSDA 4NLXA 4DV0J 5K20B 4Y3CA 4NZ6A 1HL6A 5IC4B 2DNMA 3S1TA 4ED3A 3BGLA 1BD6A 3QQCD 1Y11A 2D3OR 1RWMB 3BH6B 4L72B 4A4JA 3OT9A 4OYBA 1RA6A 3TOQA 4ID8A 2MKIA 2ZKUA 4FS2A 1J5OB 2DXEA 2P9GA 2QEXS 4WP8A 2JFDA 2Z58B 1U6BA 3D0HE 1KBRA 3MECB 1VQLS 1C2PA 3FEXB 5B0EA 1PBAA 2VJUA 3C6UA 3DLEB 2G13A 4KJIA 2U2FA 4ZVRB 1T9VA 3T9ZA 4WIQA 4JI3J 3R6GB 4DL4A 4DSJA 2W8LA 3VAIA 1U0HA 1RT3A 2JNJA 3PYEA 3V81B 3DLKB 2Y1JA 2PDAA 4F4XA 3ET6B 2K7KA 4RPFA 3LWLA 3D3BJ 2YQ1A 2IFXA 5D0GA 1UEUA 4ZDNA 1NNDA 4E8UA 2GMHA 4H4KA 3CJ4A 2MHNA 2BANA 2ILYA 1KDNA 3DLJA 2I5JB 1FTCA 1RBAA 2CNKB 5KFHA 1MMLA 2OPQA 1OJ4A 2GJIA 2GAGC 3P3DA 1SKUB 4IOCQ 2IM3A 4YR2A 1YZ7A 1TU0B 3ELHA 2ZZMA 1KOOA 3I4PA 1S99A 4HT5A 5H9EK 2MMYA 1HQUA 4K4SA 4IDKB 1PYOB 1TKDA 1BY9A 1U2CA 1G1XA 3TA2A 2XMAA 1L3TA 4PUOA 2DGSA 3IWXA 5J2QB 2VKZG 3CCVS 1WHVA 2GQ2A 2FHKA 3QIPA 3L09A 3GJQB 1BHNA 5KFKA 4WF9Q 1GQEA 1QAXA 1K0TA 1IKYA 3MUVP 2QLFB 3HKZD 2CIMA 1PC5A 2EFGA 2LECA 1JXVA 5KFGA 4H4OA 3K7RA 5IOLA 2W9CB 2M8DB 4LF5J 1HHSA 2BR0A 3JAMU 2F8EX 3LALA 1WWHA 1QE1A 3IWNC 2CKWA 3GLJA 1N4LA 2WTFA 1C0TA 2DNOA 5E3RA 1SB6A 5IS2A 1NO8A 2ASLA 1Q8BA 4UY85 4IRKA 4ANDA 1Z1ZA 4C4WA 4RW7B 4KPCA 2QL5B 1RTJA 1DQ9A 2B8QA 1BMQB 3D5MA 4J9RA 4ZOSA 4ZLNA 4CO2A 3DRPB 5IQ6A 2W7OA 3TUIC 3S7RA 1UVMA 2Z2YB 3I56S 1RT4B 4ES2A 3CUNA 5ETPA 3MPDA 2HGMA 2MEWA 1R43A 4AQYJ 1WEXA 4DUYJ 2DIVA 4JYAF 1LWXA 2HMIB 3THPA 1SL0A 2UV8A 2IVMA 2ZH6A 3M6UA 3TAMB 1HLWA 2VQFJ 2HKEA 3NAHA 3CJTA 4NLGA 2R4FA 1NPRA 4MAKA 1RT5B 3BM7A 2A10A 1S9FA 3D6HB 4PCQA 1Z2ZA 5JXSA 3OFFA 3KLFA 4NCAA 1RYRA 3GIJA 2BE9B 2RHSB 3UVJA 2KB2A 2QSWA 4HYKA 2QLJB 2ZJPQ 3JSRA 2BQ3A 4O3OA 4DG1A 3HM9A 4J9SA 2WVDA 3FQLA 4L3KA 2OPSA 2B56A 2MY8A 2GHPA 1Y5NB 1T3OA 3KKFA 3MEGA 2KZZA 2HG4A 2F4VF 1UETA 3T1AA 1X4CA 1RAHB 4CLKA 2H48B 3TYTA 2ZWPA 1LNQA 3BKTA 4HDHA 2GC8A 2FUG9 3TX0A 1CJKB 2J7KA 2FGCA 2ZBQA 3BV8A 4QR1A 2D69A 3GFHA 4AXIA 3KYLA 3DDIA 1NSPA 3UDEA 3V4IA 3QJLA 5HANA 2PIIA 3ZC4A 3V6DB 3AY0A 3LTOA 1WORA 4CLZA 3DLHA 4I1TA 1WC3A 3NNCA 4JV5F 4NYPA 2J8SA 2EBGA 1UZHA 3UDCA 3MR3A 4GMKA 3G8SA 3KHRA 4X4SA 2FC9A 2J0XA 1JLAA 4ZA1A 3HSJA 2Z0GA 1SKSA 2G2ZA 3ISND 3D2WA 5ETLA 4FXVA 4QIVA 4FYDA 3WC0A 2KFNA 1IBLJ 3I31A 3OFHA 2RD5C 1NDLA 3W3SA 2PN6A 2NQPA 1TK0A 1M5OC 4R0EA 3CULA 2J9DE 4WFNQ 1YJUA 1IKXA 1N36F 2CDRB 4UOHA 2WAQD 1VYAA 1VR6A 1WC6A 5KFDA 3GIIA 2M4MA 5F8IA 1TMMA 4MFBA 1HNVB 5LXYA 4B9SA 4NLWA 1MSWD 1RACB 1Y7PA 3BN7A 5KFOA 4F4YA 1BQMB 1XC9A 2GVDA 3Q8PB 1RTIB 3PO5A 2IAJA 1ICEB 3GZ7A 4NCGB 2X51A 3K8VA 4DOZA 2PI5A 2YWFA 3PXGa 4CCHA 5M2UA 4CWBA 1FCAA 4P9SA 2ZH8A 4J7CA 1NZ8A 2P8IA 4ZIWA 2BYCA 6AT1B 4ILLA 4RNMA 4AT1B 1B0TA 4P73A 2E5HA 1N5YA 3C15B 3MM6A 4DI6A 4GVBB 2LXUA 3CMQA 1NKCA 3EYZA 3EPIA 5E41A 3PG9A 5HSPA 2L48A 2C28A 4UUXA 3ZZ0A 2FJEB 3QGHA 1CSJA 1RHMB 1RTDB 4DL0C 3RZAA 4OJ3A 3I4HX 2NZ4A 1RLCL 2HEKA 1S0NA 3OPKA 4ZJLA 8ATCB 3UE2A 3PHTA 4I2QB 3OJSA 1HQEA 4CRJA 4O3RA 2F8MA 1HNZJ 1B3TA 2CDQA 3DCAA 3KFWX 3IG1A 3Q8SB 5GMKa 2VBYA 1BE4A 3LP2B 1YJNS 2YNIA 2XYPB 1C4CA 2KH9A 3ENAA 3JSYA 4FYWB 2UU9F 3CW2C 1B0PA 3CF5Q 1U2FA 4U7UK 4ALZA 1MU2A 2XY6A 3NBPA 1DURA 1IKVA 1SUQA 5KG4A 4ECVA 1KNZA 3OXGA 2J76E 3TVKA 2CPYA 4RNNA 3J81Y 4OYZA 3LP0A 2KYZA 4RR5A 4KTQA 3VZHA 1RP5A 2ZEJA 3UN3A 2ZD1A 2RMLA 3U1MA 2VQEJ 3H25A 3SCLE 4PWUA 3SQOP 1QJHA 3AFGA 2HHXA 2HFSA 5HBMB 5LMNF 4I2PA 2JEIA 2HQDA 5HQLA 1AZSA 2QV6A 2QO3A 5DS7A 1PG5B 4H4KC 3VALA 3GSIA 4OLPA 4RBTA 3HVWA 1NB7A 2KG0A 3Q24A 4KV8A 1M5KC 4TYBA 3IM8A 1HHQA 2OPRB 2ASYA 1XMOJ 5A2QU 4C0HA 4F4KA 2BKOA 1RLDA 2FDNA 3CIZA 1YX2A 1HW8A 5FIIA 1N34F 1F9FA 3RRGA 3D6MB 3R5AA 2AGOA 2F9DA 3RR7A 4OX9F 2H5JB 3QGIA 4JI2F 3MMCB 1R3NA 1TP7A 5K14B 1UFLA 3PR5B 3PW7A 3BBCA 1FNXH 3O8WA 5IXUA 5KFEA 1LOUA 4ETXA 1LEOA 4C98A 3QGGA 4N56A 3EXCX 1TL5A 2BDPA 2C2MB 5L1IA 1ZAXA 4C8ZA 1JLEB 2QTWA 1Y5IB 1H7WA 3BEGB 3ITHA 1UPMB 3PJWA 4DZDA 5C2CA 4PR6A 1KOHA 1X8DA 3EGVA 4I6YA 4N7TA 4ZPBA 1S1TA 3M4XA 4OLOA 1FE0A 3HZEA 4JI6J 2YKNA 4J9QA 3OBIA 2HIYA 1NLKL 2KT5A 1S79A 5A8WB 4XPCA 4GRSA 3ZO7A 3BO3A 3D1HA 4M1KA 4O3QA 4OYOA 1KONA 2MKCA 4U9RA 1U45A 5KFRA 1FX2A 2EWHA 1AT1B 1LWCA 4F25A 2Z30B 4ZCIA 3EMTA 1C0UA 4HKQA 2UXCF 2MSTA 2F65A 1MMNA 1H0HB 2DRAA 2DGOA 4ZJOA 3ZZZA 1OSDA 4WFXA 4NLOA 2KO1A 2DGVA 2ZUAA 3KLHB 2ZH1A 3LP1B 3T1HF 4KAIA 2R2SA 4ZP8A 5KFVA 3FRZA 2FHOB 1NJIT 1S57A 2RF2B 2AWZA 2KM8B 3IBCB 2VG7B 1HMVB 5J1EB 1RHJB 4LF2A 4USKA 2HBYB 1HWIA 4LFAJ 1JKHB 4L76A 3KK2B 3CCTA 1VRTB 1ZTTA 3DXSX 1U1KA 2CWXA 4J9UE 5THWA 6FDRA 2WVCA 2P9EA 5KFLA 2FQQB 4TY8B 2WB4A 4RX6A 1RAFB 1RT6A 4M5JA 4Z37A 3C8YA 1Y5LB 3CO9A 3PTWA 2CQ1A 5T14A 1FVSA 3DLGA 3KUGA 5A76A 3J7Z5 1C1CA 4O4GA 4F7VA 3I96A 2WVEA 5A6WA 1RAIB 4RW6B 3BR8A 1N5VA 2Y1RI 5I42B 4PWDA 3M2UB 8RUCA 1T05A 3J7YU 2HFOA 3NY0A 2DYAA 4DFJA 1N6QA 3BR9A 1D1UA 4LRBA 4Q2LA 2P2CB 2YXLA 4ZVOB 1LWFA 3MDFA 1GXUA 4X84A 2W4PA 2XZWA 1G7CB 5LM7E 2R8HA 1RKJA 1YJRA 3NMAA 4I0WA 1V6HA 4X4TA 1VISA 1REVB 4ED0A 2YY3A 4F2RA 3GFYA 3MR2A 3MEEA 2CPFA 1VBYA 1DFDA 4CO3A 2VG6B 3CDAA 2WB1D 4PXCA 3Q89A 1JLGA 4GVLA 4DCOB 2CJBA 3UN2A 1UAWA 1VIXA 4B3SF 2DR7A 1WF0A 2NSBA 2MB0B 2RSQA 2DB1A 2IDEA 1Y9OA 1EIYB 5DM7Q 3HX9A 4URGA 1QSYA 1FWKA 5IWAJ 3R27A 1YITS 2IPOB 3JTOA 3VAKA 3L3CA 1YJ9S 5EGYA 2W2OP 1ZA2B 4LFCF 2DNRA 1OY6A 1SH0A 3QFHA 3W2WB 3VGSA 2JEFA 4G1QA 3TO8A 4CO4A 2AYMA 4UOFA 3MECA 4MIBA 1U4BA 2OI2A 1SV5B 1PKUA 2W7PA 1OY8A 1B4SA 3DLEA 4DR6F 2ROPA 2NXUA 4ILRA 4LSZB 2H5IB 2JDJA 5D4LA 2BRLA 1RUSA 4X4PA 2FJXA 1S7IA 1Q5YA 4DV1J 3ULHA 2BXJA 2UUWA 2DH8A 3V81A 2E7XA 3DLKA 2CVEA 4FYXB 1X4GA 3CPWR 3IXQA 2I6WA 3ET6A 4HACB 4U7UD 5LSOA 3OSNA 2XB2D 2HVDA 3R3TA 1ULRA 4Y6IA 2W1BA 5E0OA 2KRBA 3G87A 1OQ6A 1P9QC 2BKNA 4DX6A 2I5JA 5BXIA 1MMDA 1ITPA 3AHPA 4F0MA 3MR7A 1CVJA 3TEHB 2Y0BB 2HHPA 3CWJA 4CO1A 2IM0A 5DDQC 5AXMA 4TQRA 2FJBB 3PV8A 4FKYA 2VQEF 4IDKA 1EQMA 3SI8A 3QJPA 2X3GA 3UD4P 2VODA 2O1PA 2ZH7A 4CO0A 5J2QA 3DM2A 4YMEA 4ZPWR 3SZ2A 3PIPQ 4QW8A 4KRWA 3J81j 1NZAA 2OD4A 4E0DA 1MN7A 4ZP7A 4K2JA 2DGUA 4MT1A 2K7JA 2PEHA 1YIJS 5FLXU 1K1SA 2CJ9A 4FPIA 2RQMA 2W9CA 1WHXA 3W61A 2Q3PA 1RWKB 3OXLA 2KL8A 3EDQB 1SQGA 1HBNA 1JJCB 3PIOQ 3V5RA 3QBCA 4A48A 3UW1A 4RW7A 2CPZA 5B0CA 5F3TA 5J1PA 3KTQA 1V3ZA 2UUTA 1U8SA 5CABA 1TKZB 2C3MA 1K47A 3CNQP 3MM7B 5F8HA 4OI1A 4IQXA 1T3NA 2IDLA 3IS9B 3J80Y 4K4WA 2GVZB 3D66A 5DG9A 1RT4A 3ETOA 4DV2F 5GAGU 1HYSB 4FF2A 4NLSA 3MMBB 2HMIA 2KHCA 3MCSA 3I0SB 2Y9HA 3DRXA 3JQMA 3G8TA 3GQCA 4X64J 1S6QB 3H8YA 3UR3C 4DV3J 2DEIA 3TAMA 2XWXA 5D77A 3CCES 3J7AN 1SQFA 3PO4A 4KB7A 2RQ4A 2ATLA 4P71A 3NGDA 3TUZC 2IA6A 1X0FA 1F5CA 1RT5A 1ZM9A 5L8RC 2C3OA 4IKAA 1WSRA 1Y3KA 1PSDA 3RBDA 2O01C 1PILA 1F9EB 4ZN3A 1R0AB 1T11A 3M2VB 2GIRA 4DL5A 2J6SA 3W5YA 4K4XA 2AEMA 3CB4A 1ZBTA 2E1RA 2YNGB 4QZVB 1S72S 4JI7J 4ILMA 4YHHF 3EGNA 2ERRA 3WBZA 5L1KA 3IO1A 3AH6A 2ZJRQ 5KG0A 2OJ3A 3QT7A 1H72C 2HGNA 4JV0A 2UUCJ 4NLYA 3D6TB 1CJKA 2POKA 2CQDA 2DGQA 2FHJD 2Y0SD 1X4AA 5M2RA 2D1CA 4OQJA 4P74A 3OFGA 2D74B 3NCPA 3V6DA 1I1GA 2V8PA 4YB1P 2EK1A 3GR1A 1XERA 3OHAA 3CJ8A 2DH9A 2V8GA 4WKYA 2WBMA 2DNGA 2DEJA 3PCOB 3BSOA 3I82A 4R8UA 3ISNC 4M5DB 1S10A 3GIKA 4OYPA 1DTTA 1RHQB 5EUHA 3K58A 2IJNA 1RWOB 2CJAA 4EYHB 1SIZA 5HROB 1V9OA 4W98A 1PJ6A 1X9SA 1U49A 4WYWA 3W60A 1HR0J 4JI0F 2LQ5A 3C6TA 3C14B 3R8YA 2HHSA 1FRLA 3SSQA 4LUBA 4L73A 4LR8A 1ACMB 4YP3A 3HHLB 1CG2A 1HNVA 2Z4PA 1IBCB 2APOA 4KGZB 2KJWA 1KWMA 4LBHA 2C2NA 1BQMA 1HI8A 2XQCA 4JI4J 1T95A 3AB4B 1WKJA 1RTIA 3W8PA 1HNXJ 4NCGA 2KYXA 3MR5A 5IWAF 1DRZA 3TR5A 3POTB 1UJ5A 3P4UB 3CCJS 3RRKA 1N33F 2PEBA 1JNRB 1YHQS 1N32F 3KLGB 3C15A 2VFVA 2V94A 2EBEA 3OTBA 1D8YA 1KRPA 2MJNA 4PG6A 4ZVSB 2QLBB 3FEYB 1WOPA 1KR4A 4CLFA 3JAMY 2CADA 2IIHA 3ISZA 1RTDA 4FDFA 4IH7A 4B3TJ 1U26A 2W01A 5DZ6A 1K44A 3T5LA 3U1LA 3PX4A 4I2QA 1U1NA 3LUYA 2FVRA 4G1PA 4ZJQA 2HHUA 5EWEA 9ATCB 3W1YC 3GV7B 2BUNA 3QNWB 4AXJA 3AOCA 2OHDA 3G6ES 2E44A 1IVZA 3LP2A 3CCQS 5D0RA 1WKKA 3ZNJ1 3SEOA 1ZPVA 4OV6A 5KTQA 1FNMA 3I5BA 2QLXA 2V68A 3DGVA 5LJ3Y 1Q79A 3NL0A 4ED1A 4QPXA 2CVIA 3DMJB 4K4VA 2N7YA 2EFNA 1LQ9A 1HNIA 2PMHA 4BS2A 4C3LA 3T1YF 4U8VA 1PYSB 3TEGA 2BJ1A 4DF4A 4FBTA 4DQPA 2W9BB 4GC6A 4IOBA 2CZ9A 1HA1A 5HBMA 1REGX 4U8YA 2GO9A 4EMDA 4URSA 3MAAB 1HQ2A 2A2DA 2GHVC 3KUEA 1VQNS 5I3UB 2RNEA 2LEAA 4NXMF 1S77D 5ADZA 3PW4A 5E5NA 2XSJA 2R7OA 5C2GA 2CQ4A 3W65A 4OYIA 4LFBJ 4USHA 2OPRA 3LW5C 1IBMF 1TZ0A 5IT9U 3GV5B 1DTQB 3EUNA 3GR0A 4YY3J 4AFFA 1KKHA 3OTCA 1GNKA 2KRRA 1UMJA 4JP8A 1VIOA 1TL4A 3R2CJ 4PKDB 1R8AA 2AGPA 1EAYC 1NBEB 1RHRB 3FCWA 4R5PA 5LMUJ 2QT7A 3MMCA 1H3DA 1TUWA 2KFYA 4K5RA 5K14A 2Z2LA 1VQYA 1VOMA 3SCJE 1L3VA 1HBMB 2LU1A 5CA5A 2KU7A 1JLEA 3CJKB 3D1OA 3SV4A 1GMWD 4DS4A 2F8HA 3QZ7A 2V4RA 4ZVFA 2V2ZA 3FCVA 1WC5A 4DSIA 1WTBA 1NH8A 3PRBA 4USMA 1JLBA 2RS8A 1N5QA 1MN9A 4WYLA 3QLHA 3VR1A 4RWXA 2CPXA 4JI5J 2VC0A 4USWA 1Y4ZB 3SMZA 4X64F 1WG5A 4DR2J 1PAEX 3I5CA 4DV3F 4CLPA 5F8NA 2RQCA 3RBEA 3LGMA 3FEZA 1TKXB 2FLPA 2CAJA 3KLVA 4KGKA 2JVRA 3US5A 3AJ2A 2E5LJ 1FI4A 2V5HG 1L3KA 3RTVA 3KLHA 1U7LA 2DH7A 3FUYA 2V4JB 3CCZA 1UA0A 1MNEA 1XJWB 4OHYA 3R5GA 2RF2A 2F63A 4P7VA 4K0KF 4JI7F 2CQBA 3NP5A 1XMQF 2GJ2A 5KFCA 1HMVA 5J1EA 2HAIA 1RCXB 4Y2KA 2KT2A 5F8JA 1UEKA 4RKUC 4C7QA 4ITSA 3KK2A 2B7BB 1RWVB 1VRTA 1SH2A 3PFOA 1KQFB 4NOHA 4C8OA 4EU0A 2BW7A 1RAAB 2DY1A 3ENQA 4DCJB 4ZPAA 4TY8A 3MUMP 3U02A 4BCAA 3G96A 4C0BA 4WP3A 4OZ3A 1G4CA 1HWUA 3F0NA 5D4OA 5MAOA 3W66A 1KSPA 5C42B 4O3NA 3BYRA 1ZPWX 3E51A 4OZJA 3BKUA 4IRDA 1QUVA 2GHWA 3R5CA 4OI6A 5K9FA 3ZTRA 2DR9A 2DR5A 2FZCB 4ED4A 4ZCLA 3VWSA 2MZ1A 1XIQA 3CJ3A 4X65J 3TZYA 5I42A 1IR2A 4F26A 2GV1A 4KY3A 3HD1A 2AQ4A 3G71S 3BH7B 2F3JA 1O8BA 2N4DA 1XR6A 1SCJB 1T9WA 2OIHA 2X1BA 2V34A 5I3PA 2CYYA 4QR2A 2EXUA 1KLMB 4LRAA 4OZ0A 2R7SA 3LH2S 1FRJA 1B7YB 1FKOB 5KFUA 2FPHX 1UFWA 1TKTB 3AJDA 1PBUA 4Q43A 3IR6B 3UWTA 3UN5A 3IR7B 3LAKA 2ATCB 3ADAC 1CJTB 5CD4H 4C2MA 2M0GB 2NYHA 3PW0A 4ZPVR 2CNOB 2MGZB 2FD2A 2LEBA 3KK3B 2A6OA 5H9FJ 2R42A 2XI3A 4YB7A 2UVRA 2AYBA 4FN5A 1RYSA 3X1LB 5A8RB 1X4BA 2VG6A 2QLWA 1H2VZ 1HBOB 3KMSA 1JJ4A 3RJMB 2XZDB 4PXEA 3AODA 3MEKA 2X7IA 3CCRS 2CPDA 1UWAA 3THVA 2D9OA 3M8YA 2J0WA 3G86A 4OZNA 1UEVA 4ZLPA 3PM9A 1YI2S 1NUEA 3IR5B 4DV5J 2BM0A 2E9TA 2E1MC 3MEDB 2D3O1 2OMLA 1R6YA 2K1RB 1WSVA 2ROEA 3QAUA 4CDIA 2QL7B 4CNZA 4K8RA 1FWLA 3MWBA 2R8IA 3W2WA 2UVVA 1YKWA 3HHLD 1T03B 2MXYA 1U1OA 1FHTA 2OGUA 1OPZA 1PGZA 1SV5A 4JBCA 3KNAA 3VZIA 4V19J 1OQ3A 4B08A 2OEMA 1RADB 2BJ9A 2E7VA 3GYGA 4XDCA 4P2SA 3DRSB 5KFFA 4C9DA 2ZE2B 4DL7A 3PFEA 4B3TF 1HFEL 3F44A 4L6V3 3NGSA 2J7WA 5DDRC 3BGRB 4AE5A 5KG5A 3K5LA 2CPJA 1JLQB 1JB0C 3FVYA 2MY7A 4OFZA 2QX0A 1RT1A 3TANA 4IH5A 3SYZA 4CH7A 2RU9A 4HACA 4DR3J 2PGCA 1QAJA 3Q2TC 4WZMA 2V8HA 4QBUA 7FDRA 4OI0A 1ZETA 2YWEA 5F3ZA 3F56A 2MQLA 4KHMA 1Q53A 5L9XA 1IQTA 1ZM2A 3DRRB 2ZH9A 4J5OA 4C8KA 4OZ2A 1RU2A 1DZ5A 2CA9A 5CYMA 3TAPA 2XMUA 3MM5B 4DUZF 3CD5A 3HP6A 2BVZA 4CT9A 4QCLA 3DOKB 2HNDB 1M0SA 1F1BB 3EGWB 2O67A 3DYAB 4LSLA 3GG0A 1FA0A 1FRXA 1R31A 2DXFA 3H5YA 2CQ3A 3O3LA 2ALYB 4DR4F 5KFXA 1D8ZA 4Q2MA 1CS4B 5HJXA 1VQ8S 1I51B 4JI1J 4ETZA 5HMYA 1LFPA 2HNYB 4EUVA 2ASDA 1FRKA 3HK2A 3L95X 3Q8YA 4Q44A 3CC7S 1N8RT 1Q1KA 2DO0A 4Y65A 1XNRF 2QJ3A 4B9VA 4N5SA 2XS7A 2CPEA 1GK8A 3GJSB 1JJ2R 4QJVA 2XMKA 3ZZPA 2A18A 1WELA 2R7TA 1N0VC 3RW7A 1Y0HA 3P96A 3IBFB 2CQ2A 1BQXA 4OI3A 1FKPA 2EFOA 5E3CA 2WONB 5CYQB 1KC8T 3OL9A 1T9XA 1G6BA 4LVNP 2E5JA 4LF8F 5CD4A 2LKZA 2Q79A 4OI4A 3PKMA 3MM7A 4RO0A 4GC7A 5DG8A 1NHVA 2HFUA 3CCUS 5KT2A 4CLSA 4FVCA 2NYIA 4B9TA 4QWAA 2H9ZA 3CE8A 2FY8A 2OH2A 1HYSA 4FVMA 2YVSA 1P1TA 3MMBA 5J1NA 4XO0A 2ZBCA 1ZM4A 3DOMB 2I1RA 4JI8F 3G2XA 1S6QA 5HP1A 1R8BA 2YPZA 2CNLB 3OTOJ 1SIWB 1M1KT 3M8WA 4DU8A 3O44A 2VOPA 2KT3A 2A0FB 1VC5A 5AXNA 1M1GA 3AJ1A 2BBEA 3Q8RB 3M2VA 4IO1A 4X62F 3G6VA 3MFHA 4KR0B 3ZXWA 1RSCA 1PIEA 3M6VA 4PQAA 5EWFA 1HHTP 1UWBB 3JQKA 2JLGA 2YNGA 2LQBA 3N5FA 3R5DA 1J5EJ 4RNOA 3H5XA 4C3KA 2F1FA 1JK9B 4NRUA 4OV1A 4NA2A 2FLLA 2G1DA 3BYPA 3W7BA 3M8SA 4ZLLA 4O44B 2V50A 1U6ZA 2MKYA 3CC2S 3MAQA 3LGHA 5D4NA 1UCNA 2FY1A 2J9CA 3NS6A 1B7FA 5KT7A 4C6AA 3ZZUA 3I6PA 3ILIA 2B0GA 4UTGA 3IFEA 3NAIA 2MKHA 1P6TA 4CM2A 1OYDA 2WW4A 3OTEA 4X66J 1O51A 3E3XA 5ETTA 3Q8UA 2MQOA 4A8FA 5DGAA 2C22A 6FD1A 1GFWB 3DDNA 1RKIA 1RHUB 5AXKA 2QA4S 3BBFA 1UW9A 1XR7A 3ILJA 5E33A 2HHQA 1YVFA 2CZVC 1K9MT 2RUSA 2RS2A 4MKAA 1S0MA 2RDIA 2Z57B 5F0UA 3N6LA 4GKKJ 4M5DA 5KFNA 2LLZA 2ZBIA 4LF6F 3KMQA 4YB6A 2B9WA 4DL3A 3S8SA 4DR5J 4EWTA 2KKHA 3V6HA 3QFWA 3KNGA 2HLTA 2XM3A 4C8MA 1L5UA 1QY7A 2N3LA 2M3DA 5D0EA 5HROA 3AD9C 2PFDA 3DGPA 3IGVA 2M70A 2VUGA 4LVOP 3H98A 2ACYA 1FDBA 3C14A 5ETKA 1NXIA 1CPZA 4ZLJA 4B3MF 3HHLA 3WX8A 2HRTA 1IWGA 1P1LA 2GCFA 4EZ6A 4HHJA 3KG0A 3N79A 3PEJA 2AJ2A 3W9HA 3BQ1A 2NCKL 4ZCMA 5A6PA 4FKXA 3OD2A 1OSCA 4MKYA 1LW2B 4IO9Q 2OFGX 5AJ3J 4DV5F 4JV2A 3POTA 2HYIB 2AW0A 3KLEB 1S59A 2HBQB 1P27B 5D4PA 1O0PA 2F40A 4DV7F 4WPAA 3QRPA 2RH3A 2YBVA 1WDDA 3T19A 5H9FK 4U7CA 3KLGA 4LF9F 3U1NA 3M30B 3W5XA 5FLXY 4F0KA 5C7PA 4ZCKA 2QYGA 3RB3A 5M2PA 2RILA 1ZAWA 3UDVA 2AU0A 1S48A 3ZZTA 1IN0A 4DLEA 3NOGA 3KK1B 4C8NA 2WOMB 4U6PA 3BBBA 1KVKA 2ACMA 3VHQA 1FDDA 3MXHP 4DPTA 5CH7B 4FBUA 1AUDA 2R8GA 2K3IA 2A2CA 2QIFA 1KQKA 1XMBA 3VV2B 2YPYA 4WFZA 3CD0A 3GWCA 4P6QA 4AL7A 5BR8F 1HNWJ 1TL3B 3DI6A 3FK4A 3M8ZA 3T6BA 4CO5A 1H2UX 4LIWA 2MLZA 4RWWA 2YWGA 3HHNB 3C3LA 3K8WA 2JZ5A 4C11B 1I94F 3QPIA 2AD9A 3BQ2A 3GIRA 3FDSA 1GXLA 2ZBPA 4N77A 3AAWB 1EKRA 4CZCA 4IR9A 2HS0A 3ONQA 1UFKA 4PABA 3AT1B 5HQMA 1SVDA 4QPTA 2KG1A 2W8KA 3R5JB 4XDDA 4FXWA 2W9BA 2HGLA 1N54B 1TUGB 3T9NA 5JJBA 2ZWOA 1URRA 3LPEA 1NK0A 2V9KA 3A8JA 2ASJA 2DGTA 3VAJA 4BWMA 1F5BA 3MAAA 2QYCA 3I9ZA 4B3RJ 5I3UA 1RQ0A 4K5SA 2EC2A 1WUUA 3JSMB 2B51A 2LA6A 3DRYA 1LW0B 4NX9A 2L41A 3R6LB 4UF4A 2B5JB 3NGTA 1WEYA 5AE2A 1DTQA 3KHLA 1S6PA 4TKTA 3H42A 1SC6A 1Q4RA 2LQ9A 1FNOA 2XCPA 4A8SA 3BPSP 2UUBJ 3RAQA 4DQSA 4DR7F 1HWJA 1D3WA 4QWDA 3J7ZT 2FVPA 3I5AA 1SI9A 3F73A 2XYGB 4ZMMA 4O3PA 1E6YA 3GP9A 1VMBA 3A3OB 4K4TA 3MMJA 3GJTB 4M8LA 4GO5X 5E2QA 3RU0A 3HXMA 1HBMA 2V2VA 3PJXA 3FNNA 4MK9A 3CJKA 3IRXB 2OD6A 5KG1A 3BREA 4NEYA 2PMZD 4ZVQB 1FJGJ 3A3PB 1NDCA 4P75A 2LCWA 1JLCB 2R7VA 2IBOA 3E01A 2JWNA 3K59A 1MG7A 1U09A 1RBLA 4LRCA 2HZCA 3WZ0A 4DV4F 2R7UA 2JEGA 4LIRA 4DS5A 1AYEA 4TNOA 2R7RA 3CDBA 2DNLA 1XBWA 2BX6A 5LOQA 1FDAA 2I2YA 5HATA 4DBQA 2ZM6J 3NOCA 4LREA 4E2FB 4B9LA 1PO6A 3P6YC 2YWHA 2H4WB 5K8NA 1AROP 5ETOA 2IA0A 3O6QA 1S1UB 3M8PB 2V4JA 4G1IA 4K7QA 2V0NA 2KDOA 1XNQJ 3UNGC 3CD6S 4PWWA 2YX7A 2XLKA 4NLDA 4NLVA 3QJJA 5FDLB 2QMWA 1T9UA 2N3OA 1QE1B 3NWRA 2KZMA 3HFZB 1WEZA 4Q7AA 1JWWA 2B9EA 2LQJA 2MTLA 4G6VB 1FXDA 5IM0A 3LA0A 3C16B 1SKWA 1D0EA 2RDDA 5C42A 4Q8FA 2VA3A 4ZVGA 3FBEA 2DISA 2F4FA 5D3GB 1UVIA 1HIYA 1S76D 3NCQA 4PYAA 4DV6J 5L38A 3EZOA 2BEFA 1S9EB 1U02A 4FP9A 2C2OB 2M9KA 2UUAF 5ETMA 2AX1A 2NSCA 3B8HA 3E8OA 2JVOA 1Q86T 3J81U 1CJUA 2HVIA 2XLIA 1KLMA 3KJNB 1QDUB 2RHQB 1QAYA 5CCLA 1FKOA 3VQTA 3PW2A 1WG4A 1TKTA 3UD3P 2DTJA 5B0FA 1U0SA 1VK8A 2BZ2A 3EZ5A 1CJTA 1VRUB 2B4UA 1YJWS 4TY9A 2FHMA 4TQSA 2UXBJ 3EE3A 4DG1B 1OYEA 2MGZA 4F4AA 3OVSA 3KK3A 2NLWA 3CJQA 2YKMB 1VLYA 2B7CB 4DHVA 5A8RA 4KSEB 1HBOA 1TMJA 2I38A 3JYTB 3NLCA 4LF7F 4B02A 4ZVUB 4DPYA 2P9CA 3Q22A 2BJ3A 4J9PA 3V2UC 3KDOA 3ZZRA 1U25A 3OR1B 3MM9B 1IXKA 4Q0BB 2IRUA 4S0MA 1YBAA 2K1RA 4B17A 2EK6A 1RA7A 1YLXA 3M8QB 4E98A 1NSAA 3V6KA 3HDSA 3HHLC 5A0YB 2YNHB 1QVFR 2XI2A 3AA8A 4KIAA 2L08A 1VFJA 1RCOB 3JB9k 1F0XA 1RTHB 1XN9A 1NK4A 2M7SA 4EBEA 4ANCA 2BE2B 3DRSA 1OY9A 2ZE2A 4P2MA 3I32A 1FXLA 4NL5A 2CQGA 2WCXA 4WTOB 2MQNA 2VPXB 1OWXA 3VAHA 2KHDA 3OTDA 2HHHJ 1WTFA 4EBCA 2OUGA 1RT2B 3IGNA 4O3SA 2MKKA 1IKXB 5I3QA 2B6AB 2MZRA 4DR1J 4EBDA 2FJWA 3M1VB 2C1EB 2HWHA 4JUZA 4BHQA 3ZZYA 2BMBA 2WVFA 3EWGA 3QAEA 4DV0F 2E66A 3AA9A 1SJ3P 3DRRA 4GKJJ 4MKBA 3MD3A 3OJUA 4HLBA 3CIMA 2HHWA 4L75A 1ZM3A 4HH0A 1NK8A 3MM5A 1FK9B 1EZZB 1FEHA 3DLLQ 4Q45A 4FS1A 2EG2A 2JJ4D 3DOKA 2HNDA 1N48A 2P6SA 4USTA 2HQ3A 3DYAA 3MMAB 2J7UA 5IQQA 2DPIA 1IR1A 1IWAA 1BC6A 1WJ9A 2XHCA 3GSDA 2DR8A 3MM8B 3UCZP 2XZTB 4Y00A 3MM6B 1MROB 2C2EA 1XQIA 4AL6A 3MGJA 4PG8A 4G65A 4JI3F 1CS4A 2LQ8A 3W8GA 3QWUA 4J9KA 3HSGA 1B99A 4QYRA 2HNYA 2M88A 4QQBA 3H20A 4CM0A 4A8QA 2WSEC 4ANEA 4ZHRB 3TP2A 1QVGR 2HS4A 2XSFA 1Z4UA 1SXLA 5G4DA 4A46A 5F0WA 1SPBP 1X5OA 4ED2A 3BGOP 1CC7A 1NDKA 4NASA 2JC1A 3TNVA 2K8GA 3MF5A 4RW8B 1M90T 3JS9A 1D9FA 2CFXA 3N5BA 5AE3A 3B6BA 4MYTA 4OYXA 2KFZA 3FFIB 1BQNA 3OLBA 2OTLS 1UJ4A 5C25B 1QM9A 4UOGA 2HLUA 1ZZFA 1ROFA 5EN1A 1HWKA 2HPUA 3FSXA 2W2MP 4W92B 3CDUA 5B0BA 2A6MA 3H2LA 3DOMA 3IAM9 1WHWA 5F9LA 5HMXA 3JXOA 3RR8A 2FYXA 2RB7A 1M5PC 3W63A 4NA1A 2Q1LA 3EDRB 4OJHA 3PACA 4HTJA 4JOUA 2ZFHA 1GX6A 3H0PA 4PXDA 4KH1B 3HULA 4KV8B 3KJVB 4LF5F 1CLFA 2PA8D 2FVCA 4HHUA 3PZPA 1FRIA 1UWBA 3FSIA 1KS2A 2NXCA 1NPPA 3IC1A 3P8BB 1WACA 1NHKL 5HVGA 3Q83A 2AJFE 1TFWA 4O44A 2YH1A 1YRTA 3OFEA 2ABYA 4NWBA 2ZOMA 3OSPA 2RKIB 2FZKB 4MK8A 4Y0FA 1UKUA 1Q8KA 1T8EA 1R8CA 1SJ4P 3ENWA 4ECRA 1N5SA 2FC8A 1CC8A 4I6AA 2VJVA 3FMBA 1PC4A 2HVHA 2EI5A 4AQYF 4DUYF 1NRKA 1U47A 3OW2R 4ZVHA 2VDIA 3AQOA 2MPUA 4IFYB 2R2UA 4LRDA 4NYZA 2ZBRA 3MAHA 3BS9A 2ZVSA 1DBDA 2VQFF 4DV6F 4JYAJ 4N47A 2XULA 3FSYA 3QRRA 2YQ3A 3V6JA 4DDFA 1ELOA 4DLGA 3N0VA 1A9NB 4DPXA 1DAXA 3Q0AA 5IFMA 2VPWB 4Q8EA 5JVGQ 1C1BB 2C3PA 4USIA 3WHIA 1VLOA 1C0UB 4F36A 2EFPA 5ETSA 1YBUA 3IBWA 3LGNA 5KG6A 1K8AT 2AEFA 5GAHI 4J9NA 5KFWA 2CRLA 4JB8B 4TXSA 2XS2A 4NA3A 1Q78A 1LXNA 1F5AA 5MLCV 4L74A 2BJ7A 5IV4A 2F4VJ 2HVEA 3QRQA 3EJMA 2LEPA 1R0BG 4CT8A 1SJ1A 1YG0A 3A4TA 3ZTSA 5J2NB 4W4MA 4B9UA 2K06A 2ZC4A 4I67A 1S4FA 1U1RA 2COLA 4KO0B 2BACA 3QSIA 2LFVA 2CQCA 1WG1A 2JHEA 1LW2A 3NXZA 4WFYA 3MCMA 4DL6A 3LPYA 3KLEA 5B0DA 4OJGA 3DLGB 1KP6A 2VFSA 4DSLA 5B7WA 3I9V9 3SSRA 1FD8A 3MFIA 2MYFA 3MR6A 1VJQA 3NMRA 1U8WA 2IC3B 2AJQA 3M30A 4JV5J 2CWKA 3CDWA 3GCWP 1VBKA 4PWDB 1T05B 1Q95G 2AKWB 1IBLF 1TL7B 2G2YA 4XIUA 2CJYB 2OPPB 3HFVA 3J80U 2BJDA 1OO0B 3KK1A 2DNHA 2D3UA 3P5BP 1L3SA 2ALZA 4DXLA 2XMVA 3O5TB 2QMXA 4HEA9 4LBPA 3TAQA 4XTTA 1VHFA 2P6TA 1XTZA 5U47A 1X60A 3CJ2A 4ICLA 1JIHA 5RUBA 1KFSA 2BW2A 5ETVA 5KFBA 1FVQA 3L9ZA 3OL7A 2D41A 1T0TV 1TL3A 3RB0A 1N5TA 2J6TA 3B78A 2ZITA 1KFDA 2CZ4A 4C11A 2OKQA 3D7SB 2GNKA 2ZHBA 2QE5A 3HLUA 4LRFA 5D15A 2H3EB 4RW9B 5KFZA 1YZ6A 4IH6A 1EQ0A 4NXNJ 3BJYA 1WOSA 4K4YA 2GZOA 3PRVA 5LSRA 4CNYA 2DY9A 1J5OA 4ZPCA 3VGVA 4DUTA 3G9CA 4O0NA 2C2RA 4BDPA 3J7A1 3D1QA 3FBCA 2ADBA 1EETB 4PYDA 1IJEB 4Y2CA 2PC6A 3K89A 2FZGB 4PEOA 4UZCA 4K4UA 5KT4A 1YRUA 4ECZA 3JSMA 2HWTA 2MKSA 1LW0A 3R7NB 2B5JA 4G1QB 3MURP 5KT5A 1HNZF 3GU0A 3HVTB 5ETRA 5EX0A 3GIMA 2H54B 4LQ3A 2PE8A 5J2MB 2G0IA 1FESA 3BB5A 5KFTA 3LF0A 2EW9A 3UPFA 3DFEA 1TL1B 1RXOB 4ED7A 1HKAA 2L3MA 4DSEA 1YGYA 4QYZK 1CBKA 1VQMS 3QZ8A 4V1Ak 2QL9B 4EK2A 4WXWA 5EDWA 3TQ1A 3SFGA 2V67A 3PYFA 1VBZA 1QAIA 1TK5A 3M32B 3R1LA 2CNNB 2KXNB 4OZ1A 1R7IA 1XK8A 3BSNA 2R2TA 4HHHA 1LK7A 3BSCA 1NAQA 3LQVA 2RQKA 2BE7D 2E9ZA 1UZDA 5B0GA 2LDIA 3IRXA 1RHKB 2W2PP 2XWYA 3HJVA 4ERDA 2UU9J 1Y10A 1IJFB 1G3OA 3K5MA 1NB2A 4P2XA 3GTYX 3A8IA 2EEYA 3K0JA 1FFSB 3BDEA 1EB0A 1APSA 2B9XA 4F4ZA 3FKBA 1JLCA 3D0IE 3FCHA 3AXMA 3I55S 4ZPTR 1GEHA 1BGXT 3W5ZA 1VK3A 2J5AA 4NLRA 1RB0A 3TJAA 1VQOS 4RJVA 1KTQA 1K1QA 3OLAA 4HT7A 5LMNJ 3VAGA 3RRHA 5C24B 4AD6A 4P10A 2K3KA 4TN2A 2W4CA 1XMOF 1EHWA 1RAEB 4DZ6A 1NM2A 4UUWA 4FXDA 1W25A 3BSAA 3DM2B 3N6NA 3HFKA 3T6JA 1DQ8A 1S1WB 2IYIA 2EFVA 4M63A 5H1SV 3QT6A 5LL6d 3KHGA 5HI7A 4QWEA 3FRYA 9RUBA 1NJXA 4UW2A 2RRNA 1S1UA 3H4BA 4RZRA 1VQSA 3M8PA 2FVSA 4ZKAA 1S6OA 2HQIA 1N34J 3SQGB 1FFGB 4NZ0A 1CULB 1Q82T 3DU5A 2ZHOA 3FQKA 1OMSA 5FDLA 4OX9J 4LR7A 4JI2J 1T7PA 2IBKA 2C2DA 3NNHA 3HVRA 1HBUB 3ILLA 5LXRA 3DRPA 1TV6B 2HFZA 2DKOB 2QRRA 1HBNB 3ETMA 2V6AA 3H2VE 5LT5A 3M9OB 2Z56B 5L9NA 2YKOA 3UD5A 3C16A 2GO8A 4JI6F 2A3JA 1NDPA 1S97A 2Q6CA 1YSJA 1VQ7S 1JMTA 2VICA 4IYQA 1SC4B 3SIPB 2G9OA 3EGZA 5D3GA 2DO4A 3PEHA 4ELTA 4A8YA 1NK6A 5DLFA 1U1MA 3QGPA 2FJAB 1S9EA 2CQIA 3WC2A 2CJQA 5HMWA 3IN5A 3CCWA 2AP6A 3Q86A 1YJ7A 4LBIA 3QSYB 4NCBA 1MWQA 3HT3A 2R8KA 2AZ1A 4DL2A 3GFZA 3FC9A 2UXCJ 1KHVA 4HI2A 2ZDOA 1F2HA 2R3VA 1U1LA 3K2YA 2J8AA 1DQAA 2LXIA 2CJXB 2N4CA 4X4NA 3PRDA 1F9HA 2RRBA 2RT3A 3CTRA 2XNRA 1VRUA 2VPYB 1RABB 4M95A 3KJFB 3T1HJ 4LFAF 4IRCA 4WFBQ 3SCKE 4DPUA 2YKMA 1UA1A 1NEEA 5E7OB 4RUHA 4U67Q 2EKNA 4Y2MA 5CQGA 4I64A 4X2BA 3TW0A 3GYXB 2K2PA 4V19X 3K5PA 2NR0A 4KH0B 3MOJB 2AJ4A 3MCOA 3JYTA 1VC0A 3NEKA 2RRAA 1RWXB 2DHXA 4ECWA 1MWZA 3AD7C 3BGUA 3ZFVA 2DT9A 3HI9A 2D3ZA 2M52A 5HAOA 3JQJA 2VG5B 1X4FA 3OR1A 3CCLS 3MM9A 3ICLA 4Q0BA 1GMUA 3RAXA 4RUBA 3K57A 5DDOC 2HZVA 3M8QA 5CXTA 1S0VA 3W9JA 5KG7A 1FDNA 4DFPA 4TU9A 3TWZA 5GMDA 2MJUA 2YTCA 1TVRB 5A0YA 2YNHA 3JSBA 2YWWA 1BWVA 4EO6A 3RGIA 4YN3B 1Q7LB 3MD1A 1RI7A 5GAEI 5L1JA 1KN6A 2G0CA 4C8YA 3PHEA 1RTHA 3R97A 2Q43A 4TLRA 2BE2A 1KLNA 1NH7A 2YX4A 4R8UB 3OQ2A 4RW4B 2XYHB 4G3IA 2MZQA 5E3AA 1DARA 1HD1A 3OUYB 1Q8LA 2IMWP 4B3OB 1H7XA 1VGYA 1DTTB 5FD1A 4DQQA 1LV5A 5BJRA 2N82B 2I8EA 1RT2A 1H2TZ 4HR2A 3H5UA 4I56A 2ZZTA 3PVXA 3TUJC 2B6AA 2FB0A 4U95A 2VF3A 3M1VA 1QLNA 3KUHA 4YEAA 3I0RB 4WXOA 3C6TB 1V3SA 1FJ7A 2GGPB 2H5EA 4DN9A 3WIVA 1S5ZA 4DWIA 4M5NA 1Q8IA 3SXLA 4Y2AA 3X3UA 4IG3B 1NJZA 3FJ2A 2AGQA 4B3SJ 2DCUB 1X9MA 3BDPA 2BJ8A 4NXNF 2XGPA 1FK9A 4KHRA 2V2QA 4ELVA 1Q5VA 4GVBA 1X4DA 5BYQA 2AIRB 4A8XA 2R7WA 3MI7X 1I5OB 3MMAA 4WK3A 1N52B 1NJWA 1I3OB 4QWBA 4FZVA 4NLPA 1HI1A 3MM8A 5DLGA 4LFCJ 4IUFA 1KVJA 3W62A 2M2BA 2IJFA 1DHMA 1MROA 3A13A 2MQMA 3LANA 5IV3A 4I6WA 4C8LA 1W2IA 2PA3A 4J9LA 1T9YA 3B4MA 1QTNB 4MIAA 3CXCR 2M8HA 4OX6A 4X4VA 4DV1F 2VPZB 4ZHRA 4DR6J 2HBZB 1FXRA 5GMEA 4J9MA 1FTRA 1NKBA 1KHWA 4Y2IA 3QWPA 2XBPA 2LYVA 3Q23A 2JC0A 1FKAF 2WZ1A 1SJQA 5D0HA 2WK4A 4RNHA 5IT4A 3VGUA 1IUJA 2QGFB 5F41A 3M7VA 5DM6Q 2XEXA 1KQSR 2M5YA 3RYLA 4RW8A 3RB6A 2NXJA 2MQQA 5KFIA 2HZAA 1S4EA 3TZZA 5KFMA 2C2KB 1ZAVA 2Z2ZA 3DN9A 1VQ6S 3CJRA 4ZVTB 4WCEQ 3H90A 3FFIA 4MMOA 1UTAA 2RE1A 4WE1B 5C25A 3P5TL 1I6JA 1NK5A 2AJ1A 4ENOA 2QA4G 2H1YA 1V5IB 1HNIB 2G1HA 1IM4A 4MIWA 2G4BA 1RE1B 3R5BA 2PMWA 2HBRB 4ZP6A 2XY7A 3UQSA 1ZOTA 5DG7A 2XO7A 2E7WA 1Q16B 2QSFA 1WOOA 4OYWA 1HPZB 1X31C 1Q0NA 5DQIA 4DF8A 5B0AA 4NZ7A 3HHDA 4KFBB 4KKOB 1ZZNA 1RTZA 1FJCA 1M5VC 2XSJB 2B43A 4DSKA 2OO4A 3L4BC 4CLUA 3HKWA 3KJVA 3WIUA 5HVFA 2O66A 2DJWA 3TJ8A 3S6EA 2VFTA 4YDDB 2HHVA 4ECSA 1GMVA 2V63A 4KGXB 3SFUA 3G4SS 5KFQA 4J9VA 1RJJA 2Q66A 4FNIA 3D3CJ 4EFAC 4R5PB 2RKIA 2ZZNA 2VKRA 2PT0A 4K59A 4OYAA 2MZSA 5L1LA 4P52A 2UP1A 1GAOA 5KT6A 3QO9B 2I9SA 2OSRA 3TA1A 3U27A 4I7FB 2LXFA 4OZLA 2DNYA 1TAQA 3MTJA 4ZVPB 3M05A 5DQHA 1R89A 1FO1A 5A8WA 4IFYA 4QIWD 1JLBB 1FE4A 1X5TA 4DV2J 1VRQC 3QLHB 5KFPA 3ZNUA 2WSFC 1RT7B 2FJDB 2VZ9A 1X0PA 2YH0A 4NEZA 3DLBA 4O0IA 4X4RA 2R7XA 5HJYA 4USVA 5KAKA 1SL1A 4CLLA 2UVWA 1NK9A 1S1XB 2ZH4A 3HPOA 1C1BA 4CH0S 3BGFA 4XAKA 3NCRA 3LP1A 4CLTA 1PJ7A 2R2RA 2E1PA 1TTHB 4ED8A 3HVAA 1S1VB 5DZ7A 4WU3A 2ZOGA 2VG7A 3B54A 4WU2A 1RWWB 1IM6A 3TI0A 1WC1A 4CQ1A 4IG0B 1JKHA 1WF1A 3EVOA 3KLIB 2XGQA 1KQGB 2OP5A 1F60B 3TUPA 2OFHX 3GJRB 1R8PA 3DOLB 1PCAA 4YHHJ 1OIAA 4NE9C 4UT4A 1P9YA 1VBXA 2UUCF 4PQUB 4DCPB 4ES3A 5J2NA 3D0GE 2JLEA 4C3MA 4KO0A 2ROGA 2AYGA 3NG8A 3Q2SC 4MK7A 4TU8A 1IKWB 4BBYA 4RW6A 3ZTQA 2WW8A 4J90A 2LDYA 2WSCC 3TZXA 3M2UA 4NLTA 1QSLA 4X4UA 1TAUA 1O5JA 3NKYA 4AL5A 4P7TA 2QN6B 3C66A 2IC3A 2VH7A 3RW6A 3D6FB 3D67A 4F50A 4D3GA 1GX5A 4CYUB 1HI0P 2EPIA 3HO1A 2NREA 3DHXA 4IR1A 1X7VA 4CTAB 1HW9A 1NJYA 1TL7A 3AOBA 2ZH5A 2OPPA 2OMOA 4UOCA 3A8KA 2ZC3A 3UI3A 1REVA 2XG8A 2H65B 1NSQA 4GO7X 4BC9A 2ZJQQ 3JTNA 4HDGA 2JFKA 1HR0F 4B9NA 2QG9B 1SC3B 2BRKA 4WZQA 4ECUA 2KJVA 1B64A 4DSFA 2H51B 2HK2A 5HL7Q 4YQWA 2YNFB 4JI0J 4XK8C 2QZ8A 1S9GB 4JI4F 1FRMA 2FLNA 1JLFB 1HNXF 2HRUA 2RVJA 5HLFB 4MTPA 4HTIA 4WIIA 1NPKA 1WI6A 1MW7A 3AD8C 3SCIE 4OI2A 4RW9A 2X3DA 1G2EA 1N88A 2CQ0A 1W7WA 2HW3A 5A2QY 1SKRA 4YDXA 4XPEA 4DPWA 1WC4A 3ILOA 2L9NA 2AEJA 1N33J 1EETA 2V9WA 2VFUA 2Z2MA 3ZZOA 1N32J 4F4WA 3SDEB 3ZTPA 3R7SB 5CCMA 1R8HA 2KI2A 1H98A 2AZ3A 1X5PA 2QA2A 2VD3A 2O5DA 3HVTA 4B9MA 1YRXA 1U1QA 2GFFA 2EC0A 5DJBA 4KHPJ 4OJ1A 2HURA 1S6UA 5J2MA 4KGVB 2GW8A 1V5VA 5GADI 2ZDPA 2Y8YA 3D4JA 3THTA 4EEYA 1EX8A 1TL1A 3NS7B 4M5IA 5J2PB 3PKYA 2MSSA 1VCTA 1TFYA 3AB2B 3GFXA 3A12A 4ECXA 1RT1B 2IVYA 1U1PA 4EYIB 1QUPA 1B0VA 3HZGA 3M32A 3R7BB 1YBTA 2E29A 2MDAA 2DGXA 1D09B 2OLWA 1F3VA 1WKLA 3P49B 4ELUA 4ES1A 3PYDA 1NU4A 2NPFA 4RL1A 4PG5A 4FF1A 5CYMB 2AT1B 3T1YJ 1FWPA 1EP4B 2GX8A 1T02A 1XEZA 1JQGA 2DXDA 4ZS6A 4X4OA 1LK5A 5G0RB 5C24A 4LFBF 4D3HA 3I87A 4LSLB 2ZKTA 1SBRA 1YTYA 3CJ0A 4NXMJ 5SUHA 4YY3F 1S1WA 5E3QA 5GAHU 3DU6A 2DIUA 3N9UC 5DGBA 4F02A 1NMEB 5T7LB 4A8KA 3MPVA 3CSKA 5A8KB 1IBMJ 5GVQA 1HD0A 4YR3A 1URNA 3WQPA 1LWEB 4QR0A 4H4MB 4CLWA 5FJ4A 5LMUF 5HK4A 3SQGA 3N28A 5EWGA 1CULA 4DX7A 3MHYA 4CI0B 3KOAA 2D9PA 3M2RB 3VF0B 2IM1A 4NPOA 2VBWA 4PPZA 1FEEA 5C5JA 1HBUA 1DLOB 5ITHA 1TV6A 1TKZA 4NLUA 2HQCA 1N56A 3T3FA 1AFJA 4FNHA 3IS9A 2UZAA 1FKPB 1MLAA 2GVZA 2BOPA 1A6LA 1R6VA 4N76A 4NRTA 4ZITA 1YQHA 4JI5F 1JXEA 4ID5B 3I0SA 3T41A 1AB8A 1Q7YT 3G6XA 3JTPA 2B8PA 1GXTA 3BO4A 4DR2F 4Y28C 5KG3A 2OELA 4M94A 3G82B 4F0HA 2C3UA 4TLQA 1D9DA 1U48A 2I0XA 2BABA 1GTEA
chains in the Genus database with same CATH topology
1YRTA 5IS2A 3OFEA 1NO8A 2ABYA 4NWBA 2ZOMA 2RQCA 3OSPA 5F8NA 2RKIB 1R0AA 3RBEA 2ASLA 1Q8BA 3LGMA 4UY85 4MK8A 4IRKA 5HP1B 4Y0FA 1Z1ZA 4C4WA 3D28A 3FEZA 4RW7B 1TKXB 2E5LF 2FLPA 1UKUA 1RTJA 1DQ9A 3KLVA 4KGKA 3D5MA 1T8EA 2VASA 5B09A 1R8CA 2JVRA 4J9RA 4ZOSA 3US5A 2V2KA 4CO2A 1UW4A 3AJ2A 1SJ4P 3DRPB 3ENWA 4ECRA 1N5SA 5IQ6A 2W7OA 2FC8A 1CC8A 2V5HG 3TUIC 1L3KA 4JV1A 4I6AA 1WHYA 2YX1A 1UVLA 3S7RA 3FMBA 1UVMA 1PC4A 5KFAA 2BJEA 4OL8A 3I56S 3KLHA 3RTVA 2HVHA 2EI5A 2W9AA 4AQYF 4DUYF 1NRKA 1U47A 1U7LA 1S0OA 3OW2R 4ZVHA 2DH7A 3AQOA 2GQQA 1RT4B 4BWJA 2MPUA 4ES2A 3FGVA 4IFYB 2V4JB 2R2UA 3CCZA 3CUNA 2FTRA 3M6XA 1UA0A 1MNEA 2HGMA 4NYOA 4A8MP 2BQRA 4OHYA 1R43A 2RF2A 1WEXA 4P7VA 4NYZA 2DIVA 4JYAF 4K0KF 2HMIB 2RIJA 3THPA 3MAHA 4JI7F 2CQBA 3NP5A 3BS9A 2ZVSA 1XMQF 2GJ2A 2IYGA 4RU2A 1DBDA 2VQFF 5KFCA 4RBVA 4DV6F 3NWGA 1HMVA 2V8VA 4YFUA 1SL0A 1VQ9S 5J1EA 2UV8A 2HAIA 1WI8A 4Y2KA 2KT2A 3OR2B 2IVMA 5K8MA 2ZH6A 5F8JA 4N47A 2XULA 3FSYA 3M6UA 4RKUC 3CCSS 2PI4A 2YQ3A 3TAMB 4C7QA 3V6JA 4N41A 4DDFA 4ITSA 1ELOA 3KK2A 4DLGA 4W90B 2B7BB 5LSLA 1VRTA 1SH2A 3N0VA 3NAHA 1A9NB 3PFOA 2FLOA 4NLGA 2R4FA 4NOHA 1DAXA 1KQFB 4EU0A 3Q0AA 1E6VB 2XMMA 4C8OA 5IFMA 3ENQA 4MAKA 2VPWB 1RT5B 4ZPAA 3BM7A 2A10A 5AE1A 1S9FA 4Q8EA 4PCQA 4TY8A 1Z2ZA 5JVGQ 1C1BB 2C3PA 2XNQA 3MUMP 5JXSA 3OFFA 4USIA 3KLFA 5I4MA 4NCAA 3U02A 2CPHA 4BCAA 3G96A 4C0BA 1RYRA 3GIJA 1C0UB 2KB2A 1C4AA 2QSWA 2ADCA 4HYKA 3C2PA 1HWLA 1HWUA 5D4OA 2EFPA 2C42A 2HNZB 3A8EA 5MAOA 2ZJPQ 3JSRA 1KSPA 3E2EA 2KM8C 1VC6A 3IBWA 3LGNA 5KG6A 3B4DA 5C42B 4O3NA 2BQ3A 4O3OA 4DJBA 1ZPWX 4DG1A 1K8AT 3PW5A 4HVZA 3E51A 5CZVA 3HM9A 4J9SA 4OZJA 4OZ5A 2F9JA 3FQLA 5GAHI 4IRDA 1QUVA 2VG5A 2GHWA 3R5CA 4OI6A 2OPSA 4X65F 3IAS9 2VONA 4J9NA 2B56A 5K9FA 2MY8A 2GHPA 5KFWA 2CRLA 1Y5NB 1T3OA 3KKFA 3MEGA 2DR5A 2DR9A 2HG4A 1J2VA 2KZZA 4TXSA 2F4VF 3A1YG 2XS2A 4NA3A 1UETA 4ZCLA 1Q78A 1LXNA 3T1AA 3GG1A 3VWSA 2MZ1A 1X4CA 4ZPDA 1F5AA 5MLCV 3CJ3A 5I42A 3HMJG 4F26A 2GV1A 5HQ8A 3TYTA 2FGOA 3K5OA 1TVRA 2AQ4A 3G71S 2LEPA 3HJFA 2F3JA 1O8BA 2N4DA 4CT8A 4HDHA 4DFMA 1SJ1A 2GC8A 2FUG9 1XR6A 1YG0A 5J2NB 4B9UA 2OIHA 2X1BA 5I3PA 2CYYA 4O44A 4QR2A 2EFQA 2ZC4A 3GMGA 1KLMB 2J7KA 2FGCA 4I67A 1S4FA 1U1RA 2COLA 4QR1A 3GFHA 4AXIA 3KYLA 2KXFA 4OZ0A 4RW4A 2R7SA 3CGIA 3LH2S 1FRJA 2BACA 1FKOB 4KO0B 5KFUA 2FPHX 1UFWA 2CQCA 1WG1A 4KT0C 1TKTB 5K8PA 2JHEA 1LW2A 4Q43A 3OUYA 3EX7B 5DETA 3IR6B 3UWTA 4B3OA 3V4IA 3QJLA 3IR7B 1U2RA 3LAKA 4WFYA 2PIIA 3ZC4A 4OHVA 3V6DB 4DL6A 3LPYA 3KLEA 5B0DA 4OJGA 3AY0A 5CD4H 4C2MA 2RU3A 3DLGB 3MOZA 3DLHA 2M0GB 4I1TA 2VFSA 3PW0A 4DSLA 5B7WA 3I9V9 3SSRA 1FD8A 3NNCA 4JV5F 4ZPVR 3MFIA 4NYPA 2MYFA 3MR6A 2MGZB 2FD2A 2EBGA 2LEBA 2P5VA 3KK3B 5H9FJ 5F8MA 3NMRA 2IC3B 2XHWA 2XI3A 5T41A 4UQGA 3UDCA 4YB7A 2UVRA 3MR3A 2AYBA 3I0RA 4LJMA 4FN5A 1RYSA 3X1LB 4LSNB 3M30A 2AJQA 4GMKA 5A8RB 3N6MA 3G8SA 1X4BA 3KHRA 2VG6A 2FC9A 4X4SA 2QLWA 1QTMA 2J0XA 3CDWA 1H2VZ 1HBOB 3KMSA 2GGPA 1JJ4A 1JLAA 4PXEA 4PWDB 3MEKA 4ZA1A 3CCRS 1T05B 2CPDA 4TYAA 1IBLF 2Z0GA 2ZOFA 1SKSA 3THVA 2D9OA 4XIUA 2OPPB 3ISND 3LOUA 3D2WA 2J0WA 2VFRA 1UP1A 1OO0B 2BJDA 3G86A 4FXVA 3KK1A 4OZNA 2DNHA 1UEVA 4ZLPA 4QIVA 4FYDA 3PM9A 3WC0A 2D3UA 2KFNA 2DK2A 3I31A 4IG3A 2AYEA 1YWXA 1YI2S 3OFHA 1L3SA 2ALZA 2RD5C 3KHHA 3W3SA 2XMVA 2PN6A 3VAMA 2NQPA 3O5TB 3IR5B 1TK0A 1M5OC 2BM0A 2QMXA 4R0EA 4HEA9 3CULA 2J9DE 4WFNQ 1YJUA 1IKXA 1N36F 3EPGA 4RLEA 2E9TA 3TAQA 1VHFA 2P6TA 1XTZA 5U47A 2E1MC 2IRXA 2E9RX 5CZXA 2WAQD 3MEDB 3CJ2A 3NNAA 2OMLA 1R6YA 4ICLA 1JIHA 2K1RB 4OMFG 2ROEA 1KFSA 3QYYA 2BW2A 3QAUA 4CNZA 5KFDA 5KFBA 3GIIA 1FVQA 2M4MA 3CEDA 3OL7A 5F8IA 2D41A 3MWBA 2R8IA 3W2WA 1TL3A 4MFBA 2UVVA 1HNVB 5LXYA 3RB0A 3HHLD 1N5TA 1T03B 4B9SA 4NLWA 2J6TA 1MSWD 3B78A 2MXYA 1U1OA 1FHTA 2ZITA 1Y7PA 3BN7A 5KFOA 1OPZA 1KFDA 4F4YA 2IRYA 1PGZA 1SV5A 4JBCA 1BQMB 2CZ4A 3KNAA 3VZIA 1XC9A 4YB5A 4V19J 1OQ3A 2HRYA 4B08A 4C11A 3Q8PB 4IFVB 1RTIB 2OKQA 3FMWA 3PO5A 2IAJA 2A1BA 2GNKA 5BYRA 2ZHBA 2QE5A 2W25A 4XDCA 4P2SA 3DRSB 3GZ7A 5KFFA 4C9DA 4NCGB 2X51A 3MPYA 1RDRA 3HLUA 2ZE2B 3DXBA 3K8VA 4DL7A 3PFEA 4B3TF 1HFEL 3F44A 3N4WA 4DOZA 2PI5A 4L6V3 2WBRA 4RW9B 5KFZA 2J7WA 2YWFA 4IH6A 3PXGa 5DDRC 3BGRB 3BJYA 4AE5A 5KG5A 3K5LA 4K4YA 3LO3A 3VTIA 4ECYA 4KHPF 5LSRA 4CNYA 2CPJA 1JLQB 1JB0C 4CCHA 5M2UA 3NRBA 3FVYA 2AV5A 1FCAA 4ZPCA 2ZH3A 2MY7A 4OFZA 1J5OA 2ZH8A 1RT1A 4DR3F 3FZBA 2DRBA 4F3OA 3G9CA 3TANA 4IH5A 3W2VB 3SYZA 4CH7A 2RU9A 1S49A 2BA9A 2BYCA 2JLFA 2C2RA 4BDPA 3J7A1 2DNNA 3D1QA 4RNMA 4ILLA 2ADBA 1B0TA 1EETB 1IJEB 2E5HA 2PGCA 1N5YA 4OX7A 1QAJA 4Y2CA 1VQ4S 3MM6A 2LXUA 3MPWA 3Q2TC 4WZMA 1NKCA 2PC6A 2V8HA 3EYZA 3EPIA 5E41A 2OAUA 4QBUA 4K4UA 5KT4A 1YRUA 2PFFB 7FDRA 4OI0A 2L48A 2C28A 1ZETA 2YWEA 5F3ZA 2RDJA 4UUXA 4ECZA 3JSMA 3F56A 3ZZ0A