2KRKA

Solution nmr structure of 26s protease regulatory subunit 8 from h.sapiens, northeast structural genomics consortium target target hr3102a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
b'MGHHHHHHSHPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 26S protease regulatory subunit 8
publication title Solution NMR Structure of 26S protease regulatory subunit 8 from H.sapiens, Northeast Structural Genomics Consortium Target HR3102A
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2krkA01
4Z8XA 2QBYB 3PFIA 4D80A 5FTKA 2DVWB 3VFDA 1IN5A 2XSZA 1E32A 1IN7A 1NJFA 4FWHA 3CF0A 1FNNA 1J7KA 2CE7A 3DZDA 3MHVC 3GLGB 1QVRA 1C1KA 3HWSA 3PVSA 4LJ7A 5FTJA 2CEAA 1JR3A 5DYIA 2C98A 2R62A 4LCBA 2ZAMA 1E94E 1IN8A 4L15A 4JN6A 3GLHA 4LJ5A 4I4LA 3GLIA 2X8AA 3U5ZB 3R8FA 2DZOB 2CHQA 1HQYE 3HU3A 4QHTA 3GLIB 2QBYA 1IXRC 2V1UA 4FCVA 2DZNB 5EP4A 1S3SA 1SXJB 1IXZA 4ZPXA 5EP2A 4FCWA 2BJWA 4KO8A 4LJ4A 4QNMA 3GLGA 2QENA 3SC3A 2C9CA 1HQCA 3VLFB 1IM2A 2XSZD 3EIHA 1OFIA 3BOSA 1W5SA 2DWZB 3KDSE 4QNRA 3HU1A 1LV7A 2QPAA 1IY0A 3AJIB 2CHVA 1JR3D 4FWGA 4I81A 3KW6A 5EXPA 3B9PA 2ZANA 1IN4A 1IQPA 5EQTA 4KLNA 4FW9A 4FWDA 1W5TA 4GITA 3WHKA 1IXSB 1D2NA 1SXJA 1XXHB 1IN6A 2Z4RA 1NY5A 4QHSA 2R65A 2HCBA 2BJVA 5EXXA 3UK6A 3D8BA 5FTNA 1G41A 3ZH9B 2KRKA 2QP9X 3M6AA 3H4MA 1G3IA 1JQJC 1X37A 4FCTA 3SYKA 1DO0A 3U61B 5EXSA 3PXGA 2ZAOA 1KSFX 3GLFB 4LY6A 2C9OA 3WHLA 1HT1E 5FTMA 1NSFA 5FTLA 5JI2E 5DYGA 3K1JA 1SXJE 4FD2A 4LZZA 4D82A 1XXHA 1KYIA 4L4UA 4KODA 4A3VB 1HT2E 3EIEA 2VIIA 1SXJC 3M0EA 5EXTA 4L16A 2RKOA 1NY6A 2DHRA 1SXJD 2Z4SA 4D81A 1DO2A 1NVMA 1NJGA 4LJ8A 5C1BA 1XWIA 1R6BX 1QZMA 5C18A 1IY2A 3HU2A 4LJ6A 1R7RA 2FNAA 4LGMA 4LRSA 5EP1A 5JI3E 1IY1A 4LJAA 3GLFA 1G4AE 4LJ9A 1OFHA 3CF2A 4QOSA 3SYLA 2C96A 2QZ4A 1L8QA 3GLHB 5EP3A 4EIWA 1OJLA 2V6ZM 4WW0A 2CHGA 2C99A 4LRTA 3U60B 1UM8A
chains in the Genus database with same CATH superfamily
4Z8XA 5ITRA 1Q3CA 1NV9A 2XSZA 1IN7A 2LHCA 5KPZA 3FRHA 1TGUA 2EKFA 1NJFA 3D8LA 4AG5A 7CATA 2QSFX 1FNNA 2BNKA 1QAMA 2CE7A 3J7BA 3MHVC 3GRYA 1J09A 1QVRA 3SMSA 3C58A 4OX9M 1A5TA 3FRIA 2CEAA 1OIPA 2RGOA 3E46A 4DV6M 3SAVA 2I7PA 2XZFA 1OIZA 2R62A 4LCBA 2ZAMA 2DWLA 4IIWA 3GRVA 4IBEA 3VK8A 3SBJA 4BLCA 4DV4M 2X8AA 3U60A 3R8FA 3ZQJA 3NBIA 3QYEA 1HQYE 3HU3A 4QHTA 3GLIB 2OOAA 2DKLA 4DUZM 1QQWA 1L1ZA 3AL0C 2F5NA 2DZNB 3VDPA 5EP4A 1S3SA 3GRRA 2J7OA 2ZTDA 4ZPXA 2UUCM 2CV1A 4FCWA 3K9OA 1PJTA 4LJ4A 2KZSA 4M9SA 3TWMA 2UUAM 2Z7JA 2C9CA 1N78A 2QHOB 2XGNA 2KA6B 1JR3E 2D7HA 2JWSA 1OFIA 2VF7A 2L7IA 4NXMM 3I4YA 2MJ5B 2DWZB 2D7GA 3GLFE 2DXIA 1LV7A 1YE9A 2QPAA 3AJIB 1V92A 2J7NA 5LMUM 3U6EA 1QYRA 1J5EM 4I81A 4AZFA 2M60A 3TQSA 1IN4A 4K0KM 1IQPA 2O01F 5EQTA 2XLJA 4CIZA 4JI8M 3JR5A 3TWKA 4S12A 5H37D 4JI3M 4TUWA 2Z4RA 3W0LB 5E6JA 1PRBA 4G4NA 3MK6A 3VKHA 2ZTCA 1E9RA 4PDIA 1D0MA 3FD9A 5E26A 1OKSA 3W0FA 1G41A 1NHGC 4XK8F 4DV2M 4NRVA 1K82A 4LG2A 3W67A 2JY7A 1JQJC 2LVOC 1N33M 2KNAA 4FCTA 4M9ZA 1PJJA 4OW0A 4M0WA 2AHMA 2Z8YM 5EXSA 1MU5A 4GHAA 2EKKA 3FE3A 3GLFB 4LY6A 2CUZA 5DFLA 2L6OA 3Q8GA 1G71A 4LF5M 4IJEA 2XH9A 3K92A 4KHPM 4R71A 1SXJE 3GPUA 1K3WA 1VEKA 1GL6A 3RFWA 3M0EA 2L4EA 3U6PA 2RKOA 1C7YA 2Z4SA 4PD2A 2X49A 1NJGA 3GPYA 1Z5AA 3AOGA 1HNZM 1BVSA 2JXNA 3FUVA 5L8RF 2FNAA 2DNAA 4LGMA 5EP1A 3DOAA 1IY1A 3GLFA 3KOWE 2F5QA 3KOYE 5KQDA 3E9SA 4LJ9A 5KPRA 3VK7A 3DA1A 2OO9A 1VEGA 1DGGA 1GLNA 2QZ4A 1ZMVA 2R4JA 3FKEA 3GLHB 1OJLA 2V6ZM 4NOOB 4WW0A 2HHHM 4II7A 2CHGA 3MMPA 1EIJA 3KXEC 3FTFA 3RGSA 4IBCA 4G4QA 1IFYA 3PFIA 2VQEM 3FUTA 3B89A 4D80A 3J27B 4MGZE 2VDBB 4NL4H 3VFDA 4GMQA 2Z3XA 1Z6TA 5LMNM 2KRUA 1OAIA 2R6FA 2RGHA 4LJ7A 1C1KA 3HWSA 3RE8A 3I4VA 1R2YA 1XNRM 1GVNA 2LNHC 3LW5F 4RKUF 2C98A 3AKZA 4B3SM 2MH8A 3GQ4A 3TE6A 2LXEA 3GLHA 4LJ5A 3TWLA 1TDZA 1Z59A 4GC9A 4I4LA 4JI1M 4DR7M 3A42A 2DZOB 3KVWA 3V76A 3U6CA 2KNVA 1N36M 1QUTA 1QZEA 4MGHA 2MGWA 4F2LA 4DR1M 2EA0A 4FCVA 2R45A 3FYDA 1IXZA 3KS8A 4NC6A 2WSEF 4HL4A 4KO8A 1D0KA 2BJWA 3T38A 3K9PA 3SC3A 1T43A 3UJNA 3L25A 4NSOB 3VKGA 1JB0F 2XSZD 1PGYA 2EO2A 1HJPA 1L1TA 4NXNM 3AV0A 2KNZA 1D0LA 1OTRA 1QUSA 4DV3M 2JY6B 1YSYA 3SHGB 3B74A 4GRIA 2DAKA 2C5RA 4DR4M 1V33A 5FLXS 2WZJA 4YHHM 4KLNA 1CUKA 3L2AA 4FW9A 5KPTA 1DV0A 4JI7M 3FTCA 3K8ZA 4I8OA 4B08A 2XF3A 3B7NA 3I01M 3QYBA 5FSWA 2JY8A 4QHSA 4PT5A 3NBXX 2F5SA 1SG9A 1NY5A 2XZUA 2KW0A 2BJVA 3GLGE 1DGHB 1GABA 1WXQA 2Q2EB 5EXXA 2ZBKB 3KFUG 3D8BA 5FTNA 4JI2M 2QP9X 3M6AA 3UMMA 3H4MA 3LMMA 4M9XA 3R9XB 1WGNA 4LF4M 1DO0A 3U61B 1N34M 4XBOA 3KOXE 3Q8XA 2G5GX 2CRUA 4AQYM 2H5XA 2JA2A 3AOEA 4IBIA 2BWEA 1L2CA 3W68A 4IBKA 5FTMA 2MROB 1NSFA 5FTLA 2DAMA 3SARA 3ILKA 3CF6E 4WURA 4GKKM 1GKIA 3L27A 2DI0A 2FE8A 4HEOA 3SASA 4LFCM 4KODA 3HJQA 1DGHA 2VIIA 3J2PB 1N32M 2UXCM 1TDHA 4L16A 5EJCA 2DHRA 2YNMD 3HHZA 2B3TA 1NVMA 2FFJA 1Q3BA 4P17A 4BB9A 3I04M 4DR5M 3SAUA 3U61A 2FS1A 4GEWA 3TPZA 3T1HM 2L2DA 1R7RA 5JI3E 1MX0A 2DAEA 4LJAA 2UU9M 3KS4A 3CF2A 4IBGA 3B7ZA 2UXDM 4IBJA 5EP3A 1R2ZA 4LF9M 1VDLA 2YQZA 3AOEC 4MH0E 1XXHE 4X65M 1UM8A 3GO8A 1NV8A 3FUUA 3UGJA 4G4OA 5BR8M 2OOBA 3HJ8A 4LFBM 3HY5A 2LHGA 4NSRA 2DVWB 2JZ1A 4ITQA 3THGA 2VQFM 1IN5A 4MGYE 2DAGA 3J81S 4LF7M 3T15A 4FWHA 1TH2A 1PM5A 1Y8GA 3CF0A 3FTEA 2HKJA 3DZDA 5IREB 5KQ8A 2G3QA 5FTJA 1N77A 2F4VM 2E5LM 4UN2B 1XC8A 1LTMA 1JR3A 1IBLM 4AKIA 3IG5A 4B7FA 5ITXE 3JR4A 4B3RM 1L2DA 1E94E 1IN8A 1VEJA 1ZV1A 2K0BX 3ZCBB 4L8RC 1N75A 3BBZA 1VDDA 3NWLA 1NHWC 2X4AA 3A98B 3MJ5A 4I5SA 3U5ZB 1QAOA 4B7HA 5A2QS 4MM3B 2R18A 4MB7A 3GPXA 2P5TA 4GIPA 2V1UA 4XGIA 4B7GA 3FUWA 2F5OA 1SXJB 1Q39A 2EUCA 3PNYA 4B3TM 2HAKA 4R3DA 2KHHA 2CFOA 4LGYA 4QNMA 5EP2A 4BBAA 1PJIA 1K3XA 4MGIE 2LWXA 4Y28F 5GKNA 2L4FA 1HQCA 3VLFB 3SAWA 1GO5A 1IM2A 4DR2M 2O25A 3GP1A 4M0DA 4KT0F 1DGBA 3H4JA 2LVPC 1W5SA 2OQ4A 3KDSE 1TH3A 2XFSA 3M7GA 2UXBM 1ZAEA 1H6UA 2LBCA 1IY0A 3HJSA 4FVMA 4CGYB 1L2BA 4REZA 4DR6M 2JZ0A 2ZM6M 2KDLA 2GQFA 2JNHA 3E21A 3KW6A 3J7AS 3IECA 3E4RA 3U5ZA 3QWLA 2ERCA 5EXPA 3L26A 2EJSA 2CV2A 3KSJA 4MGKE 4AW4A 5ITUA 2H1RA 5DNYA 4F1IA 5ITTA 1VQ1A 1IXSB 3DFZA 1D2NA 1SXJA 3SHFA 2A5YB 1XHBA 3KSXA 2CP8A 3KP0E 3CTWB 3LQQA 1DGFA 1VG5A 1HNWM 1QDTA 1Z5BA 3QAUA 3T1YM 3ZH9B 1GJSA 1WGLA 2KRKA 3GRUA 1G3IA 2OPFA 3KOZE 3OTOM 3SYKA 1QAQA 1WJ7A 2R46A 2WSCF 2DAIA 4GC5A 3GPPA 2ZAOA 3GQ5A 3U6QA 4CHTB 1F4IA 5IWAM 1TF0B 3LCUA 2HWJA 1WHCA 4RNAA 3WHLA 3GLIE 1WIVA 1EE8A 1YUBA 4P16A 5DYGA 4Z6YA 1XMQM 3K1JA 4FD2A 1IXSA 4LZZA 4X64M 2L7HA 3A45A 3LVWA 4L78A 4D82A 4L4UA 1T6OA 4DV0M 1TR8A 1HT2E 2XEPA 2YFQA 4DV5M 1SXJC 1ZMUA 1PJSA 2VF8A 2JY5A 2LVNC 3J80S 4D81A 2LH0A 4IBFA 4ANRA 1TH4A 1FJGM 4R7GA 2QQ8A 4LJ8A 5C1BA 1WR1B 2KXEA 1R6BX 1QZMA 1YLAA 5C18A 1IY2A 2APLA 2V1CA 1G8PA 1OFHA 1L8QA 2W82A 3LVVA 5ITYA 3HHYA 2O5RA 4DBGB 3HHXA 4LRTA 2JP7A 3HGIA 4DUYM 3C3DA 2G8LA 2QBYB 4JYAM 3FTDA 3U6MA 5FTKA 2QCUA 3FUXA 4GH9A 1E32A 1MN3A 3T6PA 4YY3M 1V34A 1Z5CA 4L6V6 2Y21A 3B7QA 1J7KA 1OAOC 2QNJA 1XMOM 3GLGB 1GJTA 3PVSA 4RF1A 3AFHA 3HKPA 1XNQM 5DYIA 2NQ8C 4DV7M 3HX3A 2F5PA 3IG8A 4X62M 5IT9S 2MR9A 2CWBA 4L15A 4JN6A 3SFZA 4LF8M 4OU7A 2CV0A 3GQ3A 3GLIA 4AI6A 4IBDA 2K6BA 2CHQA 2QBYA 4LFAM 1T3TA 3U6LA 1IXRC 5KO3A 4G4RA 1UFZA 5BPVA 1ZQ9A 5ITQA 2DWMA 3JAMS 3SMPA 3GLGA 2QENA 4AG6A 4DV1M 1NNJA 2LTUA 3HZJA 4CJ6A 2DWNA 3EIHA 2RRUA 3BOSA 4JXJA 3PNVA 4WP2A 4QNRA 3F92A 3U6SA 2YR0A 3HU1A 3GLHE 1RU3A 1PJQA 3CGWA 2K9DA 1TTEA 1OQYA 1JR3D 2CHVA 3L29A 4FWGA 4G6ZA 4LZJA 3TL4X 2DZLA 4JI5M 4AKHA 4Q7JA 4W5WA 1IBMM 2DENA 4AKGA 3B9PA 1ORYB 2ZANA 5F3WA 4LF6M 4FWDA 1W5TA 1Q02A 2LVQD 2XFTA 4GITA 3WHKA 4CISA 3C3EA 1MJGM 3ZC7B 3BXWA 1XXHB 1IN6A 4GHLA 2R65A 2M5ZA 2HCBA 4X66M 1P3QQ 4HLQA 1R5LA 1G59A 3I51A 1GL7A 3UK6A 1E9SA 2D7EA 3LCVB 3HHWA 3LQRA 1IBKM 1X37A 2DHYA 4GKJM 1QDRA 2J5YA 1HNXM 1QANA 4B3MM 2R0IA 4OVZB 4PCZA 3U6DA 3IHPA 3PXGA 2FOIC 1KSFX 2GNOA 2JUJA 2LVAA 2C9OA 3VDUA 1XB2B 1HT1E 2BWBA 2N35A 5JI2E 4DR3M 2Y0QA 4IJFA 3RGPA 1HR0M 4JV5M 1NNUC 1XXHA 1KYIA 1NO1A 2K47A 2KZUA 2WSFF 4A3VB 4JI4M 3EIEA 1I94M 1AUAA 1AIPC 5EXTA 4NRWA 2Y0TA 1NY6A 1SXJD 1I4WA 2R4EA 1DO2A 3FYCA 1KFVA 3K2LA 3SATA 1R4GA 2I7NA 3C9PA 1XWIA 3L28A 2HL7A 2UUBM 4OVZA 4G3OA 3HU2A 4IBBA 4LJ6A 4JI0M 1EFUB 4LRSA 4PDGA 3KP1E 8CATA 3A46A 4JI6M 5ITXA 2R44A 1ZMWA 5IZ7D 3UZUA 1G4AE 3U6OA 4QOSA 3SYLA 2C96A 2FH0A 2Y20A 4EIWA 4QOZC 2L09A 2C99A 2KEBA 4RF0A 3U60B
chains in the Genus database with same CATH topology
4Z8XA 5ITRA 1Q3CA 2XSZA 1IN7A 5KPZA 1TGUA 1NJFA 3D8LA 4AG5A 7CATA 1FNNA 2BNKA 1QAMA 2CE7A 3J7BA 3MHVC 3GRYA 1J09A 1QVRA 3SMSA 3C58A 4OX9M 2CEAA 2RGOA 4DV6M 3SAVA 2I7PA 2XZFA 2R62A 4LCBA 2ZAMA 2DWLA 4IIWA 3GRVA 4IBEA 3VK8A 3SBJA 4BLCA 4DV4M 2X8AA 3U60A 3R8FA 3NBIA 1HQYE 3HU3A 4QHTA 3GLIB 4DUZM 1QQWA 1L1ZA 3AL0C 2F5NA 2DZNB 3VDPA 5EP4A 1S3SA 3GRRA 2J7OA 4ZPXA 2UUCM 2CV1A 4FCWA 4M9SA 4LJ4A 2KZSA 3TWMA 2UUAM 2Z7JA 2C9CA 1N78A 2XGNA 2KA6B 2D7HA 1OFIA 2L7IA 4NXMM 3I4YA 2DWZB 2D7GA 2DXIA 1LV7A 1YE9A 2QPAA 3AJIB 2J7NA 5LMUM 3U6EA 1QYRA 1J5EM 4I81A 4AZFA 2M60A 3TQSA 1IN4A 4K0KM 1IQPA 5EQTA 2XLJA 4JI8M 3JR5A 3TWKA 4S12A 5H37D 4JI3M 4TUWA 2Z4RA 3W0LB 5E6JA 4G4NA 3MK6A 3VKHA 1E9RA 4PDIA 3FD9A 5E26A 3W0FA 1G41A 1NHGC 4DV2M 4NRVA 1K82A 4LG2A 1N33M 1JQJC 4FCTA 4M9ZA 1PJJA 4OW0A 4M0WA 2AHMA 5EXSA 1MU5A 4GHAA 3GLFB 4LY6A 2CUZA 2L6OA 4LF5M 4IJEA 2XH9A 3K92A 4KHPM 1SXJE 3GPUA 1K3WA 1GL6A 3RFWA 3M0EA 3U6PA 2RKOA 2Z4SA 4PD2A 2X49A 1NJGA 3GPYA 1Z5AA 3AOGA 1HNZM 3FUVA 2FNAA 4LGMA 5EP1A 3DOAA 1IY1A 3GLFA 3KOWE 2F5QA 3KOYE 5KQDA 3E9SA 4LJ9A 5KPRA 3VK7A 3DA1A 2QZ4A 1DGGA 1GLNA 2R4JA 3GLHB 4NOOB 3FKEA 2F5SA 1OJLA 2V6ZM 4WW0A 2HHHM 4II7A 2CHGA 3KXEC 3FTFA 3RGSA 4IBCA 4G4QA 3PFIA 2VQEM 3FUTA 4D80A 3J27B 4MGZE 4NL4H 3VFDA 4GMQA 2Z3XA 1Z6TA 5LMNM 2KRUA 2RGHA 4LJ7A 1C1KA 3HWSA 3RE8A 3I4VA 1R2YA 1XNRM 1GVNA 2LNHC 2C98A 3AKZA 4B3SM 3GQ4A 3TE6A 2LXEA 3GLHA 4LJ5A 3TWLA 1TDZA 1Z59A 4GC9A 4I4LA 4JI1M 4DR7M 3A42A 2DZOB 3KVWA 3U6CA 1N36M 4MGHA 4DR1M 2EA0A 4FCVA 2R45A 3FYDA 1IXZA 3KS8A 4HL4A 4KO8A 2BJWA 3T38A 3UJNA 3SC3A 3L25A 4NSOB 3VKGA 2XSZD 2EO2A 1L1TA 4NXNM 3AV0A 4DV3M 1YSYA 3SHGB 4GRIA 2C5RA 4DR4M 5FLXS 4YHHM 4KLNA 3L2AA 4FW9A 5KPTA 4JI7M 3FTCA 3K8ZA 4I8OA 4B08A 2XF3A 5FSWA 4QHSA 4PT5A 1NY5A 2XZUA 2KW0A 2BJVA 1DGHB 1WXQA 2Q2EB 5EXXA 2ZBKB 3KFUG 3D8BA 5FTNA 4JI2M 2QP9X 3M6AA 3UMMA 3H4MA 3LMMA 4M9XA 3R9XB 4LF4M 1DO0A 3U61B 1N34M 4XBOA 3KOXE 3Q8XA 2G5GX 4AQYM 2JA2A 3AOEA 4IBIA 1L2CA 3SARA 4IBKA 5FTMA 1NSFA 5FTLA 3ILKA 3CF6E 4WURA 4GKKM 1GKIA 3L27A 2FE8A 3SASA 4LFCM 4KODA 3HJQA 1DGHA 2VIIA 3J2PB 1N32M 2UXCM 1TDHA 4L16A 5EJCA 2DHRA 2YNMD 3HHZA 1NVMA 2FFJA 1Q3BA 4BB9A 4DR5M 3SAUA 3U61A 3TPZA 3T1HM 1R7RA 5JI3E 1MX0A 4LJAA 2UU9M 3KS4A 3CF2A 4IBGA 2UXDM 4IBJA 5EP3A 1R2ZA 4LF9M 4X65M 2YQZA 3AOEC 4MH0E 1UM8A 3GO8A 3FUUA 3UGJA 4G4OA 5BR8M 3HJ8A 4LFBM 4NSRA 2DVWB 4ITQA 3THGA 2VQFM 1IN5A 4MGYE 3J81S 4LF7M 3T15A 4FWHA 1TH2A 1PM5A 3CF0A 3FTEA 2HKJA 3DZDA 5IREB 5KQ8A 2F4VM 5FTJA 1N77A 2E5LM 1XC8A 1JR3A 1IBLM 4AKIA 3IG5A 4B7FA 5ITXE 3JR4A 4B3RM 1L2DA 1E94E 1IN8A 3ZCBB 4L8RC 1N75A 1VDDA 3NWLA 1NHWC 2X4AA 3A98B 3MJ5A 4I5SA 3U5ZB 1QAOA 4B7HA 5A2QS 4MM3B 2R18A 4MB7A 3GPXA 2P5TA 4GIPA 2V1UA 4XGIA 4B7GA 3FUWA 2F5OA 1SXJB 1Q39A 2EUCA 3PNYA 4B3TM 1K3XA 4R3DA 2CFOA 4LGYA 4QNMA 5EP2A 4BBAA 1PJIA 4MGIE 2LWXA 5GKNA 1HQCA 3VLFB 3SAWA 1IM2A 4DR2M 3GP1A 4M0DA 2OQ4A 1DGBA 1W5SA 3KDSE 1TH3A 2XFSA 3M7GA 2UXBM 1ZAEA 1H6UA 4FVMA 1IY0A 3HJSA 4CGYB 1L2BA 4DR6M 4REZA 2ZM6M 3KW6A 3J7AS 3U5ZA 3E4RA 3QWLA 2ERCA 5EXPA 3L26A 2CV2A 3KSJA 4MGKE 4AW4A 5ITUA 2H1RA 5DNYA 5ITTA 1IXSB 3DFZA 1D2NA 1SXJA 3SHFA 2A5YB 1XHBA 3KSXA 3LQQA 3KP0E 3CTWB 1DGFA 1HNWM 1Z5BA 3QAUA 3T1YM 3ZH9B 2KRKA 3GRUA 1G3IA 2OPFA 3KOZE 3OTOM 3SYKA 1QAQA 2R46A 4GC5A 3GPPA 2ZAOA 3GQ5A 3U6QA 4CHTB 5IWAM 4RNAA 3WHLA 1EE8A 1YUBA 4P16A 5DYGA 4Z6YA 1XMQM 3K1JA 4FD2A 4LZZA 4X64M 2L7HA 3A45A 3LVWA 4L78A 4D82A 4L4UA 4DV0M 1HT2E 2XEPA 2YFQA 4DV5M 1SXJC 3J80S 4D81A 2LH0A 4IBFA 1TH4A 1FJGM 4R7GA 4LJ8A 5C1BA 2KXEA 1R6BX 1QZMA 5C18A 1IY2A 2V1CA 1G8PA 1OFHA 1L8QA 2W82A 3LVVA 5ITYA 3HHYA 2O5RA 3HHXA 4LRTA 3HGIA 4DUYM 2G8LA 2QBYB 4JYAM 3FTDA 3U6MA 5FTKA 2QCUA 3FUXA 4GH9A 1E32A 4YY3M 1Z5CA 2Y21A 1J7KA 1XMOM 3GLGB 3PVSA 4RF1A 3AFHA 3HKPA 1XNQM 5DYIA 2NQ8C 4DV7M 2F5PA 3IG8A 4X62M 5IT9S 4L15A 4JN6A 3SFZA 4LF8M 4OU7A 2CV0A 3GQ3A 3GLIA 4AI6A 4IBDA 2CHQA 2QBYA 4LFAM 1T3TA 3U6LA 1IXRC 5KO3A 4G4RA 5BPVA 1ZQ9A 5ITQA 2DWMA 3JAMS 3SMPA 3GLGA 2QENA 4AG6A 4DV1M 1NNJA 2DWNA 3EIHA 3BOSA 4JXJA 3PNVA 4QNRA 3U6SA 2YR0A 3HU1A 4G6ZA 2CHVA 1JR3D 3L29A 4FWGA 3TL4X 4AKHA 4LZJA 4JI5M 1IBMM 4W5WA 4AKGA 3B9PA 1ORYB 2ZANA 5F3WA 4LF6M 4FWDA 1W5TA 4GITA 4CISA 2XFTA 3WHKA 3ZC7B 1XXHB 1IN6A 4GHLA 2R65A 2M5ZA 2HCBA 4X66M 4HLQA 1G59A 3I51A 1GL7A 3UK6A 1E9SA 2D7EA 3HHWA 3LQRA 1IBKM 1X37A 4GKJM 1HNXM 4B3MM 1QANA 4OVZB 4PCZA 3U6DA 3PXGA 2FOIC 1KSFX 2C9OA 3VDUA 1HT1E 5JI2E 4DR3M 2Y0QA 4IJFA 3RGPA 1HR0M 4JV5M 1NNUC 1XXHA 1KYIA 2K47A 2KZUA 4A3VB 4JI4M 3EIEA 1I94M 5EXTA 4NRWA 2Y0TA 1NY6A 1SXJD 3FYCA 1I4WA 1DO2A 2R4EA 1KFVA 3K2LA 3SATA 2I7NA 1XWIA 3L28A 2HL7A 2UUBM 4OVZA 3HU2A 4IBBA 4LJ6A 4JI0M 4PDGA 4LRSA 8CATA 3KP1E 3A46A 4JI6M 5ITXA 3UZUA 5IZ7D 3U6OA 1G4AE 4QOSA 3SYLA 2C96A 2Y20A 4EIWA 4QOZC 2L09A 2C99A 2KEBA 4RF0A 3U60B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z8X A;  2QBY B;  3PFI A;  4D80 A;  5FTK A;  2DVW B;  3VFD A;  1IN5 A;  2XSZ A;  1E32 A;  1IN7 A;  1NJF A;  4FWH A;  3CF0 A;  1FNN A;  1J7K A;  2CE7 A;  3DZD A;  3MHV C;  3GLG B;  1QVR A;  1C1K A;  3HWS A;  3PVS A;  4LJ7 A;  5FTJ A;  2CEA A;  1JR3 A;  5DYI A;  2C98 A;  2R62 A;  4LCB A;  2ZAM A;  1E94 E;  1IN8 A;  4L15 A;  4JN6 A;  3GLH A;  4LJ5 A;  4I4L A;  3GLI A;  2X8A A;  3U5Z B;  3R8F A;  2DZO B;  2CHQ A;  1HQY E;  3HU3 A;  4QHT A;  3GLI B;  2QBY A;  1IXR C;  2V1U A;  4FCV A;  2DZN B;  5EP4 A;  1S3S A;  1SXJ B;  1IXZ A;  4ZPX A;  5EP2 A;  4FCW A;  2BJW A;  4KO8 A;  4LJ4 A;  4QNM A;  3GLG A;  2QEN A;  3SC3 A;  2C9C A;  1HQC A;  3VLF B;  1IM2 A;  2XSZ D;  3EIH A;  1OFI A;  3BOS A;  1W5S A;  2DWZ B;  3KDS E;  4QNR A;  3HU1 A;  1LV7 A;  2QPA A;  1IY0 A;  3AJI B;  2CHV A;  1JR3 D;  4FWG A;  4I81 A;  3KW6 A;  5EXP A;  3B9P A;  2ZAN A;  1IN4 A;  1IQP A;  5EQT A;  4KLN A;  4FW9 A;  4FWD A;  1W5T A;  4GIT A;  3WHK A;  1IXS B;  1D2N A;  1SXJ A;  1XXH B;  1IN6 A;  2Z4R A;  1NY5 A;  4QHS A;  2R65 A;  2HCB A;  2BJV A;  5EXX A;  3UK6 A;  3D8B A;  5FTN A;  1G41 A;  3ZH9 B;  2KRK A;  2QP9 X;  3M6A A;  3H4M A;  1G3I A;  1JQJ C;  1X37 A;  4FCT A;  3SYK A;  1DO0 A;  3U61 B;  5EXS A;  3PXG A;  2ZAO A;  1KSF X;  3GLF B;  4LY6 A;  2C9O A;  3WHL A;  1HT1 E;  5FTM A;  1NSF A;  5FTL A;  5JI2 E;  5DYG A;  3K1J A;  1SXJ E;  4FD2 A;  4LZZ A;  4D82 A;  1XXH A;  1KYI A;  4L4U A;  4KOD A;  4A3V B;  1HT2 E;  3EIE A;  2VII A;  1SXJ C;  3M0E A;  5EXT A;  4L16 A;  2RKO A;  1NY6 A;  2DHR A;  1SXJ D;  2Z4S A;  4D81 A;  1DO2 A;  1NVM A;  1NJG A;  4LJ8 A;  5C1B A;  1XWI A;  1R6B X;  1QZM A;  5C18 A;  1IY2 A;  3HU2 A;  4LJ6 A;  1R7R A;  2FNA A;  4LGM A;  4LRS A;  5EP1 A;  5JI3 E;  1IY1 A;  4LJA A;  3GLF A;  1G4A E;  4LJ9 A;  1OFH A;  3CF2 A;  4QOS A;  3SYL A;  2C96 A;  2QZ4 A;  1L8Q A;  3GLH B;  5EP3 A;  4EIW A;  1OJL A;  2V6Z M;  4WW0 A;  2CHG A;  2C99 A;  4LRT A;  3U60 B;  1UM8 A; 
#chains in the Genus database with same CATH topology
 4Z8X A;  5ITR A;  1Q3C A;  1NV9 A;  2XSZ A;  1IN7 A;  2LHC A;  5KPZ A;  3FRH A;  1TGU A;  2EKF A;  1NJF A;  3D8L A;  4AG5 A;  7CAT A;  2QSF X;  1FNN A;  2BNK A;  1QAM A;  2CE7 A;  3J7B A;  3MHV C;  3GRY A;  1J09 A;  1QVR A;  3SMS A;  3C58 A;  4OX9 M;  1A5T A;  3FRI A;  2CEA A;  1OIP A;  2RGO A;  3E46 A;  4DV6 M;  3SAV A;  2I7P A;  2XZF A;  1OIZ A;  2R62 A;  4LCB A;  2ZAM A;  2DWL A;  4IIW A;  3GRV A;  4IBE A;  3VK8 A;  3SBJ A;  4BLC A;  4DV4 M;  2X8A A;  3U60 A;  3R8F A;  3ZQJ A;  3NBI A;  3QYE A;  1HQY E;  3HU3 A;  4QHT A;  3GLI B;  2OOA A;  2DKL A;  4DUZ M;  1QQW A;  1L1Z A;  3AL0 C;  2F5N A;  2DZN B;  3VDP A;  5EP4 A;  1S3S A;  3GRR A;  2J7O A;  2ZTD A;  4ZPX A;  2UUC M;  2CV1 A;  4FCW A;  3K9O A;  1PJT A;  4LJ4 A;  2KZS A;  4M9S A;  3TWM A;  2UUA M;  2Z7J A;  2C9C A;  1N78 A;  2QHO B;  2XGN A;  2KA6 B;  1JR3 E;  2D7H A;  2JWS A;  1OFI A;  2VF7 A;  2L7I A;  4NXM M;  3I4Y A;  2MJ5 B;  2DWZ B;  2D7G A;  3GLF E;  2DXI A;  1LV7 A;  1YE9 A;  2QPA A;  3AJI B;  1V92 A;  2J7N A;  5LMU M;  3U6E A;  1QYR A;  1J5E M;  4I81 A;  4AZF A;  2M60 A;  3TQS A;  1IN4 A;  4K0K M;  1IQP A;  2O01 F;  5EQT A;  2XLJ A;  4CIZ A;  4JI8 M;  3JR5 A;  3TWK A;  4S12 A;  5H37 D;  4JI3 M;  4TUW A;  2Z4R A;  3W0L B;  5E6J A;  1PRB A;  4G4N A;  3MK6 A;  3VKH A;  2ZTC A;  1E9R A;  4PDI A;  1D0M A;  3FD9 A;  5E26 A;  1OKS A;  3W0F A;  1G41 A;  1NHG C;  4XK8 F;  4DV2 M;  4NRV A;  1K82 A;  4LG2 A;  3W67 A;  2JY7 A;  1JQJ C;  2LVO C;  1N33 M;  2KNA A;  4FCT A;  4M9Z A;  1PJJ A;  4OW0 A;  4M0W A;  2AHM A;  2Z8Y M;  5EXS A;  1MU5 A;  4GHA A;  2EKK A;  3FE3 A;  3GLF B;  4LY6 A;  2CUZ A;  5DFL A;  2L6O A;  3Q8G A;  1G71 A;  4LF5 M;  4IJE A;  2XH9 A;  3K92 A;  4KHP M;  4R71 A;  1SXJ E;  3GPU A;  1K3W A;  1VEK A;  1GL6 A;  3RFW A;  3M0E A;  2L4E A;  3U6P A;  2RKO A;  1C7Y A;  2Z4S A;  4PD2 A;  2X49 A;  1NJG A;  3GPY A;  1Z5A A;  3AOG A;  1HNZ M;  1BVS A;  2JXN A;  3FUV A;  5L8R F;  2FNA A;  2DNA A;  4LGM A;  5EP1 A;  3DOA A;  1IY1 A;  3GLF A;  3KOW E;  2F5Q A;  3KOY E;  5KQD A;  3E9S A;  4LJ9 A;  5KPR A;  3VK7 A;  3DA1 A;  2OO9 A;  1VEG A;  1DGG A;  1GLN A;  2QZ4 A;  1ZMV A;  2R4J A;  3FKE A;  3GLH B;  1OJL A;  2V6Z M;  4NOO B;  4WW0 A;  2HHH M;  4II7 A;  2CHG A;  3MMP A;  1EIJ A;  3KXE C;  3FTF A;  3RGS A;  4IBC A;  4G4Q A;  1IFY A;  3PFI A;  2VQE M;  3FUT A;  3B89 A;  4D80 A;  3J27 B;  4MGZ E;  2VDB B;  4NL4 H;  3VFD A;  4GMQ A;  2Z3X A;  1Z6T A;  5LMN M;  2KRU A;  1OAI A;  2R6F A;  2RGH A;  4LJ7 A;  1C1K A;  3HWS A;  3RE8 A;  3I4V A;  1R2Y A;  1XNR M;  1GVN A;  2LNH C;  3LW5 F;  4RKU F;  2C98 A;  3AKZ A;  4B3S M;  2MH8 A;  3GQ4 A;  3TE6 A;  2LXE A;  3GLH A;  4LJ5 A;  3TWL A;  1TDZ A;  1Z59 A;  4GC9 A;  4I4L A;  4JI1 M;  4DR7 M;  3A42 A;  2DZO B;  3KVW A;  3V76 A;  3U6C A;  2KNV A;  1N36 M;  1QUT A;  1QZE A;  4MGH A;  2MGW A;  4F2L A;  4DR1 M;  2EA0 A;  4FCV A;  2R45 A;  3FYD A;  1IXZ A;  3KS8 A;  4NC6 A;  2WSE F;  4HL4 A;  4KO8 A;  1D0K A;  2BJW A;  3T38 A;  3K9P A;  3SC3 A;  1T43 A;  3UJN A;  3L25 A;  4NSO B;  3VKG A;  1JB0 F;  2XSZ D;  1PGY A;  2EO2 A;  1HJP A;  1L1T A;  4NXN M;  3AV0 A;  2KNZ A;  1D0L A;  1OTR A;  1QUS A;  4DV3 M;  2JY6 B;  1YSY A;  3SHG B;  3B74 A;  4GRI A;  2DAK A;  2C5R A;  4DR4 M;  1V33 A;  5FLX S;  2WZJ A;  4YHH M;  4KLN A;  1CUK A;  3L2A A;  4FW9 A;  5KPT A;  1DV0 A;  4JI7 M;  3FTC A;  3K8Z A;  4I8O A;  4B08 A;  2XF3 A;  3B7N A;  3I01 M;  3QYB A;  5FSW A;  2JY8 A;  4QHS A;  4PT5 A;  3NBX X;  2F5S A;  1SG9 A;  1NY5 A;  2XZU A;  2KW0 A;  2BJV A;  3GLG E;  1DGH B;  1GAB A;  1WXQ A;  2Q2E B;  5EXX A;  2ZBK B;  3KFU G;  3D8B A;  5FTN A;  4JI2 M;  2QP9 X;  3M6A A;  3UMM A;  3H4M A;  3LMM A;  4M9X A;  3R9X B;  1WGN A;  4LF4 M;  1DO0 A;  3U61 B;  1N34 M;  4XBO A;  3KOX E;  3Q8X A;  2G5G X;  2CRU A;  4AQY M;  2H5X A;  2JA2 A;  3AOE A;  4IBI A;  2BWE A;  1L2C A;  3W68 A;  4IBK A;  5FTM A;  2MRO B;  1NSF A;  5FTL A;  2DAM A;  3SAR A;  3ILK A;  3CF6 E;  4WUR A;  4GKK M;  1GKI A;  3L27 A;  2DI0 A;  2FE8 A;  4HEO A;  3SAS A;  4LFC M;  4KOD A;  3HJQ A;  1DGH A;  2VII A;  3J2P B;  1N32 M;  2UXC M;  1TDH A;  4L16 A;  5EJC A;  2DHR A;  2YNM D;  3HHZ A;  2B3T A;  1NVM A;  2FFJ A;  1Q3B A;  4P17 A;  4BB9 A;  3I04 M;  4DR5 M;  3SAU A;  3U61 A;  2FS1 A;  4GEW A;  3TPZ A;  3T1H M;  2L2D A;  1R7R A;  5JI3 E;  1MX0 A;  2DAE A;  4LJA A;  2UU9 M;  3KS4 A;  3CF2 A;  4IBG A;  3B7Z A;  2UXD M;  4IBJ A;  5EP3 A;  1R2Z A;  4LF9 M;  1VDL A;  2YQZ A;  3AOE C;  4MH0 E;  1XXH E;  4X65 M;  1UM8 A;  3GO8 A;  1NV8 A;  3FUU A;  3UGJ A;  4G4O A;  5BR8 M;  2OOB A;  3HJ8 A;  4LFB M;  3HY5 A;  2LHG A;  4NSR A;  2DVW B;  2JZ1 A;  4ITQ A;  3THG A;  2VQF M;  1IN5 A;  4MGY E;  2DAG A;  3J81 S;  4LF7 M;  3T15 A;  4FWH A;  1TH2 A;  1PM5 A;  1Y8G A;  3CF0 A;  3FTE A;  2HKJ A;  3DZD A;  5IRE B;  5KQ8 A;  2G3Q A;  5FTJ A;  1N77 A;  2F4V M;  2E5L M;  4UN2 B;  1XC8 A;  1LTM A;  1JR3 A;  1IBL M;  4AKI A;  3IG5 A;  4B7F A;  5ITX E;  3JR4 A;  4B3R M;  1L2D A;  1E94 E;  1IN8 A;  1VEJ A;  1ZV1 A;  2K0B X;  3ZCB B;  4L8R C;  1N75 A;  3BBZ A;  1VDD A;  3NWL A;  1NHW C;  2X4A A;  3A98 B;  3MJ5 A;  4I5S A;  3U5Z B;  1QAO A;  4B7H A;  5A2Q S;  4MM3 B;  2R18 A;  4MB7 A;  3GPX A;  2P5T A;  4GIP A;  2V1U A;  4XGI A;  4B7G A;  3FUW A;  2F5O A;  1SXJ B;  1Q39 A;  2EUC A;  3PNY A;  4B3T M;  2HAK A;  4R3D A;  2KHH A;  2CFO A;  4LGY A;  4QNM A;  5EP2 A;  4BBA A;  1PJI A;  1K3X A;  4MGI E;  2LWX A;  4Y28 F;  5GKN A;  2L4F A;  1HQC A;  3VLF B;  3SAW A;  1GO5 A;  1IM2 A;  4DR2 M;  2O25 A;  3GP1 A;  4M0D A;  4KT0 F;  1DGB A;  3H4J A;  2LVP C;  1W5S A;  2OQ4 A;  3KDS E;  1TH3 A;  2XFS A;  3M7G A;  2UXB M;  1ZAE A;  1H6U A;  2LBC A;  1IY0 A;  3HJS A;  4FVM A;  4CGY B;  1L2B A;  4REZ A;  4DR6 M;  2JZ0 A;  2ZM6 M;  2KDL A;  2GQF A;  2JNH A;  3E21 A;  3KW6 A;  3J7A S;  3IEC A;  3E4R A;  3U5Z A;  3QWL A;  2ERC A;  5EXP A;  3L26 A;  2EJS A;  2CV2 A;  3KSJ A;  4MGK E;  4AW4 A;  5ITU A;  2H1R A;  5DNY A;  4F1I A;  5ITT A;  1VQ1 A;  1IXS B;  3DFZ A;  1D2N A;  1SXJ A;  3SHF A;  2A5Y B;  1XHB A;  3KSX A;  2CP8 A;  3KP0 E;  3CTW B;  3LQQ A;  1DGF A;  1VG5 A;  1HNW M;  1QDT A;  1Z5B A;  3QAU A;  3T1Y M;  3ZH9 B;  1GJS A;  1WGL A;  2KRK A;  3GRU A;  1G3I A;  2OPF A;  3KOZ E;  3OTO M;  3SYK A;  1QAQ A;  1WJ7 A;  2R46 A;  2WSC F;  2DAI A;  4GC5 A;  3GPP A;  2ZAO A;  3GQ5 A;  3U6Q A;  4CHT B;  1F4I A;  5IWA M;  1TF0 B;  3LCU A;  2HWJ A;  1WHC A;  4RNA A;  3WHL A;  3GLI E;  1WIV A;  1EE8 A;  1YUB A;  4P16 A;  5DYG A;  4Z6Y A;  1XMQ M;  3K1J A;  4FD2 A;  1IXS A;  4LZZ A;  4X64 M;  2L7H A;  3A45 A;  3LVW A;  4L78 A;  4D82 A;  4L4U A;  1T6O A;  4DV0 M;  1TR8 A;  1HT2 E;  2XEP A;  2YFQ A;  4DV5 M;  1SXJ C;  1ZMU A;  1PJS A;  2VF8 A;  2JY5 A;  2LVN C;  3J80 S;  4D81 A;  2LH0 A;  4IBF A;  4ANR A;  1TH4 A;  1FJG M;  4R7G A;  2QQ8 A;  4LJ8 A;  5C1B A;  1WR1 B;  2KXE A;  1R6B X;  1QZM A;  1YLA A;  5C18 A;  1IY2 A;  2APL A;  2V1C A;  1G8P A;  1OFH A;  1L8Q A;  2W82 A;  3LVV A;  5ITY A;  3HHY A;  2O5R A;  4DBG B;  3HHX A;  4LRT A;  2JP7 A;  3HGI A;  4DUY M;  3C3D A;  2G8L A;  2QBY B;  4JYA M;  3FTD A;  3U6M A;  5FTK A;  2QCU A;  3FUX A;  4GH9 A;  1E32 A;  1MN3 A;  3T6P A;  4YY3 M;  1V34 A;  1Z5C A;  4L6V 6;  2Y21 A;  3B7Q A;  1J7K A;  1OAO C;  2QNJ A;  1XMO M;  3GLG B;  1GJT A;  3PVS A;  4RF1 A;  3AFH A;  3HKP A;  1XNQ M;  5DYI A;  2NQ8 C;  4DV7 M;  3HX3 A;  2F5P A;  3IG8 A;  4X62 M;  5IT9 S;  2MR9 A;  2CWB A;  4L15 A;  4JN6 A;  3SFZ A;  4LF8 M;  4OU7 A;  2CV0 A;  3GQ3 A;  3GLI A;  4AI6 A;  4IBD A;  2K6B A;  2CHQ A;  2QBY A;  4LFA M;  1T3T A;  3U6L A;  1IXR C;  5KO3 A;  4G4R A;  1UFZ A;  5BPV A;  1ZQ9 A;  5ITQ A;  2DWM A;  3JAM S;  3SMP A;  3GLG A;  2QEN A;  4AG6 A;  4DV1 M;  1NNJ A;  2LTU A;  3HZJ A;  4CJ6 A;  2DWN A;  3EIH A;  2RRU A;  3BOS A;  4JXJ A;  3PNV A;  4WP2 A;  4QNR A;  3F92 A;  3U6S A;  2YR0 A;  3HU1 A;  3GLH E;  1RU3 A;  1PJQ A;  3CGW A;  2K9D A;  1TTE A;  1OQY A;  1JR3 D;  2CHV A;  3L29 A;  4FWG A;  4G6Z A;  4LZJ A;  3TL4 X;  2DZL A;  4JI5 M;  4AKH A;  4Q7J A;  4W5W A;  1IBM M;  2DEN A;  4AKG A;  3B9P A;  1ORY B;  2ZAN A;  5F3W A;  4LF6 M;  4FWD A;  1W5T A;  1Q02 A;  2LVQ D;  2XFT A;  4GIT A;  3WHK A;  4CIS A;  3C3E A;  1MJG M;  3ZC7 B;  3BXW A;  1XXH B;  1IN6 A;  4GHL A;  2R65 A;  2M5Z A;  2HCB A;  4X66 M;  1P3Q Q;  4HLQ A;  1R5L A;  1G59 A;  3I51 A;  1GL7 A;  3UK6 A;  1E9S A;  2D7E A;  3LCV B;  3HHW A;  3LQR A;  1IBK M;  1X37 A;  2DHY A;  4GKJ M;  1QDR A;  2J5Y A;  1HNX M;  1QAN A;  4B3M M;  2R0I A;  4OVZ B;  4PCZ A;  3U6D A;  3IHP A;  3PXG A;  2FOI C;  1KSF X;  2GNO A;  2JUJ A;  2LVA A;  2C9O A;  3VDU A;  1XB2 B;  1HT1 E;  2BWB A;  2N35 A;  5JI2 E;  4DR3 M;  2Y0Q A;  4IJF A;  3RGP A;  1HR0 M;  4JV5 M;  1NNU C;  1XXH A;  1KYI A;  1NO1 A;  2K47 A;  2KZU A;  2WSF F;  4A3V B;  4JI4 M;  3EIE A;  1I94 M;  1AUA A;  1AIP C;  5EXT A;  4NRW A;  2Y0T A;  1NY6 A;  1SXJ D;  1I4W A;  2R4E A;  1DO2 A;  3FYC A;  1KFV A;  3K2L A;  3SAT A;  1R4G A;  2I7N A;  3C9P A;  1XWI A;  3L28 A;  2HL7 A;  2UUB M;  4OVZ A;  4G3O A;  3HU2 A;  4IBB A;  4LJ6 A;  4JI0 M;  1EFU B;  4LRS A;  4PDG A;  3KP1 E;  8CAT A;  3A46 A;  4JI6 M;  5ITX A;  2R44 A;  1ZMW A;  5IZ7 D;  3UZU A;  1G4A E;  3U6O A;  4QOS A;  3SYL A;  2C96 A;  2FH0 A;  2Y20 A;  4EIW A;  4QOZ C;  2L09 A;  2C99 A;  2KEB A;  4RF0 A;  3U60 B; 
#chains in the Genus database with same CATH homology
 4Z8X A;  5ITR A;  1Q3C A;  2XSZ A;  1IN7 A;  5KPZ A;  1TGU A;  1NJF A;  3D8L A;  4AG5 A;  7CAT A;  1FNN A;  2BNK A;  1QAM A;  2CE7 A;  3J7B A;  3MHV C;  3GRY A;  1J09 A;  1QVR A;  3SMS A;  3C58 A;  4OX9 M;  2CEA A;  2RGO A;  4DV6 M;  3SAV A;  2I7P A;  2XZF A;  2R62 A;  4LCB A;  2ZAM A;  2DWL A;  4IIW A;  3GRV A;  4IBE A;  3VK8 A;  3SBJ A;  4BLC A;  4DV4 M;  2X8A A;  3U60 A;  3R8F A;  3NBI A;  1HQY E;  3HU3 A;  4QHT A;  3GLI B;  4DUZ M;  1QQW A;  1L1Z A;  3AL0 C;  2F5N A;  2DZN B;  3VDP A;  5EP4 A;  1S3S A;  3GRR A;  2J7O A;  4ZPX A;  2UUC M;  2CV1 A;  4FCW A;  4M9S A;  4LJ4 A;  2KZS A;  3TWM A;  2UUA M;  2Z7J A;  2C9C A;  1N78 A;  2XGN A;  2KA6 B;  2D7H A;  1OFI A;  2L7I A;  4NXM M;  3I4Y A;  2DWZ B;  2D7G A;  2DXI A;  1LV7 A;  1YE9 A;  2QPA A;  3AJI B;  2J7N A;  5LMU M;  3U6E A;  1QYR A;  1J5E M;  4I81 A;  4AZF A;  2M60 A;  3TQS A;  1IN4 A;  4K0K M;  1IQP A;  5EQT A;  2XLJ A;  4JI8 M;  3JR5 A;  3TWK A;  4S12 A;  5H37 D;  4JI3 M;  4TUW A;  2Z4R A;  3W0L B;  5E6J A;  4G4N A;  3MK6 A;  3VKH A;  1E9R A;  4PDI A;  3FD9 A;  5E26 A;  3W0F A;  1G41 A;  1NHG C;  4DV2 M;  4NRV A;  1K82 A;  4LG2 A;  1N33 M;  1JQJ C;  4FCT A;  4M9Z A;  1PJJ A;  4OW0 A;  4M0W A;  2AHM A;  5EXS A;  1MU5 A;  4GHA A;  3GLF B;  4LY6 A;  2CUZ A;  2L6O A;  4LF5 M;  4IJE A;  2XH9 A;  3K92 A;  4KHP M;  1SXJ E;  3GPU A;  1K3W A;  1GL6 A;  3RFW A;  3M0E A;  3U6P A;  2RKO A;  2Z4S A;  4PD2 A;  2X49 A;  1NJG A;  3GPY A;  1Z5A A;  3AOG A;  1HNZ M;  3FUV A;  2FNA A;  4LGM A;  5EP1 A;  3DOA A;  1IY1 A;  3GLF A;  3KOW E;  2F5Q A;  3KOY E;  5KQD A;  3E9S A;  4LJ9 A;  5KPR A;  3VK7 A;  3DA1 A;  2QZ4 A;  1DGG A;  1GLN A;  2R4J A;  3GLH B;  4NOO B;  3FKE A;  2F5S A;  1OJL A;  2V6Z M;  4WW0 A;  2HHH M;  4II7 A;  2CHG A;  3KXE C;  3FTF A;  3RGS A;  4IBC A;  4G4Q A;  3PFI A;  2VQE M;  3FUT A;  4D80 A;  3J27 B;  4MGZ E;  4NL4 H;  3VFD A;  4GMQ A;  2Z3X A;  1Z6T A;  5LMN M;  2KRU A;  2RGH A;  4LJ7 A;  1C1K A;  3HWS A;  3RE8 A;  3I4V A;  1R2Y A;  1XNR M;  1GVN A;  2LNH C;  2C98 A;  3AKZ A;  4B3S M;  3GQ4 A;  3TE6 A;  2LXE A;  3GLH A;  4LJ5 A;  3TWL A;  1TDZ A;  1Z59 A;  4GC9 A;  4I4L A;  4JI1 M;  4DR7 M;  3A42 A;  2DZO B;  3KVW A;  3U6C A;  1N36 M;  4MGH A;  4DR1 M;  2EA0 A;  4FCV A;  2R45 A;  3FYD A;  1IXZ A;  3KS8 A;  4HL4 A;  4KO8 A;  2BJW A;  3T38 A;  3UJN A;  3SC3 A;  3L25 A;  4NSO B;  3VKG A;  2XSZ D;  2EO2 A;  1L1T A;  4NXN M;  3AV0 A;  4DV3 M;  1YSY A;  3SHG B;  4GRI A;  2C5R A;  4DR4 M;  5FLX S;  4YHH M;  4KLN A;  3L2A A;  4FW9 A;  5KPT A;  4JI7 M;  3FTC A;  3K8Z A;  4I8O A;  4B08 A;  2XF3 A;  5FSW A;  4QHS A;  4PT5 A;  1NY5 A;  2XZU A;  2KW0 A;  2BJV A;  1DGH B;  1WXQ A;  2Q2E B;  5EXX A;  2ZBK B;  3KFU G;  3D8B A;  5FTN A;  4JI2 M;  2QP9 X;  3M6A A;  3UMM A;  3H4M A;  3LMM A;  4M9X A;  3R9X B;  4LF4 M;  1DO0 A;  3U61 B;  1N34 M;  4XBO A;  3KOX E;  3Q8X A;  2G5G X;  4AQY M;  2JA2 A;  3AOE A;  4IBI A;  1L2C A;  3SAR A;  4IBK A;  5FTM A;  1NSF A;  5FTL A;  3ILK A;  3CF6 E;  4WUR A;  4GKK M;  1GKI A;  3L27 A;  2FE8 A;  3SAS A;  4LFC M;  4KOD A;  3HJQ A;  1DGH A;  2VII A;  3J2P B;  1N32 M;  2UXC M;  1TDH A;  4L16 A;  5EJC A;  2DHR A;  2YNM D;  3HHZ A;  1NVM A;  2FFJ A;  1Q3B A;  4BB9 A;  4DR5 M;  3SAU A;  3U61 A;  3TPZ A;  3T1H M;  1R7R A;  5JI3 E;  1MX0 A;  4LJA A;  2UU9 M;  3KS4 A;  3CF2 A;  4IBG A;  2UXD M;  4IBJ A;  5EP3 A;  1R2Z A;  4LF9 M;  4X65 M;  2YQZ A;  3AOE C;  4MH0 E;  1UM8 A;  3GO8 A;  3FUU A;  3UGJ A;  4G4O A;  5BR8 M;  3HJ8 A;  4LFB M;  4NSR A;  2DVW B;  4ITQ A;  3THG A;  2VQF M;  1IN5 A;  4MGY E;  3J81 S;  4LF7 M;  3T15 A;  4FWH A;  1TH2 A;  1PM5 A;  3CF0 A;  3FTE A;  2HKJ A;  3DZD A;  5IRE B;  5KQ8 A;  2F4V M;  5FTJ A;  1N77 A;  2E5L M;  1XC8 A;  1JR3 A;  1IBL M;  4AKI A;  3IG5 A;  4B7F A;  5ITX E;  3JR4 A;  4B3R M;  1L2D A;  1E94 E;  1IN8 A;  3ZCB B;  4L8R C;  1N75 A;  1VDD A;  3NWL A;  1NHW C;  2X4A A;  3A98 B;  3MJ5 A;  4I5S A;  3U5Z B;  1QAO A;  4B7H A;  5A2Q S;  4MM3 B;  2R18 A;  4MB7 A;  3GPX A;  2P5T A;  4GIP A;  2V1U A;  4XGI A;  4B7G A;  3FUW A;  2F5O A;  1SXJ B;  1Q39 A;  2EUC A;  3PNY A;  4B3T M;  1K3X A;  4R3D A;  2CFO A;  4LGY A;  4QNM A;  5EP2 A;  4BBA A;  1PJI A;  4MGI E;  2LWX A;  5GKN A;  1HQC A;  3VLF B;  3SAW A;  1IM2 A;  4DR2 M;  3GP1 A;  4M0D A;  2OQ4 A;  1DGB A;  1W5S A;  3KDS E;  1TH3 A;  2XFS A;  3M7G A;  2UXB M;  1ZAE A;  1H6U A;  4FVM A;  1IY0 A;  3HJS A;  4CGY B;  1L2B A;  4DR6 M;  4REZ A;  2ZM6 M;  3KW6 A;  3J7A S;  3U5Z A;  3E4R A;  3QWL A;  2ERC A;  5EXP A;  3L26 A;  2CV2 A;  3KSJ A;  4MGK E;  4AW4 A;  5ITU A;  2H1R A;  5DNY A;  5ITT A;  1IXS B;  3DFZ A;  1D2N A;  1SXJ A;  3SHF A;  2A5Y B;  1XHB A;  3KSX A;  3LQQ A;  3KP0 E;  3CTW B;  1DGF A;  1HNW M;  1Z5B A;  3QAU A;  3T1Y M;  3ZH9 B;  2KRK A;  3GRU A;  1G3I A;  2OPF A;  3KOZ E;  3OTO M;  3SYK A;  1QAQ A;  2R46 A;  4GC5 A;  3GPP A;  2ZAO A;  3GQ5 A;  3U6Q A;  4CHT B;  5IWA M;  4RNA A;  3WHL A;  1EE8 A;  1YUB A;  4P16 A;  5DYG A;  4Z6Y A;  1XMQ M;  3K1J A;  4FD2 A;  4LZZ A;  4X64 M;  2L7H A;  3A45 A;  3LVW A;  4L78 A;  4D82 A;  4L4U A;  4DV0 M;  1HT2 E;  2XEP A;  2YFQ A;  4DV5 M;  1SXJ C;  3J80 S;  4D81 A;  2LH0 A;  4IBF A;  1TH4 A;  1FJG M;  4R7G A;  4LJ8 A;  5C1B A;  2KXE A;  1R6B X;  1QZM A;  5C18 A;  1IY2 A;  2V1C A;  1G8P A;  1OFH A;  1L8Q A;  2W82 A;  3LVV A;  5ITY A;  3HHY A;  2O5R A;  3HHX A;  4LRT A;  3HGI A;  4DUY M;  2G8L A;  2QBY B;  4JYA M;  3FTD A;  3U6M A;  5FTK A;  2QCU A;  3FUX A;  4GH9 A;  1E32 A;  4YY3 M;  1Z5C A;  2Y21 A;  1J7K A;  1XMO M;  3GLG B;  3PVS A;  4RF1 A;  3AFH A;  3HKP A;  1XNQ M;  5DYI A;  2NQ8 C;  4DV7 M;  2F5P A;  3IG8 A;  4X62 M;  5IT9 S;  4L15 A;  4JN6 A;  3SFZ A;  4LF8 M;  4OU7 A;  2CV0 A;  3GQ3 A;  3GLI A;  4AI6 A;  4IBD A;  2CHQ A;  2QBY A;  4LFA M;  1T3T A;  3U6L A;  1IXR C;  5KO3 A;  4G4R A;  5BPV A;  1ZQ9 A;  5ITQ A;  2DWM A;  3JAM S;  3SMP A;  3GLG A;  2QEN A;  4AG6 A;  4DV1 M;  1NNJ A;  2DWN A;  3EIH A;  3BOS A;  4JXJ A;  3PNV A;  4QNR A;  3U6S A;  2YR0 A;  3HU1 A;  4G6Z A;  2CHV A;  1JR3 D;  3L29 A;  4FWG A;  3TL4 X;  4AKH A;  4LZJ A;  4JI5 M;  1IBM M;  4W5W A;  4AKG A;  3B9P A;  1ORY B;  2ZAN A;  5F3W A;  4LF6 M;  4FWD A;  1W5T A;  4GIT A;  4CIS A;  2XFT A;  3WHK A;  3ZC7 B;  1XXH B;  1IN6 A;  4GHL A;  2R65 A;  2M5Z A;  2HCB A;  4X66 M;  4HLQ A;  1G59 A;  3I51 A;  1GL7 A;  3UK6 A;  1E9S A;  2D7E A;  3HHW A;  3LQR A;  1IBK M;  1X37 A;  4GKJ M;  1HNX M;  4B3M M;  1QAN A;  4OVZ B;  4PCZ A;  3U6D A;  3PXG A;  2FOI C;  1KSF X;  2C9O A;  3VDU A;  1HT1 E;  5JI2 E;  4DR3 M;  2Y0Q A;  4IJF A;  3RGP A;  1HR0 M;  4JV5 M;  1NNU C;  1XXH A;  1KYI A;  2K47 A;  2KZU A;  4A3V B;  4JI4 M;  3EIE A;  1I94 M;  5EXT A;  4NRW A;  2Y0T A;  1NY6 A;  1SXJ D;  3FYC A;  1I4W A;  1DO2 A;  2R4E A;  1KFV A;  3K2L A;  3SAT A;  2I7N A;  1XWI A;  3L28 A;  2HL7 A;  2UUB M;  4OVZ A;  3HU2 A;  4IBB A;  4LJ6 A;  4JI0 M;  4PDG A;  4LRS A;  8CAT A;  3KP1 E;  3A46 A;  4JI6 M;  5ITX A;  3UZU A;  5IZ7 D;  3U6O A;  1G4A E;  4QOS A;  3SYL A;  2C96 A;  2Y20 A;  4EIW A;  4QOZ C;  2L09 A;  2C99 A;  2KEB A;  4RF0 A;  3U60 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...