2KRKA

Solution nmr structure of 26s protease regulatory subunit 8 from h.sapiens, northeast structural genomics consortium target target hr3102a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
MGHHHHHHSHPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of 26S protease regulatory subunit 8 from H.sapiens, Northeast Structural Genomics Consortium Target HR3102A
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords 26S protease regulatory subunit 8
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2krkA01
4WW0A 4L15A 1IXRC 5FTLA 4LJ5A 2XSZD 3GLHA 1S3SA 1IQPA 2C99A 3PXGA 2V1UA 1IN4A 2RKOA 4L4UA 4KO8A 2V6ZM 2QPAA 1NY5A 3BOSA 3HU1A 4FW9A 4LZZA 4QHSA 5DYGA 3GLIA 1XWIA 4ZPXA 5EXTA 1IXZA 1XXHB 3SYLA 1G41A 3GLIB 4KLNA 1IN7A 1IM2A 1HQCA 1G3IA 4FWDA 1NJFA 1W5TA 2Z4SA 5FTJA 1IN5A 1DO2A 3SYKA 1KYIA 3WHKA 2QBYB 2FNAA 3SC3A 1HQYE 1G4AE 5DYIA 2ZAOA 4D81A 3DZDA 2DWZB 4L16A 3HU2A 1OFHA 1W5SA 3WHLA 3M0EA 4FWGA 1FNNA 4LCBA 3UK6A 4JN6A 3R8FA 2KRKA 5FTMA 1IY0A 3ZH9B 4LRSA 4Z8XA 2HCBA 1XXHA 1JQJC 2C96A 5EP4A 3CF0A 1DO0A 4LJ7A 4D80A 3U60B 2C9CA 1SXJA 3VFDA 1E94E 1IY2A 4LJ4A 3GLHB 4KODA 2ZANA 2BJWA 2R65A 5JI3E 2BJVA 2DHRA 1SXJE 4LY6A 4EIWA 3GLGA 3K1JA 3U5ZB 1C1KA 2XSZA 3PVSA 1D2NA 4FWHA 4QHTA 2QZ4A 2VIIA 3AJIB 1NY6A 3VLFB 1HT1E 1JR3D 1X37A 5EP2A 3EIHA 2DZOB 1IXSB 5C18A 2CE7A 1R7RA 1E32A 5EXSA 1R6BX 4D82A 2Z4RA 3H4MA 1KSFX 3GLFB 5FTNA 1IN8A 1QZMA 4LJ9A 5EXPA 2DZNB 2DVWB 1OJLA 3CF2A 5JI2E 4I81A 3U61B 5FTKA 2X8AA 4FCWA 4LRTA 4LJ6A 1IN6A 2ZAMA 1IY1A 3M6AA 5C1BA 3GLFA 2CEAA 1LV7A 5EP3A 1QVRA 5EP1A 1OFIA 2QP9X 1J7KA 2QENA 4LJ8A 1NVMA 2CHVA 4FCVA 4I4LA 1UM8A 2C98A 2CHQA 4QOSA 3EIEA 2CHGA 3GLGB 3KW6A 3HWSA 1NJGA 3PFIA 3B9PA 1L8QA 4QNRA 1JR3A 4A3VB 4LJAA 3HU3A 1SXJB 3MHVC 3KDSE 4GITA 1NSFA 4FCTA 4FD2A 4QNMA 3D8BA 2R62A 5EQTA 1SXJD 4LGMA 1SXJC 2C9OA 5EXXA 2QBYA 1HT2E
chains in the Genus database with same CATH superfamily
4WW0A 3W67A 3KP1E 4YY3M 2GNOA 3GLHA 1S3SA 3RGSA 1N77A 4IBBA 4L4UA 4B7HA 1R2YA 3HU1A 3KXEC 4M9ZA 3E46A 4ZPXA 2Z3XA 1XXHB 1I4WA 3SYLA 3MMPA 1OAIA 5FTKA 4KHPM 1G3IA 4DV5M 1VEKA 2D7HA 1KYIA 4B3RM 4LFCM 3TL4X 2EA0A 1C7YA 4L16A 4DR2M 3WHLA 1VEGA 4M9XA 4B7GA 2DZLA 2HKJA 2KNAA 3HJSA 4B08A 3UK6A 4GIPA 3R8FA 5GKNA 5FTMA 4JI0M 2VF7A 1YSYA 2ZBKB 4MH0E 2EKFA 4BLCA 4DV6M 1F4IA 4GHAA 1E9SA 5EP4A 3U6CA 1WJ7A 3FUWA 1K3XA 3U60B 2C9CA 4Z6YA 4DV0M 3F92A 2I7NA 5FLXS 1XXHE 1E94E 1VQ1A 2QNJA 3J81S 1NHWC 4MGZE 2CV2A 5JI3E 4W5WA 2XZFA 5ITQA 3SATA 2DHRA 4LY6A 3J80S 1VDDA 4EIWA 1N78A 2J5YA 4JI6M 1L2BA 2QZ4A 2J7NA 1WR1B 2KNZA 3VDUA 4XBOA 1QQWA 4RF1A 2JY5A 1OTRA 2HHHM 2JWSA 1HT1E 1N36M 3EIHA 1GKIA 2DZOB 2LVQD 2L4EA 3IG5A 2FE8A 1FJGM 2K6BA 1ORYB 3GRRA 3I4YA 4NXMM 4BB9A 2DKLA 4IBKA 3SBJA 1R4GA 2LVNC 2YNMD 2DWLA 5L8RF 3LQQA 3QWLA 3AKZA 1IN8A 2N35A 3RFWA 5ITXA 3CTWB 4LJ9A 5EXPA 5KPZA 2Z7JA 4X64M 1G8PA 1RU3A 2UUBM 2EUCA 3LW5F 2Y0QA 3J7BA 4I5SA 4OW0A 2H5XA 3U61B 4GEWA 1ZMUA 2YQZA 2X49A 2Y21A 1QAOA 1QYRA 4LRTA 3QYEA 1V92A 4DR6M 4R3DA 2ZAMA 1IY1A 4F2LA 4DR5M 4IBIA 5IREB 3B7ZA 2P5TA 1QVRA 1D0KA 2JNHA 1OFIA 3KFUG 4GC5A 4R71A 1D0LA 2CHVA 1GJSA 3VKGA 2MJ5B 2MROB 2MH8A 4QOSA 4WP2A 1YE9A 3KW6A 3FUXA 1NJGA 3PFIA 3B9PA 4QNRA 4HLQA 3J2PB 2OQ4A 3U6PA 4CIZA 3AOGA 4RKUF 3FTFA 2JA2A 3MHVC 1Z5CA 3KDSE 5EJCA 4IJEA 1PJSA 5KQDA 3M7GA 4IBCA 1YUBA 3NBXX 4FD2A 1TR8A 1TH4A 2BWEA 2R62A 3SFZA 3SAVA 4MGKE 3L29A 4NL4H 5IWAM 1Q3BA 2JUJA 3KP0E 1XMOM 1GABA 3GQ3A 2DHYA 2QBYA 1XMQM 4X65M 3TWMA 2XEPA 2J7OA 4L15A 4IJFA 3IECA 1PJJA 2C99A 3PXGA 1IN4A 1NNUC 2RKOA 2V6ZM 3MJ5A 4UN2B 4AQYM 1QDRA 3LVVA 3T6PA 4QHSA 4B7FA 1N75A 2KZUA 3GLHE 3HY5A 4P16A 4PT5A 3GPYA 1HR0M 1IBMM 4AKIA 3PNYA 2G3QA 2G8LA 2R4JA 4LZJA 3SARA 2JP7A 1L1ZA 4PDIA 1HQCA 2G5GX 2QQ8A 1Z5BA 4FWDA 2Z4SA 1ZMVA 5FTJA 3SYKA 3THGA 2QHOB 2QBYB 4NXNM 3VK8A 2FNAA 4B3TM 2ZAOA 2OPFA 1NHGC 1FNNA 3KOWE 3GPPA 5DNYA 1ZV1A 3U6OA 1IY0A 5H37D 2K0BX 4LRSA 2AHMA 2O01F 4JXJA 1L2DA 2C96A 2K9DA 4GKJM 2A5YB 3CF0A 2CUZA 3B7QA 3HJ8A 2L7HA 1WGLA 2LH0A 2NQ8C 3GLGE 3KOYE 3VFDA 1DGGA 5IT9S 3E4RA 4NSOB 1UFZA 2Q2EB 2R65A 3FUVA 3TQSA 2BJVA 2L6OA 3W68A 4CGYB 5DFLA 3U60A 1K3WA 3L25A 3GLGA 1QAQA 1GO5A 3K1JA 3KS8A 2JY7A 1MU5A 2XSZA 2OO9A 3B7NA 3BXWA 3DA1A 4XK8F 3FE3A 4LF4M 3C58A 3TPZA 1DGHB 3VLFB 1GL7A 4G4NA 3NWLA 3PNVA 4OX9M 1PM5A 4M9SA 1QUSA 5C18A 1WHCA 4K0KM 4GHLA 1E32A 1H6UA 2KRUA 4DR4M 2LHGA 5KPRA 4B3MM 3GLFB 3A42A 1VDLA 4B3SM 2L2DA 2I7PA 3GPXA 5FTNA 2OOBA 1QZMA 3C9PA 1I94M 1XNRM 1K82A 3SAUA 4DV2M 2XF3A 4M0WA 4MGYE 2R0IA 3CF2A 1TDHA 1QUTA 3GPUA 3D8LA 4I81A 4DV1M 2XH9A 2Y0TA 4OVZB 2EJSA 1Z59A 3NBIA 2L7IA 4R7GA 1JB0F 1L1TA 3L27A 4LJ6A 2XLJA 1IN6A 2JY8A 4NRWA 3R9XB 1N33M 5C1BA 3VKHA 3T38A 1DGBA 3UJNA 5EP1A 1ZQ9A 1MJGM 3W0FA 4LJ8A 1VEJA 3T1HM 3FTEA 2ZTCA 1R2ZA 1WGNA 1T3TA 1V34A 2L09A 3A45A 3GRYA 2KHHA 4FCVA 4I4LA 3W0LB 4GRIA 2K47A 3GLFE 4DUZM 4DV4M 1OIPA 3GLGB 1DV0A 2R44A 4HEOA 3L26A 4AKGA 2LHCA 4A3VB 1Q39A 4RNAA 4LGYA 4G4QA 4CISA 1SXJB 3FTDA 4FVMA 3SHFA 1Q3CA 4IBGA 4GITA 4AI6A 1NSFA 2EO2A 4FCTA 4AZFA 2WZJA 3SMSA 3U6QA 2RRUA 1NV9A 3LQRA 4LGMA 1SXJC 3ZCBB 1QZEA 5EXXA 3U6DA 4IIWA 5FSWA 1XC8A 3LMMA 2UUAM 1IXRC 5FTLA 4LJ5A 2XSZD 4DV7M 4DR1M 2F5NA 1IQPA 4HL4A 3GQ4A 5IZ7D 5ITUA 2HWJA 2F5SA 2JZ0A 5F3WA 2QPAA 3BOSA 2B3TA 3GLIA 1KFVA 3DOAA 3QYBA 3VDPA 1XWIA 2LBCA 2MGWA 3TE6A 1L2CA 2LVOC 1IN7A 1IM2A 4Q7JA 3GLIE 3U6LA 4L8RC 1DO2A 3FUUA 2JZ1A 1T43A 2CWBA 2MR9A 3HHWA 3SC3A 2EKKA 3WHKA 1HQYE 2APLA 1G4AE 3FKEA 5DYIA 4D81A 3DZDA 4LG2A 2DWZB 1OFHA 1W5SA 4GH9A 3VK7A 1QAMA 4II7A 1YLAA 4JN6A 1XB2B 2WSCF 3ZH9B 3K8ZA 2W82A 3DFZA 2FFJA 4CHTB 3E21A 3FTCA 4G6ZA 3IG8A 1P3QQ 4LJ7A 4D80A 2DNAA 3HKPA 1CUKA 4L6V6 4ANRA 4QOZC 2R46A 4IBEA 4LJ4A 3C3EA 4S12A 4L78A 4PCZA 1SXJE 3L28A 4JI5M 4MGIE 4DV3M 4LFAM 4QHTA 1D2NA 3SASA 4JI4M 2ZM6M 2VIIA 4NC6A 3AJIB 4P17A 3GRVA 4LF7M 1X37A 5EP2A 3JR4A 4G4OA 2UXDM 3T15A 3JR5A 1TDZA 2CE7A 1R7RA 5KO3A 4MB7A 5EXSA 2F5PA 1QANA 2LVAA 3GP1A 3OTOM 4AKHA 3FYCA 2Z4RA 3HGIA 1KSFX 1ZMWA 3CGWA 4GKKM 8CATA 2R18A 1Z6TA 1XNQM 1LTMA 3L2AA 2KZSA 4JI2M 5E6JA 2UXCM 2DZNB 2DAMA 2X4AA 3LCVB 4OVZA 1AUAA 2GQFA 2BWBA 4DR3M 1EIJA 4JI1M 4IBFA 1ZAEA 2DAGA 1BVSA 4I8OA 1AIPC 1PJTA 2KEBA 3KOZE 3Q8GA 1NNJA 4JI3M 2O5RA 1T6OA 4LFBM 4NRVA 4BBAA 2E5LM 1TH2A 3SMPA 3AOEC 3M6AA 1HJPA 3GLFA 2CEAA 2CFOA 2XZUA 3J7AS 1LV7A 3I01M 5EP3A 4KT0F 2QP9X 4CJ6A 3SAWA 1HNZM 1TTEA 2QSFX 3HHYA 3T1YM 2F4VM 1NVMA 3U6MA 3AL0C 2DI0A 4G3OA 2C98A 4Y28F 3UZUA 3U6EA 3I4VA 4X66M 1EE8A 2R4EA 1L8QA 1JR3A 2KDLA 2VF8A 3AV0A 3HZJA 1PJQA 4LJAA 3HX3A 2VQFM 1GLNA 1SG9A 4AG6A 2ZTDA 3V76A 1Z5AA 2M60A 2KNVA 3KVWA 2M5ZA 7CATA 3D8BA 3JAMS 3H4JA 5EQTA 5A2QS 5LMUM 3HHZA 1GJTA 1TF0B 3TWKA 1OKSA 2CP8A 1HNWM 4YHHM 2HL7A 4JI7M 3C3DA 1TH3A 2UU9M 1J5EM 1HT2E 1E9RA 1IFYA 4REZA 3FD9A 4PDGA 2R45A 2CV1A 1V33A 2V1UA 4PD2A 3KSJA 4KO8A 5KQ8A 2KW0A 1NY5A 4M0DA 4LZZA 4FW9A 3K92A 5DYGA 4IBDA 3U5ZA 1G59A 4JYAM 5EXTA 1IXZA 2KA6B 3GQ5A 1G41A 5ITYA 5ITTA 4KLNA 3GLIB 1DGHA 4AW4A 1J09A 5JI2E 1NJFA 1W5TA 2DENA 1IN5A 4NSRA 2O25A 2DWNA 1OQYA 2WSEF 2V1CA 2UUCM 2VQEM 2LVPC 3HU2A 1MX0A 2RGOA 3M0EA 3QAUA 2XFTA 4FWGA 4LCBA 2FS1A 2KRKA 4TUWA 1OIZA 4Z8XA 1HNXM 2HCBA 1XXHA 2QCUA 1JQJC 2CV0A 3LVWA 1R5LA 3UMMA 4AG5A 5ITXE 2DWMA 4NOOB 1DO0A 2XGNA 2UXBM 1SXJA 2H1RA 2L4FA 2R6FA 5E26A 3U6SA 1PRBA 4MM3B 3RE8A 1IY2A 2KXEA 1WIVA 3GLHB 4KODA 2ZANA 2BJWA 3ZC7B 4GC9A 1N34M 3I04M 1VG5A 2LWXA 4DUYM 3U5ZB 3GRUA 2JY6B 4G4RA 1C1KA 1PGYA 3AFHA 3HHXA 3PVSA 4FWHA 2OOAA 2C5RA 1EFUB 2FH0A 2YFQA 3KOXE 1NY6A 1JR3D 3K9OA 1IXSB 1XHBA 3ZQJA 3ILKA 1NV8A 4F1IA 3A98B 1R6BX 4D82A 1DGFA 2DAIA 3MK6A 2F5QA 2RGHA 5BR8M 1JR3E 3H4MA 2HAKA 2WSFF 1GVNA 5BPVA 3UGJA 2Z8YM 4X62M 2D7GA 3A46A 1IBKM 3KS4A 3U61A 3FRIA 3K9PA 4DR7M 4RF0A 4IBJA 2F5OA 2DVWB 2Y20A 4JV5M 1OJLA 2LTUA 4GMQA 2D7EA 1WXQA 2X8AA 4LF8M 3LCUA 3CF6E 3FRHA 4DBGB 4FCWA 4LF5M 4OU7A 2YR0A 3B89A 3E9SA 3J27B 2DXIA 5KPTA 1IBLM 3AOEA 2JXNA 1J7KA 2QENA 3Q8XA 3FUTA 3TWLA 2DAEA 3B74A 1UM8A 3HJQA 1PJIA 2VDBB 4LF6M 2CHQA 1N32M 2FOIC 3EIEA 3I51A 2CHGA 1QDTA 3FYDA 1D0MA 3HWSA 1OAOC 2BNKA 3KSXA 1MN3A 4WURA 1G71A 1A5TA 1NO1A 3K2LA 3HU3A 3GO8A 3SHGB 4LF9M 2XFSA 3IHPA 1GL6A 4QNMA 4XGIA 3RGPA 3BBZA 1IXSA 2LNHC 1SXJD 1Q02A 2CRUA 4ITQA 5ITRA 4JI8M 2C9OA 1TGUA 1Y8GA 2ERCA 5LMNM 2LXEA 2DAKA 4MGHA
chains in the Genus database with same CATH topology
4WW0A 3KP1E 4YY3M 3GLHA 1S3SA 3RGSA 4IBBA 4L4UA 4B7HA 1R2YA 3HU1A 3KXEC 4M9ZA 4ZPXA 2Z3XA 1XXHB 1I4WA 3SYLA 5FTKA 4KHPM 1G3IA 4DV5M 2D7HA 4B3RM 1KYIA 4LFCM 3TL4X 2EA0A 4L16A 4DR2M 3WHLA 4B7GA 4M9XA 3HJSA 2HKJA 4B08A 3UK6A 4GIPA 3R8FA 5GKNA 5FTMA 4JI0M 2ZBKB 1YSYA 4MH0E 4BLCA 4DV6M 4GHAA 1E9SA 5EP4A 3U6CA 3FUWA 1K3XA 3U60B 2C9CA 4Z6YA 4DV0M 2I7NA 5FLXS 3J81S 1E94E 1NHWC 4MGZE 2CV2A 5JI3E 4W5WA 2XZFA 5ITQA 3SATA 2DHRA 4LY6A 3J80S 1VDDA 4EIWA 1N78A 4JI6M 1L2BA 2QZ4A 2J7NA 3VDUA 4XBOA 1QQWA 4RF1A 2HHHM 1N36M 1HT1E 3EIHA 1GKIA 2DZOB 3IG5A 1FJGM 2FE8A 1ORYB 3GRRA 3I4YA 4NXMM 4BB9A 4IBKA 3SBJA 2DWLA 2YNMD 3LQQA 3QWLA 3AKZA 1IN8A 3RFWA 5ITXA 3CTWB 4LJ9A 5EXPA 5KPZA 2Z7JA 4X64M 1G8PA 2UUBM 2EUCA 4I5SA 2Y0QA 3J7BA 4OW0A 3U61B 2YQZA 2X49A 2Y21A 1QAOA 1QYRA 4LRTA 4DR6M 4R3DA 2ZAMA 1IY1A 4DR5M 4IBIA 5IREB 2P5TA 1QVRA 1OFIA 3KFUG 4GC5A 2CHVA 3VKGA 4QOSA 1YE9A 3KW6A 3FUXA 1NJGA 3PFIA 3B9PA 4QNRA 4HLQA 3J2PB 2OQ4A 3U6PA 3FTFA 3AOGA 2JA2A 3MHVC 1Z5CA 3KDSE 5EJCA 4IJEA 5KQDA 3M7GA 4IBCA 1YUBA 4FD2A 1TH4A 2R62A 3SFZA 3SAVA 4MGKE 3L29A 4NL4H 5IWAM 1Q3BA 3KP0E 1XMOM 3GQ3A 2QBYA 1XMQM 4X65M 3TWMA 2XEPA 2J7OA 4L15A 4IJFA 1PJJA 2C99A 3PXGA 1IN4A 1NNUC 2RKOA 2V6ZM 3MJ5A 4AQYM 3LVVA 4B7FA 4QHSA 1N75A 2KZUA 4P16A 4PT5A 3GPYA 1HR0M 1IBMM 4AKIA 3PNYA 2G8LA 2R4JA 4LZJA 3SARA 1L1ZA 4PDIA 1HQCA 2G5GX 1Z5BA 4FWDA 2Z4SA 5FTJA 3SYKA 3THGA 2QBYB 4B3TM 4NXNM 3VK8A 2FNAA 2ZAOA 2OPFA 1NHGC 1FNNA 3KOWE 3GPPA 5DNYA 3U6OA 1IY0A 5H37D 4LRSA 2AHMA 4JXJA 1L2DA 2C96A 4GKJM 2A5YB 3CF0A 2CUZA 3HJ8A 2L7HA 2NQ8C 2LH0A 3KOYE 3VFDA 1DGGA 5IT9S 3E4RA 4NSOB 3TQSA 2Q2EB 2R65A 3FUVA 4CGYB 2BJVA 2L6OA 3U60A 1K3WA 3L25A 3GLGA 1QAQA 3K1JA 3KS8A 1MU5A 2XSZA 3DA1A 4LF4M 3C58A 3TPZA 1DGHB 3VLFB 1GL7A 4G4NA 3NWLA 3PNVA 4OX9M 1PM5A 4M9SA 5C18A 4K0KM 4GHLA 1E32A 1H6UA 2KRUA 4DR4M 5KPRA 4B3MM 3GLFB 3A42A 4B3SM 3GPXA 2I7PA 5FTNA 1I94M 1QZMA 1XNRM 1K82A 3SAUA 4DV2M 2XF3A 4M0WA 4MGYE 3CF2A 3GPUA 1TDHA 4DV1M 3D8LA 4I81A 2XH9A 2Y0TA 4OVZB 1Z59A 3NBIA 2L7IA 4R7GA 1L1TA 3L27A 4LJ6A 2XLJA 1IN6A 1N33M 4NRWA 3R9XB 3VKHA 5C1BA 3T38A 1DGBA 3UJNA 5EP1A 1ZQ9A 3W0FA 4LJ8A 3T1HM 3FTEA 1R2ZA 1T3TA 3A45A 2L09A 4FCVA 4I4LA 3GRYA 3W0LB 4DUZM 4GRIA 2K47A 4DV4M 3GLGB 3L26A 4AKGA 4A3VB 1Q39A 4RNAA 4LGYA 4G4QA 4CISA 1SXJB 3FTDA 4FVMA 3SHFA 1Q3CA 4IBGA 4GITA 4AI6A 1NSFA 2EO2A 4FCTA 4AZFA 3SMSA 3U6QA 3LQRA 4LGMA 1SXJC 3ZCBB 5EXXA 3U6DA 4IIWA 5FSWA 1XC8A 3LMMA 2UUAM 1IXRC 5FTLA 4LJ5A 2XSZD 4DV7M 4DR1M 2F5NA 1IQPA 4HL4A 3GQ4A 5IZ7D 5ITUA 2F5SA 5F3WA 2QPAA 3BOSA 3GLIA 1KFVA 3DOAA 3VDPA 1XWIA 3TE6A 1L2CA 3U6LA 1IN7A 1IM2A 4L8RC 1DO2A 3FUUA 3WHKA 3HHWA 3SC3A 1N77A 1HQYE 1G4AE 3FKEA 5DYIA 4D81A 3DZDA 4LG2A 2DWZB 1OFHA 1W5SA 4GH9A 3VK7A 1QAMA 4II7A 4JN6A 3ZH9B 3K8ZA 2W82A 3DFZA 2FFJA 4CHTB 3FTCA 4G6ZA 3IG8A 4LJ7A 4D80A 3HKPA 4QOZC 2R46A 4IBEA 4LJ4A 4S12A 4L78A 4PCZA 1SXJE 3L28A 4JI5M 4MGIE 4DV3M 4LFAM 4QHTA 1D2NA 3SASA 4JI4M 2ZM6M 2VIIA 3AJIB 3GRVA 4LF7M 1X37A 5EP2A 3JR4A 4G4OA 2UXDM 3T15A 3JR5A 1TDZA 2CE7A 1R7RA 5KO3A 4MB7A 5EXSA 2F5PA 1QANA 3GP1A 3OTOM 4AKHA 3FYCA 2Z4RA 3HGIA 1KSFX 4GKKM 8CATA 2R18A 1Z6TA 1XNQM 3L2AA 2KZSA 4JI2M 5E6JA 2UXCM 2DZNB 2X4AA 4OVZA 4DR3M 4JI1M 4IBFA 1ZAEA 4I8OA 2KEBA 3KOZE 1NNJA 4JI3M 2O5RA 4LFBM 4NRVA 4BBAA 2E5LM 1TH2A 3SMPA 3AOEC 3M6AA 3GLFA 2CEAA 2CFOA 2XZUA 3J7AS 1LV7A 5EP3A 2QP9X 3SAWA 1HNZM 3HHYA 2F4VM 3T1YM 1NVMA 3U6MA 3AL0C 2C98A 3UZUA 3U6EA 3I4VA 4X66M 1EE8A 1L8QA 2R4EA 1JR3A 3AV0A 4LJAA 2VQFM 1GLNA 4AG6A 1Z5AA 2M60A 3KVWA 2M5ZA 7CATA 3D8BA 3JAMS 5A2QS 5EQTA 5LMUM 3HHZA 3TWKA 1HNWM 4YHHM 2HL7A 4JI7M 1TH3A 2UU9M 1J5EM 1HT2E 1E9RA 4REZA 3FD9A 4PDGA 2R45A 2CV1A 2V1UA 4PD2A 3KSJA 4KO8A 5KQ8A 2KW0A 1NY5A 4M0DA 4LZZA 4FW9A 3K92A 5DYGA 4IBDA 3U5ZA 1G59A 4JYAM 5EXTA 1IXZA 2KA6B 3GQ5A 1G41A 5ITYA 5ITTA 4KLNA 3GLIB 1DGHA 4AW4A 1J09A 5JI2E 1NJFA 1W5TA 1IN5A 4NSRA 2DWNA 2UUCM 2V1CA 2VQEM 3HU2A 1MX0A 2RGOA 3M0EA 3QAUA 2XFTA 4FWGA 4LCBA 2KRKA 4TUWA 4Z8XA 1HNXM 2HCBA 1XXHA 2QCUA 1JQJC 2CV0A 3LVWA 3UMMA 5ITXE 4AG5A 2DWMA 4NOOB 1DO0A 2XGNA 2UXBM 1SXJA 2H1RA 3U6SA 5E26A 4MM3B 3RE8A 1IY2A 2KXEA 3GLHB 4KODA 2ZANA 2BJWA 3ZC7B 4GC9A 1N34M 2LWXA 4DUYM 3U5ZB 3GRUA 4G4RA 1C1KA 3AFHA 3PVSA 2C5RA 4FWHA 2YFQA 3KOXE 1NY6A 1JR3D 1IXSB 1XHBA 3ILKA 3A98B 1R6BX 4D82A 1DGFA 3MK6A 2F5QA 2RGHA 5BR8M 3H4MA 1GVNA 5BPVA 3UGJA 4X62M 2D7GA 3A46A 1IBKM 3KS4A 3U61A 4DR7M 4RF0A 4IBJA 2F5OA 2DVWB 2Y20A 4JV5M 1OJLA 4GMQA 2D7EA 1WXQA 2X8AA 4LF8M 3CF6E 4FCWA 4LF5M 4OU7A 2YR0A 3E9SA 3J27B 2DXIA 5KPTA 1IBLM 3AOEA 1J7KA 2QENA 3Q8XA 3FUTA 3TWLA 1PJIA 1UM8A 3HJQA 4LF6M 1N32M 2CHQA 2FOIC 3EIEA 3I51A 2CHGA 3HWSA 3FYDA 4WURA 2BNKA 3KSXA 3K2LA 3GO8A 3HU3A 3SHGB 4LF9M 2XFSA 1GL6A 4QNMA 4XGIA 3RGPA 2LNHC 1SXJD 4ITQA 5ITRA 4JI8M 2C9OA 1TGUA 2ERCA 5LMNM 2LXEA 3HHXA 4MGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WW0 A;  4L15 A;  1IXR C;  5FTL A;  4LJ5 A;  2XSZ D;  3GLH A;  1S3S A;  1IQP A;  2C99 A;  3PXG A;  2V1U A;  1IN4 A;  2RKO A;  4L4U A;  4KO8 A;  2V6Z M;  2QPA A;  1NY5 A;  3BOS A;  3HU1 A;  4FW9 A;  4LZZ A;  4QHS A;  5DYG A;  3GLI A;  1XWI A;  4ZPX A;  5EXT A;  1IXZ A;  1XXH B;  3SYL A;  1G41 A;  3GLI B;  4KLN A;  1IN7 A;  1IM2 A;  1HQC A;  1G3I A;  4FWD A;  1NJF A;  1W5T A;  2Z4S A;  5FTJ A;  1IN5 A;  1DO2 A;  3SYK A;  1KYI A;  3WHK A;  2QBY B;  2FNA A;  3SC3 A;  1HQY E;  1G4A E;  5DYI A;  2ZAO A;  4D81 A;  3DZD A;  2DWZ B;  4L16 A;  3HU2 A;  1OFH A;  1W5S A;  3WHL A;  3M0E A;  4FWG A;  1FNN A;  4LCB A;  3UK6 A;  4JN6 A;  3R8F A;  2KRK A;  5FTM A;  1IY0 A;  3ZH9 B;  4LRS A;  4Z8X A;  2HCB A;  1XXH A;  1JQJ C;  2C96 A;  5EP4 A;  3CF0 A;  1DO0 A;  4LJ7 A;  4D80 A;  3U60 B;  2C9C A;  1SXJ A;  3VFD A;  1E94 E;  1IY2 A;  4LJ4 A;  3GLH B;  4KOD A;  2ZAN A;  2BJW A;  2R65 A;  5JI3 E;  2BJV A;  2DHR A;  1SXJ E;  4LY6 A;  4EIW A;  3GLG A;  3K1J A;  3U5Z B;  1C1K A;  2XSZ A;  3PVS A;  1D2N A;  4FWH A;  4QHT A;  2QZ4 A;  2VII A;  3AJI B;  1NY6 A;  3VLF B;  1HT1 E;  1JR3 D;  1X37 A;  5EP2 A;  3EIH A;  2DZO B;  1IXS B;  5C18 A;  2CE7 A;  1R7R A;  1E32 A;  5EXS A;  1R6B X;  4D82 A;  2Z4R A;  3H4M A;  1KSF X;  3GLF B;  5FTN A;  1IN8 A;  1QZM A;  4LJ9 A;  5EXP A;  2DZN B;  2DVW B;  1OJL A;  3CF2 A;  5JI2 E;  4I81 A;  3U61 B;  5FTK A;  2X8A A;  4FCW A;  4LRT A;  4LJ6 A;  1IN6 A;  2ZAM A;  1IY1 A;  3M6A A;  5C1B A;  3GLF A;  2CEA A;  1LV7 A;  5EP3 A;  1QVR A;  5EP1 A;  1OFI A;  2QP9 X;  1J7K A;  2QEN A;  4LJ8 A;  1NVM A;  2CHV A;  4FCV A;  4I4L A;  1UM8 A;  2C98 A;  2CHQ A;  4QOS A;  3EIE A;  2CHG A;  3GLG B;  3KW6 A;  3HWS A;  1NJG A;  3PFI A;  3B9P A;  1L8Q A;  4QNR A;  1JR3 A;  4A3V B;  4LJA A;  3HU3 A;  1SXJ B;  3MHV C;  3KDS E;  4GIT A;  1NSF A;  4FCT A;  4FD2 A;  4QNM A;  3D8B A;  2R62 A;  5EQT A;  1SXJ D;  4LGM A;  1SXJ C;  2C9O A;  5EXX A;  2QBY A;  1HT2 E; 
#chains in the Genus database with same CATH topology
 4WW0 A;  3W67 A;  3KP1 E;  4YY3 M;  2GNO A;  3GLH A;  1S3S A;  3RGS A;  1N77 A;  4IBB A;  4L4U A;  4B7H A;  1R2Y A;  3HU1 A;  3KXE C;  4M9Z A;  3E46 A;  4ZPX A;  2Z3X A;  1XXH B;  1I4W A;  3SYL A;  3MMP A;  1OAI A;  5FTK A;  4KHP M;  1G3I A;  4DV5 M;  1VEK A;  2D7H A;  1KYI A;  4B3R M;  4LFC M;  3TL4 X;  2EA0 A;  1C7Y A;  4L16 A;  4DR2 M;  3WHL A;  1VEG A;  4M9X A;  4B7G A;  2DZL A;  2HKJ A;  2KNA A;  3HJS A;  4B08 A;  3UK6 A;  4GIP A;  3R8F A;  5GKN A;  5FTM A;  4JI0 M;  2VF7 A;  1YSY A;  2ZBK B;  4MH0 E;  2EKF A;  4BLC A;  4DV6 M;  1F4I A;  4GHA A;  1E9S A;  5EP4 A;  3U6C A;  1WJ7 A;  3FUW A;  1K3X A;  3U60 B;  2C9C A;  4Z6Y A;  4DV0 M;  3F92 A;  2I7N A;  5FLX S;  1XXH E;  1E94 E;  1VQ1 A;  2QNJ A;  3J81 S;  1NHW C;  4MGZ E;  2CV2 A;  5JI3 E;  4W5W A;  2XZF A;  5ITQ A;  3SAT A;  2DHR A;  4LY6 A;  3J80 S;  1VDD A;  4EIW A;  1N78 A;  2J5Y A;  4JI6 M;  1L2B A;  2QZ4 A;  2J7N A;  1WR1 B;  2KNZ A;  3VDU A;  4XBO A;  1QQW A;  4RF1 A;  2JY5 A;  1OTR A;  2HHH M;  2JWS A;  1HT1 E;  1N36 M;  3EIH A;  1GKI A;  2DZO B;  2LVQ D;  2L4E A;  3IG5 A;  2FE8 A;  1FJG M;  2K6B A;  1ORY B;  3GRR A;  3I4Y A;  4NXM M;  4BB9 A;  2DKL A;  4IBK A;  3SBJ A;  1R4G A;  2LVN C;  2YNM D;  2DWL A;  5L8R F;  3LQQ A;  3QWL A;  3AKZ A;  1IN8 A;  2N35 A;  3RFW A;  5ITX A;  3CTW B;  4LJ9 A;  5EXP A;  5KPZ A;  2Z7J A;  4X64 M;  1G8P A;  1RU3 A;  2UUB M;  2EUC A;  3LW5 F;  2Y0Q A;  3J7B A;  4I5S A;  4OW0 A;  2H5X A;  3U61 B;  4GEW A;  1ZMU A;  2YQZ A;  2X49 A;  2Y21 A;  1QAO A;  1QYR A;  4LRT A;  3QYE A;  1V92 A;  4DR6 M;  4R3D A;  2ZAM A;  1IY1 A;  4F2L A;  4DR5 M;  4IBI A;  5IRE B;  3B7Z A;  2P5T A;  1QVR A;  1D0K A;  2JNH A;  1OFI A;  3KFU G;  4GC5 A;  4R71 A;  1D0L A;  2CHV A;  1GJS A;  3VKG A;  2MJ5 B;  2MRO B;  2MH8 A;  4QOS A;  4WP2 A;  1YE9 A;  3KW6 A;  3FUX A;  1NJG A;  3PFI A;  3B9P A;  4QNR A;  4HLQ A;  3J2P B;  2OQ4 A;  3U6P A;  4CIZ A;  3AOG A;  4RKU F;  3FTF A;  2JA2 A;  3MHV C;  1Z5C A;  3KDS E;  5EJC A;  4IJE A;  1PJS A;  5KQD A;  3M7G A;  4IBC A;  1YUB A;  3NBX X;  4FD2 A;  1TR8 A;  1TH4 A;  2BWE A;  2R62 A;  3SFZ A;  3SAV A;  4MGK E;  3L29 A;  4NL4 H;  5IWA M;  1Q3B A;  2JUJ A;  3KP0 E;  1XMO M;  1GAB A;  3GQ3 A;  2DHY A;  2QBY A;  1XMQ M;  4X65 M;  3TWM A;  2XEP A;  2J7O A;  4L15 A;  4IJF A;  3IEC A;  1PJJ A;  2C99 A;  3PXG A;  1IN4 A;  1NNU C;  2RKO A;  2V6Z M;  3MJ5 A;  4UN2 B;  4AQY M;  1QDR A;  3LVV A;  3T6P A;  4QHS A;  4B7F A;  1N75 A;  2KZU A;  3GLH E;  3HY5 A;  4P16 A;  4PT5 A;  3GPY A;  1HR0 M;  1IBM M;  4AKI A;  3PNY A;  2G3Q A;  2G8L A;  2R4J A;  4LZJ A;  3SAR A;  2JP7 A;  1L1Z A;  4PDI A;  1HQC A;  2G5G X;  2QQ8 A;  1Z5B A;  4FWD A;  2Z4S A;  1ZMV A;  5FTJ A;  3SYK A;  3THG A;  2QHO B;  2QBY B;  4NXN M;  3VK8 A;  2FNA A;  4B3T M;  2ZAO A;  2OPF A;  1NHG C;  1FNN A;  3KOW E;  3GPP A;  5DNY A;  1ZV1 A;  3U6O A;  1IY0 A;  5H37 D;  2K0B X;  4LRS A;  2AHM A;  2O01 F;  4JXJ A;  1L2D A;  2C96 A;  2K9D A;  4GKJ M;  2A5Y B;  3CF0 A;  2CUZ A;  3B7Q A;  3HJ8 A;  2L7H A;  1WGL A;  2LH0 A;  2NQ8 C;  3GLG E;  3KOY E;  3VFD A;  1DGG A;  5IT9 S;  3E4R A;  4NSO B;  1UFZ A;  2Q2E B;  2R65 A;  3FUV A;  3TQS A;  2BJV A;  2L6O A;  3W68 A;  4CGY B;  5DFL A;  3U60 A;  1K3W A;  3L25 A;  3GLG A;  1QAQ A;  1GO5 A;  3K1J A;  3KS8 A;  2JY7 A;  1MU5 A;  2XSZ A;  2OO9 A;  3B7N A;  3BXW A;  3DA1 A;  4XK8 F;  3FE3 A;  4LF4 M;  3C58 A;  3TPZ A;  1DGH B;  3VLF B;  1GL7 A;  4G4N A;  3NWL A;  3PNV A;  4OX9 M;  1PM5 A;  4M9S A;  1QUS A;  5C18 A;  1WHC A;  4K0K M;  4GHL A;  1E32 A;  1H6U A;  2KRU A;  4DR4 M;  2LHG A;  5KPR A;  4B3M M;  3GLF B;  3A42 A;  1VDL A;  4B3S M;  2L2D A;  2I7P A;  3GPX A;  5FTN A;  2OOB A;  1QZM A;  3C9P A;  1I94 M;  1XNR M;  1K82 A;  3SAU A;  4DV2 M;  2XF3 A;  4M0W A;  4MGY E;  2R0I A;  3CF2 A;  1TDH A;  1QUT A;  3GPU A;  3D8L A;  4I81 A;  4DV1 M;  2XH9 A;  2Y0T A;  4OVZ B;  2EJS A;  1Z59 A;  3NBI A;  2L7I A;  4R7G A;  1JB0 F;  1L1T A;  3L27 A;  4LJ6 A;  2XLJ A;  1IN6 A;  2JY8 A;  4NRW A;  3R9X B;  1N33 M;  5C1B A;  3VKH A;  3T38 A;  1DGB A;  3UJN A;  5EP1 A;  1ZQ9 A;  1MJG M;  3W0F A;  4LJ8 A;  1VEJ A;  3T1H M;  3FTE A;  2ZTC A;  1R2Z A;  1WGN A;  1T3T A;  1V34 A;  2L09 A;  3A45 A;  3GRY A;  2KHH A;  4FCV A;  4I4L A;  3W0L B;  4GRI A;  2K47 A;  3GLF E;  4DUZ M;  4DV4 M;  1OIP A;  3GLG B;  1DV0 A;  2R44 A;  4HEO A;  3L26 A;  4AKG A;  2LHC A;  4A3V B;  1Q39 A;  4RNA A;  4LGY A;  4G4Q A;  4CIS A;  1SXJ B;  3FTD A;  4FVM A;  3SHF A;  1Q3C A;  4IBG A;  4GIT A;  4AI6 A;  1NSF A;  2EO2 A;  4FCT A;  4AZF A;  2WZJ A;  3SMS A;  3U6Q A;  2RRU A;  1NV9 A;  3LQR A;  4LGM A;  1SXJ C;  3ZCB B;  1QZE A;  5EXX A;  3U6D A;  4IIW A;  5FSW A;  1XC8 A;  3LMM A;  2UUA M;  1IXR C;  5FTL A;  4LJ5 A;  2XSZ D;  4DV7 M;  4DR1 M;  2F5N A;  1IQP A;  4HL4 A;  3GQ4 A;  5IZ7 D;  5ITU A;  2HWJ A;  2F5S A;  2JZ0 A;  5F3W A;  2QPA A;  3BOS A;  2B3T A;  3GLI A;  1KFV A;  3DOA A;  3QYB A;  3VDP A;  1XWI A;  2LBC A;  2MGW A;  3TE6 A;  1L2C A;  2LVO C;  1IN7 A;  1IM2 A;  4Q7J A;  3GLI E;  3U6L A;  4L8R C;  1DO2 A;  3FUU A;  2JZ1 A;  1T43 A;  2CWB A;  2MR9 A;  3HHW A;  3SC3 A;  2EKK A;  3WHK A;  1HQY E;  2APL A;  1G4A E;  3FKE A;  5DYI A;  4D81 A;  3DZD A;  4LG2 A;  2DWZ B;  1OFH A;  1W5S A;  4GH9 A;  3VK7 A;  1QAM A;  4II7 A;  1YLA A;  4JN6 A;  1XB2 B;  2WSC F;  3ZH9 B;  3K8Z A;  2W82 A;  3DFZ A;  2FFJ A;  4CHT B;  3E21 A;  3FTC A;  4G6Z A;  3IG8 A;  1P3Q Q;  4LJ7 A;  4D80 A;  2DNA A;  3HKP A;  1CUK A;  4L6V 6;  4ANR A;  4QOZ C;  2R46 A;  4IBE A;  4LJ4 A;  3C3E A;  4S12 A;  4L78 A;  4PCZ A;  1SXJ E;  3L28 A;  4JI5 M;  4MGI E;  4DV3 M;  4LFA M;  4QHT A;  1D2N A;  3SAS A;  4JI4 M;  2ZM6 M;  2VII A;  4NC6 A;  3AJI B;  4P17 A;  3GRV A;  4LF7 M;  1X37 A;  5EP2 A;  3JR4 A;  4G4O A;  2UXD M;  3T15 A;  3JR5 A;  1TDZ A;  2CE7 A;  1R7R A;  5KO3 A;  4MB7 A;  5EXS A;  2F5P A;  1QAN A;  2LVA A;  3GP1 A;  3OTO M;  4AKH A;  3FYC A;  2Z4R A;  3HGI A;  1KSF X;  1ZMW A;  3CGW A;  4GKK M;  8CAT A;  2R18 A;  1Z6T A;  1XNQ M;  1LTM A;  3L2A A;  2KZS A;  4JI2 M;  5E6J A;  2UXC M;  2DZN B;  2DAM A;  2X4A A;  3LCV B;  4OVZ A;  1AUA A;  2GQF A;  2BWB A;  4DR3 M;  1EIJ A;  4JI1 M;  4IBF A;  1ZAE A;  2DAG A;  1BVS A;  4I8O A;  1AIP C;  1PJT A;  2KEB A;  3KOZ E;  3Q8G A;  1NNJ A;  4JI3 M;  2O5R A;  1T6O A;  4LFB M;  4NRV A;  4BBA A;  2E5L M;  1TH2 A;  3SMP A;  3AOE C;  3M6A A;  1HJP A;  3GLF A;  2CEA A;  2CFO A;  2XZU A;  3J7A S;  1LV7 A;  3I01 M;  5EP3 A;  4KT0 F;  2QP9 X;  4CJ6 A;  3SAW A;  1HNZ M;  1TTE A;  2QSF X;  3HHY A;  3T1Y M;  2F4V M;  1NVM A;  3U6M A;  3AL0 C;  2DI0 A;  4G3O A;  2C98 A;  4Y28 F;  3UZU A;  3U6E A;  3I4V A;  4X66 M;  1EE8 A;  2R4E A;  1L8Q A;  1JR3 A;  2KDL A;  2VF8 A;  3AV0 A;  3HZJ A;  1PJQ A;  4LJA A;  3HX3 A;  2VQF M;  1GLN A;  1SG9 A;  4AG6 A;  2ZTD A;  3V76 A;  1Z5A A;  2M60 A;  2KNV A;  3KVW A;  2M5Z A;  7CAT A;  3D8B A;  3JAM S;  3H4J A;  5EQT A;  5A2Q S;  5LMU M;  3HHZ A;  1GJT A;  1TF0 B;  3TWK A;  1OKS A;  2CP8 A;  1HNW M;  4YHH M;  2HL7 A;  4JI7 M;  3C3D A;  1TH3 A;  2UU9 M;  1J5E M;  1HT2 E;  1E9R A;  1IFY A;  4REZ A;  3FD9 A;  4PDG A;  2R45 A;  2CV1 A;  1V33 A;  2V1U A;  4PD2 A;  3KSJ A;  4KO8 A;  5KQ8 A;  2KW0 A;  1NY5 A;  4M0D A;  4LZZ A;  4FW9 A;  3K92 A;  5DYG A;  4IBD A;  3U5Z A;  1G59 A;  4JYA M;  5EXT A;  1IXZ A;  2KA6 B;  3GQ5 A;  1G41 A;  5ITY A;  5ITT A;  4KLN A;  3GLI B;  1DGH A;  4AW4 A;  1J09 A;  5JI2 E;  1NJF A;  1W5T A;  2DEN A;  1IN5 A;  4NSR A;  2O25 A;  2DWN A;  1OQY A;  2WSE F;  2V1C A;  2UUC M;  2VQE M;  2LVP C;  3HU2 A;  1MX0 A;  2RGO A;  3M0E A;  3QAU A;  2XFT A;  4FWG A;  4LCB A;  2FS1 A;  2KRK A;  4TUW A;  1OIZ A;  4Z8X A;  1HNX M;  2HCB A;  1XXH A;  2QCU A;  1JQJ C;  2CV0 A;  3LVW A;  1R5L A;  3UMM A;  4AG5 A;  5ITX E;  2DWM A;  4NOO B;  1DO0 A;  2XGN A;  2UXB M;  1SXJ A;  2H1R A;  2L4F A;  2R6F A;  5E26 A;  3U6S A;  1PRB A;  4MM3 B;  3RE8 A;  1IY2 A;  2KXE A;  1WIV A;  3GLH B;  4KOD A;  2ZAN A;  2BJW A;  3ZC7 B;  4GC9 A;  1N34 M;  3I04 M;  1VG5 A;  2LWX A;  4DUY M;  3U5Z B;  3GRU A;  2JY6 B;  4G4R A;  1C1K A;  1PGY A;  3AFH A;  3HHX A;  3PVS A;  4FWH A;  2OOA A;  2C5R A;  1EFU B;  2FH0 A;  2YFQ A;  3KOX E;  1NY6 A;  1JR3 D;  3K9O A;  1IXS B;  1XHB A;  3ZQJ A;  3ILK A;  1NV8 A;  4F1I A;  3A98 B;  1R6B X;  4D82 A;  1DGF A;  2DAI A;  3MK6 A;  2F5Q A;  2RGH A;  5BR8 M;  1JR3 E;  3H4M A;  2HAK A;  2WSF F;  1GVN A;  5BPV A;  3UGJ A;  2Z8Y M;  4X62 M;  2D7G A;  3A46 A;  1IBK M;  3KS4 A;  3U61 A;  3FRI A;  3K9P A;  4DR7 M;  4RF0 A;  4IBJ A;  2F5O A;  2DVW B;  2Y20 A;  4JV5 M;  1OJL A;  2LTU A;  4GMQ A;  2D7E A;  1WXQ A;  2X8A A;  4LF8 M;  3LCU A;  3CF6 E;  3FRH A;  4DBG B;  4FCW A;  4LF5 M;  4OU7 A;  2YR0 A;  3B89 A;  3E9S A;  3J27 B;  2DXI A;  5KPT A;  1IBL M;  3AOE A;  2JXN A;  1J7K A;  2QEN A;  3Q8X A;  3FUT A;  3TWL A;  2DAE A;  3B74 A;  1UM8 A;  3HJQ A;  1PJI A;  2VDB B;  4LF6 M;  2CHQ A;  1N32 M;  2FOI C;  3EIE A;  3I51 A;  2CHG A;  1QDT A;  3FYD A;  1D0M A;  3HWS A;  1OAO C;  2BNK A;  3KSX A;  1MN3 A;  4WUR A;  1G71 A;  1A5T A;  1NO1 A;  3K2L A;  3HU3 A;  3GO8 A;  3SHG B;  4LF9 M;  2XFS A;  3IHP A;  1GL6 A;  4QNM A;  4XGI A;  3RGP A;  3BBZ A;  1IXS A;  2LNH C;  1SXJ D;  1Q02 A;  2CRU A;  4ITQ A;  5ITR A;  4JI8 M;  2C9O A;  1TGU A;  1Y8G A;  2ERC A;  5LMN M;  2LXE A;  2DAK A;  4MGH A; 
#chains in the Genus database with same CATH homology
 4WW0 A;  3KP1 E;  4YY3 M;  3GLH A;  1S3S A;  3RGS A;  4IBB A;  4L4U A;  4B7H A;  1R2Y A;  3HU1 A;  3KXE C;  4M9Z A;  4ZPX A;  2Z3X A;  1XXH B;  1I4W A;  3SYL A;  5FTK A;  4KHP M;  1G3I A;  4DV5 M;  2D7H A;  4B3R M;  1KYI A;  4LFC M;  3TL4 X;  2EA0 A;  4L16 A;  4DR2 M;  3WHL A;  4B7G A;  4M9X A;  3HJS A;  2HKJ A;  4B08 A;  3UK6 A;  4GIP A;  3R8F A;  5GKN A;  5FTM A;  4JI0 M;  2ZBK B;  1YSY A;  4MH0 E;  4BLC A;  4DV6 M;  4GHA A;  1E9S A;  5EP4 A;  3U6C A;  3FUW A;  1K3X A;  3U60 B;  2C9C A;  4Z6Y A;  4DV0 M;  2I7N A;  5FLX S;  3J81 S;  1E94 E;  1NHW C;  4MGZ E;  2CV2 A;  5JI3 E;  4W5W A;  2XZF A;  5ITQ A;  3SAT A;  2DHR A;  4LY6 A;  3J80 S;  1VDD A;  4EIW A;  1N78 A;  4JI6 M;  1L2B A;  2QZ4 A;  2J7N A;  3VDU A;  4XBO A;  1QQW A;  4RF1 A;  2HHH M;  1N36 M;  1HT1 E;  3EIH A;  1GKI A;  2DZO B;  3IG5 A;  1FJG M;  2FE8 A;  1ORY B;  3GRR A;  3I4Y A;  4NXM M;  4BB9 A;  4IBK A;  3SBJ A;  2DWL A;  2YNM D;  3LQQ A;  3QWL A;  3AKZ A;  1IN8 A;  3RFW A;  5ITX A;  3CTW B;  4LJ9 A;  5EXP A;  5KPZ A;  2Z7J A;  4X64 M;  1G8P A;  2UUB M;  2EUC A;  4I5S A;  2Y0Q A;  3J7B A;  4OW0 A;  3U61 B;  2YQZ A;  2X49 A;  2Y21 A;  1QAO A;  1QYR A;  4LRT A;  4DR6 M;  4R3D A;  2ZAM A;  1IY1 A;  4DR5 M;  4IBI A;  5IRE B;  2P5T A;  1QVR A;  1OFI A;  3KFU G;  4GC5 A;  2CHV A;  3VKG A;  4QOS A;  1YE9 A;  3KW6 A;  3FUX A;  1NJG A;  3PFI A;  3B9P A;  4QNR A;  4HLQ A;  3J2P B;  2OQ4 A;  3U6P A;  3FTF A;  3AOG A;  2JA2 A;  3MHV C;  1Z5C A;  3KDS E;  5EJC A;  4IJE A;  5KQD A;  3M7G A;  4IBC A;  1YUB A;  4FD2 A;  1TH4 A;  2R62 A;  3SFZ A;  3SAV A;  4MGK E;  3L29 A;  4NL4 H;  5IWA M;  1Q3B A;  3KP0 E;  1XMO M;  3GQ3 A;  2QBY A;  1XMQ M;  4X65 M;  3TWM A;  2XEP A;  2J7O A;  4L15 A;  4IJF A;  1PJJ A;  2C99 A;  3PXG A;  1IN4 A;  1NNU C;  2RKO A;  2V6Z M;  3MJ5 A;  4AQY M;  3LVV A;  4B7F A;  4QHS A;  1N75 A;  2KZU A;  4P16 A;  4PT5 A;  3GPY A;  1HR0 M;  1IBM M;  4AKI A;  3PNY A;  2G8L A;  2R4J A;  4LZJ A;  3SAR A;  1L1Z A;  4PDI A;  1HQC A;  2G5G X;  1Z5B A;  4FWD A;  2Z4S A;  5FTJ A;  3SYK A;  3THG A;  2QBY B;  4B3T M;  4NXN M;  3VK8 A;  2FNA A;  2ZAO A;  2OPF A;  1NHG C;  1FNN A;  3KOW E;  3GPP A;  5DNY A;  3U6O A;  1IY0 A;  5H37 D;  4LRS A;  2AHM A;  4JXJ A;  1L2D A;  2C96 A;  4GKJ M;  2A5Y B;  3CF0 A;  2CUZ A;  3HJ8 A;  2L7H A;  2NQ8 C;  2LH0 A;  3KOY E;  3VFD A;  1DGG A;  5IT9 S;  3E4R A;  4NSO B;  3TQS A;  2Q2E B;  2R65 A;  3FUV A;  4CGY B;  2BJV A;  2L6O A;  3U60 A;  1K3W A;  3L25 A;  3GLG A;  1QAQ A;  3K1J A;  3KS8 A;  1MU5 A;  2XSZ A;  3DA1 A;  4LF4 M;  3C58 A;  3TPZ A;  1DGH B;  3VLF B;  1GL7 A;  4G4N A;  3NWL A;  3PNV A;  4OX9 M;  1PM5 A;  4M9S A;  5C18 A;  4K0K M;  4GHL A;  1E32 A;  1H6U A;  2KRU A;  4DR4 M;  5KPR A;  4B3M M;  3GLF B;  3A42 A;  4B3S M;  3GPX A;  2I7P A;  5FTN A;  1I94 M;  1QZM A;  1XNR M;  1K82 A;  3SAU A;  4DV2 M;  2XF3 A;  4M0W A;  4MGY E;  3CF2 A;  3GPU A;  1TDH A;  4DV1 M;  3D8L A;  4I81 A;  2XH9 A;  2Y0T A;  4OVZ B;  1Z59 A;  3NBI A;  2L7I A;  4R7G A;  1L1T A;  3L27 A;  4LJ6 A;  2XLJ A;  1IN6 A;  1N33 M;  4NRW A;  3R9X B;  3VKH A;  5C1B A;  3T38 A;  1DGB A;  3UJN A;  5EP1 A;  1ZQ9 A;  3W0F A;  4LJ8 A;  3T1H M;  3FTE A;  1R2Z A;  1T3T A;  3A45 A;  2L09 A;  4FCV A;  4I4L A;  3GRY A;  3W0L B;  4DUZ M;  4GRI A;  2K47 A;  4DV4 M;  3GLG B;  3L26 A;  4AKG A;  4A3V B;  1Q39 A;  4RNA A;  4LGY A;  4G4Q A;  4CIS A;  1SXJ B;  3FTD A;  4FVM A;  3SHF A;  1Q3C A;  4IBG A;  4GIT A;  4AI6 A;  1NSF A;  2EO2 A;  4FCT A;  4AZF A;  3SMS A;  3U6Q A;  3LQR A;  4LGM A;  1SXJ C;  3ZCB B;  5EXX A;  3U6D A;  4IIW A;  5FSW A;  1XC8 A;  3LMM A;  2UUA M;  1IXR C;  5FTL A;  4LJ5 A;  2XSZ D;  4DV7 M;  4DR1 M;  2F5N A;  1IQP A;  4HL4 A;  3GQ4 A;  5IZ7 D;  5ITU A;  2F5S A;  5F3W A;  2QPA A;  3BOS A;  3GLI A;  1KFV A;  3DOA A;  3VDP A;  1XWI A;  3TE6 A;  1L2C A;  3U6L A;  1IN7 A;  1IM2 A;  4L8R C;  1DO2 A;  3FUU A;  3WHK A;  3HHW A;  3SC3 A;  1N77 A;  1HQY E;  1G4A E;  3FKE A;  5DYI A;  4D81 A;  3DZD A;  4LG2 A;  2DWZ B;  1OFH A;  1W5S A;  4GH9 A;  3VK7 A;  1QAM A;  4II7 A;  4JN6 A;  3ZH9 B;  3K8Z A;  2W82 A;  3DFZ A;  2FFJ A;  4CHT B;  3FTC A;  4G6Z A;  3IG8 A;  4LJ7 A;  4D80 A;  3HKP A;  4QOZ C;  2R46 A;  4IBE A;  4LJ4 A;  4S12 A;  4L78 A;  4PCZ A;  1SXJ E;  3L28 A;  4JI5 M;  4MGI E;  4DV3 M;  4LFA M;  4QHT A;  1D2N A;  3SAS A;  4JI4 M;  2ZM6 M;  2VII A;  3AJI B;  3GRV A;  4LF7 M;  1X37 A;  5EP2 A;  3JR4 A;  4G4O A;  2UXD M;  3T15 A;  3JR5 A;  1TDZ A;  2CE7 A;  1R7R A;  5KO3 A;  4MB7 A;  5EXS A;  2F5P A;  1QAN A;  3GP1 A;  3OTO M;  4AKH A;  3FYC A;  2Z4R A;  3HGI A;  1KSF X;  4GKK M;  8CAT A;  2R18 A;  1Z6T A;  1XNQ M;  3L2A A;  2KZS A;  4JI2 M;  5E6J A;  2UXC M;  2DZN B;  2X4A A;  4OVZ A;  4DR3 M;  4JI1 M;  4IBF A;  1ZAE A;  4I8O A;  2KEB A;  3KOZ E;  1NNJ A;  4JI3 M;  2O5R A;  4LFB M;  4NRV A;  4BBA A;  2E5L M;  1TH2 A;  3SMP A;  3AOE C;  3M6A A;  3GLF A;  2CEA A;  2CFO A;  2XZU A;  3J7A S;  1LV7 A;  5EP3 A;  2QP9 X;  3SAW A;  1HNZ M;  3HHY A;  2F4V M;  3T1Y M;  1NVM A;  3U6M A;  3AL0 C;  2C98 A;  3UZU A;  3U6E A;  3I4V A;  4X66 M;  1EE8 A;  1L8Q A;  2R4E A;  1JR3 A;  3AV0 A;  4LJA A;  2VQF M;  1GLN A;  4AG6 A;  1Z5A A;  2M60 A;  3KVW A;  2M5Z A;  7CAT A;  3D8B A;  3JAM S;  5A2Q S;  5EQT A;  5LMU M;  3HHZ A;  3TWK A;  1HNW M;  4YHH M;  2HL7 A;  4JI7 M;  1TH3 A;  2UU9 M;  1J5E M;  1HT2 E;  1E9R A;  4REZ A;  3FD9 A;  4PDG A;  2R45 A;  2CV1 A;  2V1U A;  4PD2 A;  3KSJ A;  4KO8 A;  5KQ8 A;  2KW0 A;  1NY5 A;  4M0D A;  4LZZ A;  4FW9 A;  3K92 A;  5DYG A;  4IBD A;  3U5Z A;  1G59 A;  4JYA M;  5EXT A;  1IXZ A;  2KA6 B;  3GQ5 A;  1G41 A;  5ITY A;  5ITT A;  4KLN A;  3GLI B;  1DGH A;  4AW4 A;  1J09 A;  5JI2 E;  1NJF A;  1W5T A;  1IN5 A;  4NSR A;  2DWN A;  2UUC M;  2V1C A;  2VQE M;  3HU2 A;  1MX0 A;  2RGO A;  3M0E A;  3QAU A;  2XFT A;  4FWG A;  4LCB A;  2KRK A;  4TUW A;  4Z8X A;  1HNX M;  2HCB A;  1XXH A;  2QCU A;  1JQJ C;  2CV0 A;  3LVW A;  3UMM A;  5ITX E;  4AG5 A;  2DWM A;  4NOO B;  1DO0 A;  2XGN A;  2UXB M;  1SXJ A;  2H1R A;  3U6S A;  5E26 A;  4MM3 B;  3RE8 A;  1IY2 A;  2KXE A;  3GLH B;  4KOD A;  2ZAN A;  2BJW A;  3ZC7 B;  4GC9 A;  1N34 M;  2LWX A;  4DUY M;  3U5Z B;  3GRU A;  4G4R A;  1C1K A;  3AFH A;  3PVS A;  2C5R A;  4FWH A;  2YFQ A;  3KOX E;  1NY6 A;  1JR3 D;  1IXS B;  1XHB A;  3ILK A;  3A98 B;  1R6B X;  4D82 A;  1DGF A;  3MK6 A;  2F5Q A;  2RGH A;  5BR8 M;  3H4M A;  1GVN A;  5BPV A;  3UGJ A;  4X62 M;  2D7G A;  3A46 A;  1IBK M;  3KS4 A;  3U61 A;  4DR7 M;  4RF0 A;  4IBJ A;  2F5O A;  2DVW B;  2Y20 A;  4JV5 M;  1OJL A;  4GMQ A;  2D7E A;  1WXQ A;  2X8A A;  4LF8 M;  3CF6 E;  4FCW A;  4LF5 M;  4OU7 A;  2YR0 A;  3E9S A;  3J27 B;  2DXI A;  5KPT A;  1IBL M;  3AOE A;  1J7K A;  2QEN A;  3Q8X A;  3FUT A;  3TWL A;  1PJI A;  1UM8 A;  3HJQ A;  4LF6 M;  1N32 M;  2CHQ A;  2FOI C;  3EIE A;  3I51 A;  2CHG A;  3HWS A;  3FYD A;  4WUR A;  2BNK A;  3KSX A;  3K2L A;  3GO8 A;  3HU3 A;  3SHG B;  4LF9 M;  2XFS A;  1GL6 A;  4QNM A;  4XGI A;  3RGP A;  2LNH C;  1SXJ D;  4ITQ A;  5ITR A;  4JI8 M;  2C9O A;  1TGU A;  2ERC A;  5LMN M;  2LXE A;  3HHX A;  4MGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...