2KRKA

Solution nmr structure of 26s protease regulatory subunit 8 from h.sapiens, northeast structural genomics consortium target target hr3102a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
b'MGHHHHHHSHPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 26S protease regulatory subunit 8
molecule tags Protein binding
source organism Homo sapiens
publication title Solution NMR Structure of 26S protease regulatory subunit 8 from H.sapiens, Northeast Structural Genomics Consortium Target HR3102A
rcsb
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2krkA01
1W5TA 2QBYB 1IM2A 1XXHA 4JN6A 4LJ6A 3SYLA 4EIWA 3SYKA 3WHKA 3GLIA 5EP1A 3R8FA 4QOSA 4QNMA 4LJ5A 1IN7A 2CHQA 4I81A 5DYIA 3U61B 2V6ZM 2VIIA 4KO8A 3M0EA 5JI2E 5FTLA 4L4UA 2DVWB 4QHSA 1DO2A 2DWZB 3CF0A 3HWSA 4LCBA 5FTJA 2CE7A 4FCTA 1JQJC 2QZ4A 1G3IA 4QHTA 2R65A 1KSFX 3GLGA 5EXTA 1HQCA 1JR3A 4LJ8A 1IN6A 5EP3A 2ZAMA 4WW0A 4FWGA 3PFIA 2CEAA 3AJIB 2QBYA 1QVRA 5C1BA 4LJ9A 4KLNA 4FWHA 1IXSB 3H4MA 2HCBA 2CHGA 3D8BA 2QENA 5EP4A 3HU1A 1X37A 1SXJB 1G4AE 3ZH9B 3KW6A 4LY6A 1IQPA 1C1KA 1W5SA 3VLFB 3WHLA 2BJWA 4LJAA 4QNRA 1UM8A 1OFHA 1SXJD 1HQYE 1HT2E 3M6AA 1E32A 5FTKA 1G41A 3PXGA 1SXJE 4L16A 3U5ZB 2XSZD 4L15A 4D81A 4D82A 1NJGA 1NJFA 1IN4A 1HT1E 4ZPXA 1XXHB 4LJ7A 1IXRC 1IN8A 2FNAA 1QZMA 3GLGB 1S3SA 1R7RA 2Z4RA 4KODA 2XSZA 3HU3A 3HU2A 1XWIA 4FCVA 5EXXA 2DZOB 1OJLA 1L8QA 5C18A 1FNNA 3PVSA 4LGMA 3VFDA 3EIEA 1IY1A 1OFIA 3DZDA 4I4LA 3GLIB 3SC3A 4FCWA 2X8AA 5JI3E 1J7KA 2V1UA 2ZAOA 2KRKA 3GLHB 4LJ4A 1NY5A 1SXJC 1NY6A 1IN5A 2C99A 3CF2A 4LRSA 1IXZA 1R6BX 1NSFA 1E94E 4FWDA 4GITA 2DZNB 5FTMA 4FW9A 1JR3D 2QP9X 3K1JA 2CHVA 5EQTA 5FTNA 2C9CA 1SXJA 3EIHA 2R62A 3MHVC 2DHRA 4LRTA 3B9PA 2C9OA 4D80A 1LV7A 2QPAA 1IY2A 3BOSA 5EXSA 1IY0A 4LZZA 4Z8XA 5DYGA 3GLFB 3UK6A 2ZANA 1NVMA 3GLFA 2Z4SA 1DO0A 3KDSE 4FD2A 3U60B 2RKOA 3GLHA 5EXPA 2C96A 2C98A 1D2NA 2BJVA 1KYIA 5EP2A 4A3VB
chains in the Genus database with same CATH superfamily
2KZUA 1IM2A 1XXHA 4JN6A 4Y28F 3SYKA 3WHKA 1JB0F 3LVVA 5IREB 4B7HA 4PDIA 1NV8A 1G71A 1IN7A 3HHXA 4I81A 3LMMA 4JI3M 3GLGE 4KO8A 2JY8A 1MX0A 4IBEA 2LHCA 4MGYE 3W68A 1WIVA 5KPRA 2K47A 1XB2B 3CF0A 3GLHE 1N77A 3A98B 2CE7A 2DAGA 3TL4X 4JI6M 2VF7A 1JQJC 1QAQA 4MGHA 1WR1B 4F1IA 3U6SA 1PJIA 3HY5A 3KOWE 4MGKE 4DV5M 1IN6A 5EP3A 2ZAMA 4WW0A 3VK8A 4PDGA 4JI1M 3C3EA 4DV1M 3PFIA 2R45A 2CEAA 2QBYA 1L2DA 1D0LA 1Y8GA 2G3QA 1Q3BA 2H5XA 4IBIA 4CGYB 4LJ9A 5H37D 5ITQA 4G4OA 1XC8A 1DGGA 1R2YA 1NO1A 2LVAA 3H4MA 4GH9A 3D8BA 2QENA 1UFZA 2ZTDA 3HU1A 1X37A 3T6PA 5E26A 4XGIA 4BBAA 3KW6A 3KOYE 1C1KA 4KHPM 3AOEA 2I7PA 4AKGA 1HNWM 5KPTA 4IBKA 2FFJA 3I01M 4LF9M 2QSFX 4Z6YA 3U6OA 1F4IA 1EIJA 3TWMA 2V1CA 1E32A 3FTCA 5FTKA 2WSEF 1N36M 3SARA 5BR8M 1G8PA 3KVWA 2LXEA 4AKIA 2QHOB 1NJGA 1IN4A 1A5TA 3Q8XA 1WJ7A 3SMSA 3QYEA 1GO5A 1DGBA 3GP1A 2LVQD 4LJ7A 1EE8A 1IN8A 2FNAA 2KW0A 4GC5A 1OIPA 2DNAA 3GPPA 4DR5M 2Z4RA 1PJTA 2EKFA 4LF7M 1T6OA 2UXDM 1OJLA 3LCUA 3FRIA 5C18A 4NRWA 3RFWA 2MH8A 3HKPA 3PVSA 1TH2A 1N75A 2XFTA 2D7HA 3EIEA 4DV4M 3A42A 1OFIA 2R18A 2Y20A 5KQ8A 4QOZC 1GABA 3RGSA 2J7NA 4IIWA 1TH3A 4GKKM 1H6UA 3TWLA 1J7KA 2Y0QA 2CWBA 3AFHA 2R4EA 1GKIA 1YLAA 3GLHB 4LJ4A 2DWLA 1LTMA 4AW4A 1NY6A 2C99A 2K0BX 1NSFA 2KNAA 3ILKA 3GLIE 3W67A 1TH4A 3FYDA 1R5LA 4M0WA 5EQTA 2QP9X 3K1JA 3LVWA 2R44A 1E9RA 3EIHA 4DR6M 1HJPA 2DHRA 3TWKA 2QCUA 4DR7M 4DBGB 3GO8A 2KNZA 2E5LM 3VDPA 1IY0A 4LZZA 1L2BA 1NHGC 3U6QA 2CUZA 3GLFB 3GRVA 2ZANA 2H1RA 2Z4SA 4FD2A 3MK6A 1BVSA 4UN2B 3U5ZA 4JI5M 3F92A 3GPUA 5EXPA 1TR8A 1N32M 4NC6A 3QYBA 2L4EA 3A45A 1HNZM 4LZJA 4A3VB 2QBYB 1JR3E 4DR3M 3C3DA 3PNVA 2KNVA 3K2LA 5ITYA 3GQ5A 4AG5A 5EP1A 3R8FA 4LJ5A 2F4VM 1ZV1A 2VF8A 4AZFA 4K0KM 3IG5A 2VIIA 2UU9M 2JXNA 3GPXA 3NWLA 2UUAM 5JI2E 3W0LB 3B7NA 1ZQ9A 5BPVA 2WSFF 4L4UA 4QHSA 3UZUA 2DWZB 1VQ1A 4R7GA 3L28A 4P17A 4X64M 1GLNA 1GL6A 2DHYA 1PJQA 5FTJA 2O5RA 3I4YA 3JR4A 3HHYA 3W0FA 1K3XA 4G3OA 3VKGA 4B7FA 1PGYA 4NRVA 5E6JA 3U6LA 4LFBM 3GLGA 3KSXA 4II7A 1HQCA 1JR3A 4JYAM 3SBJA 1RU3A 2LNHC 3CGWA 2G8LA 2QNJA 1P3QQ 4IJFA 4BLCA 4OVZB 4NXMM 4KLNA 5ITRA 2JUJA 4FWHA 4B3TM 1IXSB 2A5YB 2HCBA 3FUXA 3HJQA 4B08A 3GQ4A 3PNYA 1SXJB 1G4AE 4CJ6A 1MU5A 1W5SA 2JZ1A 3VK7A 4AQYM 3VLFB 5KQDA 1L2CA 4LJAA 4LGYA 2LHGA 4XK8F 1OFHA 1HQYE 3M6AA 1ZAEA 2L6OA 1N34M 4JV5M 4IJEA 2XSZD 4HLQA 2UXCM 2JNHA 4D82A 4WURA 1C7YA 3JAMS 1OKSA 4I8OA 4B3SM 1D0KA 1Z6TA 2MR9A 2XF3A 4XBOA 1XXHB 1IXRC 3BXWA 4TUWA 1OIZA 4IBGA 3K92A 1V33A 2XSZA 3HU3A 4CHTB 4MGZE 4FCVA 5EXXA 2DZOB 1L8QA 2HWJA 2YR0A 1PM5A 3IG8A 3VFDA 3U6PA 1QAMA 1IY1A 3BBZA 1QQWA 8CATA 2X49A 4I4LA 2EJSA 4JXJA 2LTUA 2X4AA 4FCWA 7CATA 2X8AA 2CFOA 1OAOC 5JI3E 3B89A 1WGLA 2LWXA 2KRKA 1NY5A 2Y21A 2XGNA 2J5YA 4JI7M 3KOXE 1MN3A 4LRSA 1R6BX 1E94E 3RE8A 4FWDA 4GITA 3HJSA 2HHHM 5FTMA 4FW9A 3KS8A 1JR3D 1NHWC 5IWAM 5FTNA 2RGHA 3B7QA 4LRTA 3IHPA 4ANRA 4Q7JA 3LCVB 1J5EM 4REZA 2OO9A 4D80A 4G6ZA 4PD2A 2YFQA 2DXIA 2QPAA 4JI8M 1IY2A 5A2QS 3KXEC 5F3WA 2KXEA 3HGIA 4MB7A 3U6MA 2DKLA 1Z59A 4L78A 2OQ4A 2WZJA 1DO0A 1V92A 3KDSE 4B3MM 1L1ZA 2N35A 2JA2A 1DGHA 1V34A 3E46A 4DV7M 2LH0A 3T1HM 2F5OA 1D2NA 3L29A 3ZC7B 4L8RC 3SYLA 2FS1A 2VQEM 3SAWA 3VKHA 2I7NA 3FUVA 4QOSA 5LMNM 4QNMA 3T1YM 1ORYB 2CHQA 2KA6B 4NSRA 5DYIA 3U61B 1XXHE 3L27A 1TDHA 4MM3B 3LW5F 2LVPC 1D0MA 2M60A 3M0EA 4IBCA 4I5SA 4OVZA 3KS4A 5FTLA 5FLXS 4OX9M 2LVNC 2XEPA 4M9SA 1DO2A 4LFAM 2JZ0A 2F5SA 4JI0M 5L8RF 4NXNM 2CV0A 2J7OA 3TPZA 4LG2A 2XH9A 1VEGA 3AKZA 1DGFA 2VQFM 3E21A 5KO3A 1VG5A 4DV3M 3UGJA 1G3IA 2ZTCA 4QHTA 1YSYA 3HHWA 1WXQA 2R65A 3FE3A 1KSFX 1NNUC 3VDUA 3HHZA 3SAUA 1TF0B 3U60A 1DV0A 3AV0A 4DV2M 2R46A 3U6DA 3U6CA 4S12A 2K6BA 4X66M 3KFUG 5DNYA 5ITUA 5EJCA 3HZJA 2Z8YM 1QVRA 4HL4A 3J7BA 1T3TA 2EUCA 3KOZE 1QAOA 5GKNA 3UJNA 3TE6A 3FTDA 2DAMA 2R6FA 2F5NA 1GJSA 1VDLA 1PJSA 2KDLA 3SFZA 4LFCM 1ZMUA 2LVOC 2HL7A 3ZH9B 3FUTA 2CRUA 2GNOA 1IQPA 4LF8M 2O01F 2AHMA 3J27B 3WHLA 2BJWA 3I51A 4QNRA 1SXJD 5KPZA 3GRUA 3UMMA 4W5WA 1G41A 1J09A 1IBKM 2P5TA 3THGA 4L15A 1QUTA 3KP0E 3T38A 3Q8GA 4OU7A 2CV2A 3FTFA 1VEJA 3U61A 1NJFA 3CF6E 4JI2M 2DAIA 3C58A 3GRYA 1L1TA 3ZCBB 1N33M 4M0DA 1R7RA 2CV1A 3HU2A 1SG9A 2CP8A 1R4GA 4RNAA 4AKHA 2DWMA 1TTEA 1NNJA 2UUCM 4IBFA 4IBJA 2WSCF 3I4VA 1GVNA 3DZDA 4G4QA 3GLIB 3SC3A 4DV0M 4X65M 1I94M 3T15A 3E4RA 2M5ZA 5IZ7D 2V1UA 2ZAOA 3SHFA 2R4JA 1OTRA 1SXJC 4RKUF 3B74A 3CF2A 3L26A 3SASA 4PCZA 4CISA 3FKEA 2LBCA 2F5PA 4M9XA 2F5QA 4FVMA 3GPYA 2BWEA 3SATA 2DZLA 2CHVA 2L7HA 3LQRA 4CIZA 1HNXM 2C9CA 3AOEC 1SXJA 4GIPA 2XFSA 3CTWB 4DR2M 2C5RA 1IBLM 3M7GA 3B9PA 3RGPA 2L09A 1VEKA 1YE9A 4GHAA 1WGNA 2HKJA 4ITQA 1QDRA 2ERCA 4B3RM 3BOSA 5EXSA 2XZUA 3B7ZA 2XLJA 4Z8XA 5DYGA 1QZEA 2EO2A 1NVMA 1AUAA 2RGOA 4YY3M 3GLFA 2DAEA 3A46A 3U60B 3NBIA 2MROB 4X62M 2RKOA 3GLHA 3FUUA 2W82A 3GQ3A 1Q3CA 2EKKA 1XNQM 3UK6A 2BJVA 4RF0A 1W5TA 4LJ6A 3GLIA 4EIWA 1ZMVA 2UUBM 3FTEA 2YNMD 1GL7A 3J7AS 2OOAA 3K9PA 4G4RA 3DFZA 4OW0A 4WP2A 3V76A 2K9DA 2V6ZM 4YHHM 4LF5M 4DV6M 3SMPA 3KP1E 3QAUA 2Z7JA 1XMQM 3FUWA 2APLA 2DVWB 1TGUA 2JP7A 4B7GA 2YQZA 1Q39A 3HWSA 4NSOB 4LCBA 4FCTA 2G5GX 2QZ4A 1Q02A 1Z5AA 3LQQA 2GQFA 2FH0A 1I4WA 2ZBKB 2Q2EB 3FRHA 2JY5A 3FYCA 5EXTA 1PRBA 1PJJA 1XNRM 2O25A 4LJ8A 1QYRA 2QQ8A 1QDTA 4FWGA 2D7GA 4DUYM 3NBXX 4M9ZA 3AJIB 4JI4M 5C1BA 4G4NA 2L7IA 4DR4M 1WHCA 2B3TA 2JWSA 3K9OA 3J2PB 2MJ5B 5FSWA 3L25A 2VDBB 2KRUA 2FE8A 2CHGA 1QUSA 4GMQA 4HEOA 4P16A 5EP4A 5ITTA 3GLFE 5IT9S 4MGIE 1CUKA 4LY6A 2JY6B 1T43A 4R71A 2MGWA 3K8ZA 4NOOB 1K3WA 1FJGM 3AOGA 2KHHA 3E9SA 5ITXA 1OQYA 1UM8A 1HT2E 2EA0A 3D8LA 1IFYA 3PXGA 1K82A 1SXJE 1QANA 2FOIC 3IECA 4L16A 4LF6M 3U5ZB 4D81A 2DAKA 1HR0M 3J80S 3GRRA 1Z5BA 3SHGB 1HT1E 3OTOM 2Z3XA 4ZPXA 3SAVA 2HAKA 2L4FA 3J81S 1QZMA 3DA1A 3GLGB 3DOAA 3L2AA 1S3SA 4KODA 2JY7A 4DUZM 2XZFA 1KFVA 2DWNA 4GKJM 1XWIA 1AIPC 1IXSA 4GEWA 1ZMWA 1FNNA 3KSJA 4LF4M 4PT5A 4LGMA 2Y0TA 3HJ8A 1XMOM 4R3DA 1GJTA 5ITXE 1G59A 4NL4H 2NQ8C 1VDDA 4RF1A 2KEBA 2OPFA 4MH0E 2R0IA 2BNKA 2L2DA 1XHBA 1IN5A 1IXZA 3C9PA 3MJ5A 4GHLA 2DZNB 4L6V6 2OOBA 3ZQJA 2D7EA 2UXBM 3I04M 2R62A 1Z5CA 1NV9A 1OAIA 3MHVC 3HX3A 2DENA 4GRIA 1MJGM 4AG6A 4BB9A 4IBDA 1E9SA 2C9OA 1TDZA 3MMPA 3QWLA 1LV7A 3AL0C 4F2LA 2ZM6M 3JR5A 1R2ZA 4IBBA 1EFUB 2DI0A 3R9XB 1YUBA 4KT0F 5DFLA 1N78A 2RRUA 4GC9A 2BWBA 3H4JA 4AI6A 1DGHB 3TQSA 2C96A 3U6EA 4DR1M 5LMUM 2C98A 2KZSA 3FD9A 1KYIA 1IBMM 5EP2A
chains in the Genus database with same CATH topology
2KZUA 1IM2A 1XXHA 4JN6A 3SYKA 3WHKA 3LVVA 5IREB 4B7HA 4PDIA 3HHXA 1IN7A 4I81A 3LMMA 4JI3M 4KO8A 1MX0A 4IBEA 4MGYE 5KPRA 2K47A 3CF0A 1N77A 3A98B 2CE7A 3TL4X 4JI6M 1JQJC 1QAQA 4MGHA 3U6SA 1PJIA 3KOWE 4MGKE 4DV5M 1IN6A 5EP3A 2ZAMA 4WW0A 3VK8A 4PDGA 4JI1M 3PFIA 2R45A 2CEAA 2QBYA 1L2DA 5ITQA 4IBIA 1Q3BA 4CGYB 5H37D 4LJ9A 4G4OA 1XC8A 1DGGA 1R2YA 3H4MA 4GH9A 3D8BA 2QENA 3HU1A 1X37A 5E26A 4XGIA 4BBAA 3KW6A 3KOYE 1C1KA 4KHPM 3AOEA 2I7PA 4AKGA 1HNWM 5KPTA 4IBKA 2FFJA 4LF9M 4Z6YA 3U6OA 3TWMA 2V1CA 1E32A 3FTCA 5FTKA 1N36M 3SARA 5BR8M 1G8PA 3KVWA 2LXEA 4AKIA 1NJGA 1IN4A 3Q8XA 3SMSA 1DGBA 3GP1A 4LJ7A 1EE8A 1IN8A 2FNAA 2KW0A 4GC5A 3GPPA 4DR5M 2Z4RA 4LF7M 2UXDM 1OJLA 5C18A 4NRWA 3RFWA 3HKPA 3PVSA 1TH2A 1N75A 2XFTA 2D7HA 3EIEA 4DV4M 3A42A 1OFIA 2R18A 2Y20A 5KQ8A 4QOZC 2J7NA 4IIWA 1TH3A 4GKKM 1H6UA 3TWLA 3AFHA 1J7KA 2Y0QA 2R4EA 1GKIA 3GLHB 4LJ4A 2DWLA 4AW4A 1NY6A 2C99A 1NSFA 3ILKA 1TH4A 3FYDA 4M0WA 5EQTA 3LVWA 2QP9X 3K1JA 1E9RA 3EIHA 4DR6M 2DHRA 3TWKA 2QCUA 4DR7M 3GO8A 2E5LM 3VDPA 1IY0A 4LZZA 1L2BA 1NHGC 3U6QA 2CUZA 3GLFB 3GRVA 2ZANA 2H1RA 2Z4SA 4FD2A 3MK6A 3U5ZA 4JI5M 3GPUA 5EXPA 1N32M 1HNZM 3A45A 4LZJA 4A3VB 2QBYB 4DR3M 3PNVA 5ITYA 3K2LA 3GQ5A 4AG5A 5EP1A 3R8FA 4LJ5A 2F4VM 4K0KM 4AZFA 3IG5A 2VIIA 2UU9M 3GPXA 3NWLA 2UUAM 5JI2E 3W0LB 1ZQ9A 5BPVA 4L4UA 3UZUA 4QHSA 2DWZB 4R7GA 3L28A 4X64M 1GLNA 1GL6A 5FTJA 2O5RA 3I4YA 3JR4A 3HHYA 3W0FA 1K3XA 3VKGA 4B7FA 4NRVA 5E6JA 3U6LA 4LFBM 3GLGA 3KSXA 4II7A 1HQCA 1JR3A 4JYAM 3SBJA 2LNHC 2G8LA 4IJFA 4BLCA 4OVZB 4NXMM 4KLNA 5ITRA 4FWHA 4B3TM 1IXSB 2A5YB 2HCBA 3FUXA 3HJQA 4B08A 3GQ4A 3PNYA 1SXJB 1G4AE 1MU5A 1W5SA 3VK7A 4AQYM 3VLFB 5KQDA 1L2CA 4LJAA 4LGYA 1OFHA 1HQYE 3M6AA 1ZAEA 2L6OA 1N34M 4JV5M 4IJEA 2XSZD 4HLQA 2UXCM 4D82A 4WURA 3JAMS 4I8OA 4B3SM 1Z6TA 2XF3A 4XBOA 1XXHB 1IXRC 4TUWA 4IBGA 3K92A 2XSZA 3HU3A 4CHTB 4MGZE 4FCVA 5EXXA 2DZOB 1L8QA 2YR0A 1PM5A 3IG8A 3VFDA 3U6PA 1QAMA 1IY1A 1QQWA 8CATA 2X49A 4I4LA 4JXJA 7CATA 2X4AA 4FCWA 2X8AA 2CFOA 5JI3E 2LWXA 2KRKA 1NY5A 2Y21A 2XGNA 4JI7M 3KOXE 4LRSA 1R6BX 1E94E 3RE8A 4FWDA 4GITA 3HJSA 2HHHM 5FTMA 4FW9A 3KS8A 1JR3D 1NHWC 5IWAM 5FTNA 2RGHA 4LRTA 1J5EM 4REZA 4PD2A 4D80A 4G6ZA 2DXIA 2YFQA 4JI8M 2QPAA 1IY2A 5A2QS 3KXEC 5F3WA 2KXEA 3HGIA 4MB7A 3U6MA 4L78A 1Z59A 2OQ4A 1DO0A 3KDSE 4B3MM 1L1ZA 2JA2A 1DGHA 4DV7M 2LH0A 3T1HM 2F5OA 3L29A 1D2NA 3ZC7B 4L8RC 3SYLA 2VQEM 3SAWA 3VKHA 2I7NA 3FUVA 4QOSA 5LMNM 4QNMA 3T1YM 1ORYB 2CHQA 2KA6B 4NSRA 5DYIA 3U61B 3L27A 1TDHA 4MM3B 2M60A 3M0EA 4IBCA 4I5SA 4OVZA 3KS4A 5FTLA 5FLXS 4OX9M 2XEPA 4M9SA 1DO2A 4LFAM 2F5SA 4JI0M 4NXNM 2CV0A 2J7OA 3TPZA 4LG2A 2XH9A 3AKZA 1DGFA 2VQFM 5KO3A 4DV3M 3UGJA 1G3IA 4QHTA 1YSYA 3HHWA 1WXQA 2R65A 3U60A 1KSFX 1NNUC 3VDUA 3HHZA 3SAUA 3AV0A 4DV2M 2R46A 3U6DA 3U6CA 4S12A 4X66M 3KFUG 5DNYA 5ITUA 5EJCA 1QVRA 4HL4A 3J7BA 1T3TA 2EUCA 3KOZE 1QAOA 5GKNA 3UJNA 3TE6A 3FTDA 2F5NA 3SFZA 4LFCM 2HL7A 3ZH9B 3FUTA 1IQPA 4LF8M 2AHMA 3J27B 3WHLA 2BJWA 3I51A 4QNRA 1SXJD 5KPZA 3GRUA 3UMMA 4W5WA 1G41A 1J09A 1IBKM 2P5TA 3THGA 4L15A 3KP0E 2CV2A 3T38A 4OU7A 3FTFA 3U61A 1NJFA 3CF6E 4JI2M 3C58A 3GRYA 1L1TA 3ZCBB 1N33M 4M0DA 1R7RA 2CV1A 3HU2A 4RNAA 4AKHA 2DWMA 1NNJA 2UUCM 4IBFA 4IBJA 3I4VA 1GVNA 3DZDA 4G4QA 3GLIB 3SC3A 4DV0M 4X65M 1I94M 3T15A 3E4RA 2M5ZA 5IZ7D 2V1UA 2ZAOA 3SHFA 2R4JA 1SXJC 3CF2A 3L26A 3SASA 4PCZA 4CISA 3FKEA 2F5PA 4M9XA 2F5QA 4FVMA 3GPYA 3SATA 1HNXM 2CHVA 2L7HA 3LQRA 2C9CA 3AOEC 1SXJA 4GIPA 2XFSA 3CTWB 4DR2M 2C5RA 1IBLM 3M7GA 3B9PA 3RGPA 2L09A 1YE9A 4GHAA 2HKJA 4ITQA 2ERCA 4B3RM 3BOSA 5EXSA 2XZUA 2XLJA 4Z8XA 5DYGA 1NVMA 2EO2A 2RGOA 4YY3M 3GLFA 3A46A 3U60B 3NBIA 4X62M 2RKOA 3GLHA 3FUUA 2W82A 3GQ3A 1Q3CA 1XNQM 3UK6A 2BJVA 4RF0A 1W5TA 4LJ6A 3GLIA 4EIWA 2UUBM 3FTEA 2YNMD 1GL7A 3J7AS 4G4RA 3DFZA 4OW0A 2V6ZM 4YHHM 4LF5M 3SMPA 3KP1E 3QAUA 2Z7JA 1XMQM 3FUWA 2DVWB 1TGUA 4B7GA 2YQZA 1Q39A 3HWSA 4NSOB 4LCBA 4FCTA 2G5GX 2QZ4A 3RGSA 1Z5AA 3LQQA 4DV1M 1I4WA 2ZBKB 2Q2EB 5EXTA 3FYCA 1PJJA 1XNRM 4LJ8A 1QYRA 4FWGA 2D7GA 4DUYM 4M9ZA 3AJIB 4JI4M 5C1BA 4G4NA 2L7IA 4DR4M 5FSWA 3L25A 3J2PB 2KRUA 2FE8A 2CHGA 4GMQA 5EP4A 4P16A 5ITTA 5IT9S 4MGIE 4LY6A 3K8ZA 4NOOB 1K3WA 1FJGM 3AOGA 3E9SA 5ITXA 1UM8A 1HT2E 2EA0A 3D8LA 3PXGA 1K82A 1SXJE 1QANA 2FOIC 4L16A 4LF6M 3U5ZB 4D81A 1HR0M 3J80S 3GRRA 1Z5BA 3SHGB 1HT1E 3OTOM 2Z3XA 4ZPXA 3SAVA 3J81S 3GLGB 1QZMA 3DA1A 3DOAA 3L2AA 1S3SA 4KODA 4DUZM 2XZFA 1KFVA 2DWNA 4GKJM 1XWIA 1FNNA 3KSJA 4LF4M 4PT5A 4LGMA 2Y0TA 3HJ8A 1XMOM 4R3DA 5ITXE 1G59A 4NL4H 2NQ8C 1VDDA 4RF1A 2KEBA 2OPFA 4MH0E 2BNKA 1XHBA 1IN5A 1IXZA 3MJ5A 4GHLA 2DZNB 2D7EA 2UXBM 2R62A 1Z5CA 3MHVC 4DV6M 4AG6A 4GRIA 4BB9A 1TDZA 4IBDA 1E9SA 2C9OA 3QWLA 1LV7A 3AL0C 2ZM6M 3JR5A 1R2ZA 4IBBA 3R9XB 1YUBA 1N78A 4GC9A 4AI6A 1DGHB 3TQSA 2C96A 3U6EA 4DR1M 5LMUM 2C98A 2KZSA 3FD9A 1KYIA 1IBMM 5EP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W5T A;  2QBY B;  1IM2 A;  1XXH A;  4JN6 A;  4LJ6 A;  3SYL A;  4EIW A;  3SYK A;  3WHK A;  3GLI A;  5EP1 A;  3R8F A;  4QOS A;  4QNM A;  4LJ5 A;  1IN7 A;  2CHQ A;  4I81 A;  5DYI A;  3U61 B;  2V6Z M;  2VII A;  4KO8 A;  3M0E A;  5JI2 E;  5FTL A;  4L4U A;  2DVW B;  4QHS A;  1DO2 A;  2DWZ B;  3CF0 A;  3HWS A;  4LCB A;  5FTJ A;  2CE7 A;  4FCT A;  1JQJ C;  2QZ4 A;  1G3I A;  4QHT A;  2R65 A;  1KSF X;  3GLG A;  5EXT A;  1HQC A;  1JR3 A;  4LJ8 A;  1IN6 A;  5EP3 A;  2ZAM A;  4WW0 A;  4FWG A;  3PFI A;  2CEA A;  3AJI B;  2QBY A;  1QVR A;  5C1B A;  4LJ9 A;  4KLN A;  4FWH A;  1IXS B;  3H4M A;  2HCB A;  2CHG A;  3D8B A;  2QEN A;  5EP4 A;  3HU1 A;  1X37 A;  1SXJ B;  1G4A E;  3ZH9 B;  3KW6 A;  4LY6 A;  1IQP A;  1C1K A;  1W5S A;  3VLF B;  3WHL A;  2BJW A;  4LJA A;  4QNR A;  1UM8 A;  1OFH A;  1SXJ D;  1HQY E;  1HT2 E;  3M6A A;  1E32 A;  5FTK A;  1G41 A;  3PXG A;  1SXJ E;  4L16 A;  3U5Z B;  2XSZ D;  4L15 A;  4D81 A;  4D82 A;  1NJG A;  1NJF A;  1IN4 A;  1HT1 E;  4ZPX A;  1XXH B;  4LJ7 A;  1IXR C;  1IN8 A;  2FNA A;  1QZM A;  3GLG B;  1S3S A;  1R7R A;  2Z4R A;  4KOD A;  2XSZ A;  3HU3 A;  3HU2 A;  1XWI A;  4FCV A;  5EXX A;  2DZO B;  1OJL A;  1L8Q A;  5C18 A;  1FNN A;  3PVS A;  4LGM A;  3VFD A;  3EIE A;  1IY1 A;  1OFI A;  3DZD A;  4I4L A;  3GLI B;  3SC3 A;  4FCW A;  2X8A A;  5JI3 E;  1J7K A;  2V1U A;  2ZAO A;  2KRK A;  3GLH B;  4LJ4 A;  1NY5 A;  1SXJ C;  1NY6 A;  1IN5 A;  2C99 A;  3CF2 A;  4LRS A;  1IXZ A;  1R6B X;  1NSF A;  1E94 E;  4FWD A;  4GIT A;  2DZN B;  5FTM A;  4FW9 A;  1JR3 D;  2QP9 X;  3K1J A;  2CHV A;  5EQT A;  5FTN A;  2C9C A;  1SXJ A;  3EIH A;  2R62 A;  3MHV C;  2DHR A;  4LRT A;  3B9P A;  2C9O A;  4D80 A;  1LV7 A;  2QPA A;  1IY2 A;  3BOS A;  5EXS A;  1IY0 A;  4LZZ A;  4Z8X A;  5DYG A;  3GLF B;  3UK6 A;  2ZAN A;  1NVM A;  3GLF A;  2Z4S A;  1DO0 A;  3KDS E;  4FD2 A;  3U60 B;  2RKO A;  3GLH A;  5EXP A;  2C96 A;  2C98 A;  1D2N A;  2BJV A;  1KYI A;  5EP2 A;  4A3V B; 
#chains in the Genus database with same CATH topology
 2KZU A;  1IM2 A;  1XXH A;  4JN6 A;  4Y28 F;  3SYK A;  3WHK A;  1JB0 F;  3LVV A;  5IRE B;  4B7H A;  4PDI A;  1NV8 A;  1G71 A;  1IN7 A;  3HHX A;  4I81 A;  3LMM A;  4JI3 M;  3GLG E;  4KO8 A;  2JY8 A;  1MX0 A;  4IBE A;  2LHC A;  4MGY E;  3W68 A;  1WIV A;  5KPR A;  2K47 A;  1XB2 B;  3CF0 A;  3GLH E;  1N77 A;  3A98 B;  2CE7 A;  2DAG A;  3TL4 X;  4JI6 M;  2VF7 A;  1JQJ C;  1QAQ A;  4MGH A;  1WR1 B;  4F1I A;  3U6S A;  1PJI A;  3HY5 A;  3KOW E;  4MGK E;  4DV5 M;  1IN6 A;  5EP3 A;  2ZAM A;  4WW0 A;  3VK8 A;  4PDG A;  4JI1 M;  3C3E A;  4DV1 M;  3PFI A;  2R45 A;  2CEA A;  2QBY A;  1L2D A;  1D0L A;  1Y8G A;  2G3Q A;  1Q3B A;  2H5X A;  4IBI A;  4CGY B;  4LJ9 A;  5H37 D;  5ITQ A;  4G4O A;  1XC8 A;  1DGG A;  1R2Y A;  1NO1 A;  2LVA A;  3H4M A;  4GH9 A;  3D8B A;  2QEN A;  1UFZ A;  2ZTD A;  3HU1 A;  1X37 A;  3T6P A;  5E26 A;  4XGI A;  4BBA A;  3KW6 A;  3KOY E;  1C1K A;  4KHP M;  3AOE A;  2I7P A;  4AKG A;  1HNW M;  5KPT A;  4IBK A;  2FFJ A;  3I01 M;  4LF9 M;  2QSF X;  4Z6Y A;  3U6O A;  1F4I A;  1EIJ A;  3TWM A;  2V1C A;  1E32 A;  3FTC A;  5FTK A;  2WSE F;  1N36 M;  3SAR A;  5BR8 M;  1G8P A;  3KVW A;  2LXE A;  4AKI A;  2QHO B;  1NJG A;  1IN4 A;  1A5T A;  3Q8X A;  1WJ7 A;  3SMS A;  3QYE A;  1GO5 A;  1DGB A;  3GP1 A;  2LVQ D;  4LJ7 A;  1EE8 A;  1IN8 A;  2FNA A;  2KW0 A;  4GC5 A;  1OIP A;  2DNA A;  3GPP A;  4DR5 M;  2Z4R A;  1PJT A;  2EKF A;  4LF7 M;  1T6O A;  2UXD M;  1OJL A;  3LCU A;  3FRI A;  5C18 A;  4NRW A;  3RFW A;  2MH8 A;  3HKP A;  3PVS A;  1TH2 A;  1N75 A;  2XFT A;  2D7H A;  3EIE A;  4DV4 M;  3A42 A;  1OFI A;  2R18 A;  2Y20 A;  5KQ8 A;  4QOZ C;  1GAB A;  3RGS A;  2J7N A;  4IIW A;  1TH3 A;  4GKK M;  1H6U A;  3TWL A;  1J7K A;  2Y0Q A;  2CWB A;  3AFH A;  2R4E A;  1GKI A;  1YLA A;  3GLH B;  4LJ4 A;  2DWL A;  1LTM A;  4AW4 A;  1NY6 A;  2C99 A;  2K0B X;  1NSF A;  2KNA A;  3ILK A;  3GLI E;  3W67 A;  1TH4 A;  3FYD A;  1R5L A;  4M0W A;  5EQT A;  2QP9 X;  3K1J A;  3LVW A;  2R44 A;  1E9R A;  3EIH A;  4DR6 M;  1HJP A;  2DHR A;  3TWK A;  2QCU A;  4DR7 M;  4DBG B;  3GO8 A;  2KNZ A;  2E5L M;  3VDP A;  1IY0 A;  4LZZ A;  1L2B A;  1NHG C;  3U6Q A;  2CUZ A;  3GLF B;  3GRV A;  2ZAN A;  2H1R A;  2Z4S A;  4FD2 A;  3MK6 A;  1BVS A;  4UN2 B;  3U5Z A;  4JI5 M;  3F92 A;  3GPU A;  5EXP A;  1TR8 A;  1N32 M;  4NC6 A;  3QYB A;  2L4E A;  3A45 A;  1HNZ M;  4LZJ A;  4A3V B;  2QBY B;  1JR3 E;  4DR3 M;  3C3D A;  3PNV A;  2KNV A;  3K2L A;  5ITY A;  3GQ5 A;  4AG5 A;  5EP1 A;  3R8F A;  4LJ5 A;  2F4V M;  1ZV1 A;  2VF8 A;  4AZF A;  4K0K M;  3IG5 A;  2VII A;  2UU9 M;  2JXN A;  3GPX A;  3NWL A;  2UUA M;  5JI2 E;  3W0L B;  3B7N A;  1ZQ9 A;  5BPV A;  2WSF F;  4L4U A;  4QHS A;  3UZU A;  2DWZ B;  1VQ1 A;  4R7G A;  3L28 A;  4P17 A;  4X64 M;  1GLN A;  1GL6 A;  2DHY A;  1PJQ A;  5FTJ A;  2O5R A;  3I4Y A;  3JR4 A;  3HHY A;  3W0F A;  1K3X A;  4G3O A;  3VKG A;  4B7F A;  1PGY A;  4NRV A;  5E6J A;  3U6L A;  4LFB M;  3GLG A;  3KSX A;  4II7 A;  1HQC A;  1JR3 A;  4JYA M;  3SBJ A;  1RU3 A;  2LNH C;  3CGW A;  2G8L A;  2QNJ A;  1P3Q Q;  4IJF A;  4BLC A;  4OVZ B;  4NXM M;  4KLN A;  5ITR A;  2JUJ A;  4FWH A;  4B3T M;  1IXS B;  2A5Y B;  2HCB A;  3FUX A;  3HJQ A;  4B08 A;  3GQ4 A;  3PNY A;  1SXJ B;  1G4A E;  4CJ6 A;  1MU5 A;  1W5S A;  2JZ1 A;  3VK7 A;  4AQY M;  3VLF B;  5KQD A;  1L2C A;  4LJA A;  4LGY A;  2LHG A;  4XK8 F;  1OFH A;  1HQY E;  3M6A A;  1ZAE A;  2L6O A;  1N34 M;  4JV5 M;  4IJE A;  2XSZ D;  4HLQ A;  2UXC M;  2JNH A;  4D82 A;  4WUR A;  1C7Y A;  3JAM S;  1OKS A;  4I8O A;  4B3S M;  1D0K A;  1Z6T A;  2MR9 A;  2XF3 A;  4XBO A;  1XXH B;  1IXR C;  3BXW A;  4TUW A;  1OIZ A;  4IBG A;  3K92 A;  1V33 A;  2XSZ A;  3HU3 A;  4CHT B;  4MGZ E;  4FCV A;  5EXX A;  2DZO B;  1L8Q A;  2HWJ A;  2YR0 A;  1PM5 A;  3IG8 A;  3VFD A;  3U6P A;  1QAM A;  1IY1 A;  3BBZ A;  1QQW A;  8CAT A;  2X49 A;  4I4L A;  2EJS A;  4JXJ A;  2LTU A;  2X4A A;  4FCW A;  7CAT A;  2X8A A;  2CFO A;  1OAO C;  5JI3 E;  3B89 A;  1WGL A;  2LWX A;  2KRK A;  1NY5 A;  2Y21 A;  2XGN A;  2J5Y A;  4JI7 M;  3KOX E;  1MN3 A;  4LRS A;  1R6B X;  1E94 E;  3RE8 A;  4FWD A;  4GIT A;  3HJS A;  2HHH M;  5FTM A;  4FW9 A;  3KS8 A;  1JR3 D;  1NHW C;  5IWA M;  5FTN A;  2RGH A;  3B7Q A;  4LRT A;  3IHP A;  4ANR A;  4Q7J A;  3LCV B;  1J5E M;  4REZ A;  2OO9 A;  4D80 A;  4G6Z A;  4PD2 A;  2YFQ A;  2DXI A;  2QPA A;  4JI8 M;  1IY2 A;  5A2Q S;  3KXE C;  5F3W A;  2KXE A;  3HGI A;  4MB7 A;  3U6M A;  2DKL A;  1Z59 A;  4L78 A;  2OQ4 A;  2WZJ A;  1DO0 A;  1V92 A;  3KDS E;  4B3M M;  1L1Z A;  2N35 A;  2JA2 A;  1DGH A;  1V34 A;  3E46 A;  4DV7 M;  2LH0 A;  3T1H M;  2F5O A;  1D2N A;  3L29 A;  3ZC7 B;  4L8R C;  3SYL A;  2FS1 A;  2VQE M;  3SAW A;  3VKH A;  2I7N A;  3FUV A;  4QOS A;  5LMN M;  4QNM A;  3T1Y M;  1ORY B;  2CHQ A;  2KA6 B;  4NSR A;  5DYI A;  3U61 B;  1XXH E;  3L27 A;  1TDH A;  4MM3 B;  3LW5 F;  2LVP C;  1D0M A;  2M60 A;  3M0E A;  4IBC A;  4I5S A;  4OVZ A;  3KS4 A;  5FTL A;  5FLX S;  4OX9 M;  2LVN C;  2XEP A;  4M9S A;  1DO2 A;  4LFA M;  2JZ0 A;  2F5S A;  4JI0 M;  5L8R F;  4NXN M;  2CV0 A;  2J7O A;  3TPZ A;  4LG2 A;  2XH9 A;  1VEG A;  3AKZ A;  1DGF A;  2VQF M;  3E21 A;  5KO3 A;  1VG5 A;  4DV3 M;  3UGJ A;  1G3I A;  2ZTC A;  4QHT A;  1YSY A;  3HHW A;  1WXQ A;  2R65 A;  3FE3 A;  1KSF X;  1NNU C;  3VDU A;  3HHZ A;  3SAU A;  1TF0 B;  3U60 A;  1DV0 A;  3AV0 A;  4DV2 M;  2R46 A;  3U6D A;  3U6C A;  4S12 A;  2K6B A;  4X66 M;  3KFU G;  5DNY A;  5ITU A;  5EJC A;  3HZJ A;  2Z8Y M;  1QVR A;  4HL4 A;  3J7B A;  1T3T A;  2EUC A;  3KOZ E;  1QAO A;  5GKN A;  3UJN A;  3TE6 A;  3FTD A;  2DAM A;  2R6F A;  2F5N A;  1GJS A;  1VDL A;  1PJS A;  2KDL A;  3SFZ A;  4LFC M;  1ZMU A;  2LVO C;  2HL7 A;  3ZH9 B;  3FUT A;  2CRU A;  2GNO A;  1IQP A;  4LF8 M;  2O01 F;  2AHM A;  3J27 B;  3WHL A;  2BJW A;  3I51 A;  4QNR A;  1SXJ D;  5KPZ A;  3GRU A;  3UMM A;  4W5W A;  1G41 A;  1J09 A;  1IBK M;  2P5T A;  3THG A;  4L15 A;  1QUT A;  3KP0 E;  3T38 A;  3Q8G A;  4OU7 A;  2CV2 A;  3FTF A;  1VEJ A;  3U61 A;  1NJF A;  3CF6 E;  4JI2 M;  2DAI A;  3C58 A;  3GRY A;  1L1T A;  3ZCB B;  1N33 M;  4M0D A;  1R7R A;  2CV1 A;  3HU2 A;  1SG9 A;  2CP8 A;  1R4G A;  4RNA A;  4AKH A;  2DWM A;  1TTE A;  1NNJ A;  2UUC M;  4IBF A;  4IBJ A;  2WSC F;  3I4V A;  1GVN A;  3DZD A;  4G4Q A;  3GLI B;  3SC3 A;  4DV0 M;  4X65 M;  1I94 M;  3T15 A;  3E4R A;  2M5Z A;  5IZ7 D;  2V1U A;  2ZAO A;  3SHF A;  2R4J A;  1OTR A;  1SXJ C;  4RKU F;  3B74 A;  3CF2 A;  3L26 A;  3SAS A;  4PCZ A;  4CIS A;  3FKE A;  2LBC A;  2F5P A;  4M9X A;  2F5Q A;  4FVM A;  3GPY A;  2BWE A;  3SAT A;  2DZL A;  2CHV A;  2L7H A;  3LQR A;  4CIZ A;  1HNX M;  2C9C A;  3AOE C;  1SXJ A;  4GIP A;  2XFS A;  3CTW B;  4DR2 M;  2C5R A;  1IBL M;  3M7G A;  3B9P A;  3RGP A;  2L09 A;  1VEK A;  1YE9 A;  4GHA A;  1WGN A;  2HKJ A;  4ITQ A;  1QDR A;  2ERC A;  4B3R M;  3BOS A;  5EXS A;  2XZU A;  3B7Z A;  2XLJ A;  4Z8X A;  5DYG A;  1QZE A;  2EO2 A;  1NVM A;  1AUA A;  2RGO A;  4YY3 M;  3GLF A;  2DAE A;  3A46 A;  3U60 B;  3NBI A;  2MRO B;  4X62 M;  2RKO A;  3GLH A;  3FUU A;  2W82 A;  3GQ3 A;  1Q3C A;  2EKK A;  1XNQ M;  3UK6 A;  2BJV A;  4RF0 A;  1W5T A;  4LJ6 A;  3GLI A;  4EIW A;  1ZMV A;  2UUB M;  3FTE A;  2YNM D;  1GL7 A;  3J7A S;  2OOA A;  3K9P A;  4G4R A;  3DFZ A;  4OW0 A;  4WP2 A;  3V76 A;  2K9D A;  2V6Z M;  4YHH M;  4LF5 M;  4DV6 M;  3SMP A;  3KP1 E;  3QAU A;  2Z7J A;  1XMQ M;  3FUW A;  2APL A;  2DVW B;  1TGU A;  2JP7 A;  4B7G A;  2YQZ A;  1Q39 A;  3HWS A;  4NSO B;  4LCB A;  4FCT A;  2G5G X;  2QZ4 A;  1Q02 A;  1Z5A A;  3LQQ A;  2GQF A;  2FH0 A;  1I4W A;  2ZBK B;  2Q2E B;  3FRH A;  2JY5 A;  3FYC A;  5EXT A;  1PRB A;  1PJJ A;  1XNR M;  2O25 A;  4LJ8 A;  1QYR A;  2QQ8 A;  1QDT A;  4FWG A;  2D7G A;  4DUY M;  3NBX X;  4M9Z A;  3AJI B;  4JI4 M;  5C1B A;  4G4N A;  2L7I A;  4DR4 M;  1WHC A;  2B3T A;  2JWS A;  3K9O A;  3J2P B;  2MJ5 B;  5FSW A;  3L25 A;  2VDB B;  2KRU A;  2FE8 A;  2CHG A;  1QUS A;  4GMQ A;  4HEO A;  4P16 A;  5EP4 A;  5ITT A;  3GLF E;  5IT9 S;  4MGI E;  1CUK A;  4LY6 A;  2JY6 B;  1T43 A;  4R71 A;  2MGW A;  3K8Z A;  4NOO B;  1K3W A;  1FJG M;  3AOG A;  2KHH A;  3E9S A;  5ITX A;  1OQY A;  1UM8 A;  1HT2 E;  2EA0 A;  3D8L A;  1IFY A;  3PXG A;  1K82 A;  1SXJ E;  1QAN A;  2FOI C;  3IEC A;  4L16 A;  4LF6 M;  3U5Z B;  4D81 A;  2DAK A;  1HR0 M;  3J80 S;  3GRR A;  1Z5B A;  3SHG B;  1HT1 E;  3OTO M;  2Z3X A;  4ZPX A;  3SAV A;  2HAK A;  2L4F A;  3J81 S;  1QZM A;  3DA1 A;  3GLG B;  3DOA A;  3L2A A;  1S3S A;  4KOD A;  2JY7 A;  4DUZ M;  2XZF A;  1KFV A;  2DWN A;  4GKJ M;  1XWI A;  1AIP C;  1IXS A;  4GEW A;  1ZMW A;  1FNN A;  3KSJ A;  4LF4 M;  4PT5 A;  4LGM A;  2Y0T A;  3HJ8 A;  1XMO M;  4R3D A;  1GJT A;  5ITX E;  1G59 A;  4NL4 H;  2NQ8 C;  1VDD A;  4RF1 A;  2KEB A;  2OPF A;  4MH0 E;  2R0I A;  2BNK A;  2L2D A;  1XHB A;  1IN5 A;  1IXZ A;  3C9P A;  3MJ5 A;  4GHL A;  2DZN B;  4L6V 6;  2OOB A;  3ZQJ A;  2D7E A;  2UXB M;  3I04 M;  2R62 A;  1Z5C A;  1NV9 A;  1OAI A;  3MHV C;  3HX3 A;  2DEN A;  4GRI A;  1MJG M;  4AG6 A;  4BB9 A;  4IBD A;  1E9S A;  2C9O A;  1TDZ A;  3MMP A;  3QWL A;  1LV7 A;  3AL0 C;  4F2L A;  2ZM6 M;  3JR5 A;  1R2Z A;  4IBB A;  1EFU B;  2DI0 A;  3R9X B;  1YUB A;  4KT0 F;  5DFL A;  1N78 A;  2RRU A;  4GC9 A;  2BWB A;  3H4J A;  4AI6 A;  1DGH B;  3TQS A;  2C96 A;  3U6E A;  4DR1 M;  5LMU M;  2C98 A;  2KZS A;  3FD9 A;  1KYI A;  1IBM M;  5EP2 A; 
#chains in the Genus database with same CATH homology
 2KZU A;  1IM2 A;  1XXH A;  4JN6 A;  3SYK A;  3WHK A;  3LVV A;  5IRE B;  4B7H A;  4PDI A;  3HHX A;  1IN7 A;  4I81 A;  3LMM A;  4JI3 M;  4KO8 A;  1MX0 A;  4IBE A;  4MGY E;  5KPR A;  2K47 A;  3CF0 A;  1N77 A;  3A98 B;  2CE7 A;  3TL4 X;  4JI6 M;  1JQJ C;  1QAQ A;  4MGH A;  3U6S A;  1PJI A;  3KOW E;  4MGK E;  4DV5 M;  1IN6 A;  5EP3 A;  2ZAM A;  4WW0 A;  3VK8 A;  4PDG A;  4JI1 M;  3PFI A;  2R45 A;  2CEA A;  2QBY A;  1L2D A;  5ITQ A;  4IBI A;  1Q3B A;  4CGY B;  5H37 D;  4LJ9 A;  4G4O A;  1XC8 A;  1DGG A;  1R2Y A;  3H4M A;  4GH9 A;  3D8B A;  2QEN A;  3HU1 A;  1X37 A;  5E26 A;  4XGI A;  4BBA A;  3KW6 A;  3KOY E;  1C1K A;  4KHP M;  3AOE A;  2I7P A;  4AKG A;  1HNW M;  5KPT A;  4IBK A;  2FFJ A;  4LF9 M;  4Z6Y A;  3U6O A;  3TWM A;  2V1C A;  1E32 A;  3FTC A;  5FTK A;  1N36 M;  3SAR A;  5BR8 M;  1G8P A;  3KVW A;  2LXE A;  4AKI A;  1NJG A;  1IN4 A;  3Q8X A;  3SMS A;  1DGB A;  3GP1 A;  4LJ7 A;  1EE8 A;  1IN8 A;  2FNA A;  2KW0 A;  4GC5 A;  3GPP A;  4DR5 M;  2Z4R A;  4LF7 M;  2UXD M;  1OJL A;  5C18 A;  4NRW A;  3RFW A;  3HKP A;  3PVS A;  1TH2 A;  1N75 A;  2XFT A;  2D7H A;  3EIE A;  4DV4 M;  3A42 A;  1OFI A;  2R18 A;  2Y20 A;  5KQ8 A;  4QOZ C;  2J7N A;  4IIW A;  1TH3 A;  4GKK M;  1H6U A;  3TWL A;  3AFH A;  1J7K A;  2Y0Q A;  2R4E A;  1GKI A;  3GLH B;  4LJ4 A;  2DWL A;  4AW4 A;  1NY6 A;  2C99 A;  1NSF A;  3ILK A;  1TH4 A;  3FYD A;  4M0W A;  5EQT A;  3LVW A;  2QP9 X;  3K1J A;  1E9R A;  3EIH A;  4DR6 M;  2DHR A;  3TWK A;  2QCU A;  4DR7 M;  3GO8 A;  2E5L M;  3VDP A;  1IY0 A;  4LZZ A;  1L2B A;  1NHG C;  3U6Q A;  2CUZ A;  3GLF B;  3GRV A;  2ZAN A;  2H1R A;  2Z4S A;  4FD2 A;  3MK6 A;  3U5Z A;  4JI5 M;  3GPU A;  5EXP A;  1N32 M;  1HNZ M;  3A45 A;  4LZJ A;  4A3V B;  2QBY B;  4DR3 M;  3PNV A;  5ITY A;  3K2L A;  3GQ5 A;  4AG5 A;  5EP1 A;  3R8F A;  4LJ5 A;  2F4V M;  4K0K M;  4AZF A;  3IG5 A;  2VII A;  2UU9 M;  3GPX A;  3NWL A;  2UUA M;  5JI2 E;  3W0L B;  1ZQ9 A;  5BPV A;  4L4U A;  3UZU A;  4QHS A;  2DWZ B;  4R7G A;  3L28 A;  4X64 M;  1GLN A;  1GL6 A;  5FTJ A;  2O5R A;  3I4Y A;  3JR4 A;  3HHY A;  3W0F A;  1K3X A;  3VKG A;  4B7F A;  4NRV A;  5E6J A;  3U6L A;  4LFB M;  3GLG A;  3KSX A;  4II7 A;  1HQC A;  1JR3 A;  4JYA M;  3SBJ A;  2LNH C;  2G8L A;  4IJF A;  4BLC A;  4OVZ B;  4NXM M;  4KLN A;  5ITR A;  4FWH A;  4B3T M;  1IXS B;  2A5Y B;  2HCB A;  3FUX A;  3HJQ A;  4B08 A;  3GQ4 A;  3PNY A;  1SXJ B;  1G4A E;  1MU5 A;  1W5S A;  3VK7 A;  4AQY M;  3VLF B;  5KQD A;  1L2C A;  4LJA A;  4LGY A;  1OFH A;  1HQY E;  3M6A A;  1ZAE A;  2L6O A;  1N34 M;  4JV5 M;  4IJE A;  2XSZ D;  4HLQ A;  2UXC M;  4D82 A;  4WUR A;  3JAM S;  4I8O A;  4B3S M;  1Z6T A;  2XF3 A;  4XBO A;  1XXH B;  1IXR C;  4TUW A;  4IBG A;  3K92 A;  2XSZ A;  3HU3 A;  4CHT B;  4MGZ E;  4FCV A;  5EXX A;  2DZO B;  1L8Q A;  2YR0 A;  1PM5 A;  3IG8 A;  3VFD A;  3U6P A;  1QAM A;  1IY1 A;  1QQW A;  8CAT A;  2X49 A;  4I4L A;  4JXJ A;  7CAT A;  2X4A A;  4FCW A;  2X8A A;  2CFO A;  5JI3 E;  2LWX A;  2KRK A;  1NY5 A;  2Y21 A;  2XGN A;  4JI7 M;  3KOX E;  4LRS A;  1R6B X;  1E94 E;  3RE8 A;  4FWD A;  4GIT A;  3HJS A;  2HHH M;  5FTM A;  4FW9 A;  3KS8 A;  1JR3 D;  1NHW C;  5IWA M;  5FTN A;  2RGH A;  4LRT A;  1J5E M;  4REZ A;  4PD2 A;  4D80 A;  4G6Z A;  2DXI A;  2YFQ A;  4JI8 M;  2QPA A;  1IY2 A;  5A2Q S;  3KXE C;  5F3W A;  2KXE A;  3HGI A;  4MB7 A;  3U6M A;  4L78 A;  1Z59 A;  2OQ4 A;  1DO0 A;  3KDS E;  4B3M M;  1L1Z A;  2JA2 A;  1DGH A;  4DV7 M;  2LH0 A;  3T1H M;  2F5O A;  3L29 A;  1D2N A;  3ZC7 B;  4L8R C;  3SYL A;  2VQE M;  3SAW A;  3VKH A;  2I7N A;  3FUV A;  4QOS A;  5LMN M;  4QNM A;  3T1Y M;  1ORY B;  2CHQ A;  2KA6 B;  4NSR A;  5DYI A;  3U61 B;  3L27 A;  1TDH A;  4MM3 B;  2M60 A;  3M0E A;  4IBC A;  4I5S A;  4OVZ A;  3KS4 A;  5FTL A;  5FLX S;  4OX9 M;  2XEP A;  4M9S A;  1DO2 A;  4LFA M;  2F5S A;  4JI0 M;  4NXN M;  2CV0 A;  2J7O A;  3TPZ A;  4LG2 A;  2XH9 A;  3AKZ A;  1DGF A;  2VQF M;  5KO3 A;  4DV3 M;  3UGJ A;  1G3I A;  4QHT A;  1YSY A;  3HHW A;  1WXQ A;  2R65 A;  3U60 A;  1KSF X;  1NNU C;  3VDU A;  3HHZ A;  3SAU A;  3AV0 A;  4DV2 M;  2R46 A;  3U6D A;  3U6C A;  4S12 A;  4X66 M;  3KFU G;  5DNY A;  5ITU A;  5EJC A;  1QVR A;  4HL4 A;  3J7B A;  1T3T A;  2EUC A;  3KOZ E;  1QAO A;  5GKN A;  3UJN A;  3TE6 A;  3FTD A;  2F5N A;  3SFZ A;  4LFC M;  2HL7 A;  3ZH9 B;  3FUT A;  1IQP A;  4LF8 M;  2AHM A;  3J27 B;  3WHL A;  2BJW A;  3I51 A;  4QNR A;  1SXJ D;  5KPZ A;  3GRU A;  3UMM A;  4W5W A;  1G41 A;  1J09 A;  1IBK M;  2P5T A;  3THG A;  4L15 A;  3KP0 E;  2CV2 A;  3T38 A;  4OU7 A;  3FTF A;  3U61 A;  1NJF A;  3CF6 E;  4JI2 M;  3C58 A;  3GRY A;  1L1T A;  3ZCB B;  1N33 M;  4M0D A;  1R7R A;  2CV1 A;  3HU2 A;  4RNA A;  4AKH A;  2DWM A;  1NNJ A;  2UUC M;  4IBF A;  4IBJ A;  3I4V A;  1GVN A;  3DZD A;  4G4Q A;  3GLI B;  3SC3 A;  4DV0 M;  4X65 M;  1I94 M;  3T15 A;  3E4R A;  2M5Z A;  5IZ7 D;  2V1U A;  2ZAO A;  3SHF A;  2R4J A;  1SXJ C;  3CF2 A;  3L26 A;  3SAS A;  4PCZ A;  4CIS A;  3FKE A;  2F5P A;  4M9X A;  2F5Q A;  4FVM A;  3GPY A;  3SAT A;  1HNX M;  2CHV A;  2L7H A;  3LQR A;  2C9C A;  3AOE C;  1SXJ A;  4GIP A;  2XFS A;  3CTW B;  4DR2 M;  2C5R A;  1IBL M;  3M7G A;  3B9P A;  3RGP A;  2L09 A;  1YE9 A;  4GHA A;  2HKJ A;  4ITQ A;  2ERC A;  4B3R M;  3BOS A;  5EXS A;  2XZU A;  2XLJ A;  4Z8X A;  5DYG A;  1NVM A;  2EO2 A;  2RGO A;  4YY3 M;  3GLF A;  3A46 A;  3U60 B;  3NBI A;  4X62 M;  2RKO A;  3GLH A;  3FUU A;  2W82 A;  3GQ3 A;  1Q3C A;  1XNQ M;  3UK6 A;  2BJV A;  4RF0 A;  1W5T A;  4LJ6 A;  3GLI A;  4EIW A;  2UUB M;  3FTE A;  2YNM D;  1GL7 A;  3J7A S;  4G4R A;  3DFZ A;  4OW0 A;  2V6Z M;  4YHH M;  4LF5 M;  3SMP A;  3KP1 E;  3QAU A;  2Z7J A;  1XMQ M;  3FUW A;  2DVW B;  1TGU A;  4B7G A;  2YQZ A;  1Q39 A;  3HWS A;  4NSO B;  4LCB A;  4FCT A;  2G5G X;  2QZ4 A;  3RGS A;  1Z5A A;  3LQQ A;  4DV1 M;  1I4W A;  2ZBK B;  2Q2E B;  5EXT A;  3FYC A;  1PJJ A;  1XNR M;  4LJ8 A;  1QYR A;  4FWG A;  2D7G A;  4DUY M;  4M9Z A;  3AJI B;  4JI4 M;  5C1B A;  4G4N A;  2L7I A;  4DR4 M;  5FSW A;  3L25 A;  3J2P B;  2KRU A;  2FE8 A;  2CHG A;  4GMQ A;  5EP4 A;  4P16 A;  5ITT A;  5IT9 S;  4MGI E;  4LY6 A;  3K8Z A;  4NOO B;  1K3W A;  1FJG M;  3AOG A;  3E9S A;  5ITX A;  1UM8 A;  1HT2 E;  2EA0 A;  3D8L A;  3PXG A;  1K82 A;  1SXJ E;  1QAN A;  2FOI C;  4L16 A;  4LF6 M;  3U5Z B;  4D81 A;  1HR0 M;  3J80 S;  3GRR A;  1Z5B A;  3SHG B;  1HT1 E;  3OTO M;  2Z3X A;  4ZPX A;  3SAV A;  3J81 S;  3GLG B;  1QZM A;  3DA1 A;  3DOA A;  3L2A A;  1S3S A;  4KOD A;  4DUZ M;  2XZF A;  1KFV A;  2DWN A;  4GKJ M;  1XWI A;  1FNN A;  3KSJ A;  4LF4 M;  4PT5 A;  4LGM A;  2Y0T A;  3HJ8 A;  1XMO M;  4R3D A;  5ITX E;  1G59 A;  4NL4 H;  2NQ8 C;  1VDD A;  4RF1 A;  2KEB A;  2OPF A;  4MH0 E;  2BNK A;  1XHB A;  1IN5 A;  1IXZ A;  3MJ5 A;  4GHL A;  2DZN B;  2D7E A;  2UXB M;  2R62 A;  1Z5C A;  3MHV C;  4DV6 M;  4AG6 A;  4GRI A;  4BB9 A;  1TDZ A;  4IBD A;  1E9S A;  2C9O A;  3QWL A;  1LV7 A;  3AL0 C;  2ZM6 M;  3JR5 A;  1R2Z A;  4IBB A;  3R9X B;  1YUB A;  1N78 A;  4GC9 A;  4AI6 A;  1DGH B;  3TQS A;  2C96 A;  3U6E A;  4DR1 M;  5LMU M;  2C98 A;  2KZS A;  3FD9 A;  1KYI A;  1IBM M;  5EP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...